Symbol:
Lst1
Name:
leukocyte specific transcript 1
RGD ID:
620077
Description:
Predicted to be involved in dendrite development and negative regulation of lymphocyte proliferation. Predicted to be located in cytosol and plasma membrane. Predicted to be active in membrane. Human ortholog(s) of this gene implicated in graft-versus-host disease. Orthologous to human LST1 (leukocyte specific transcript 1); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
B144; leucocyte specific transcript 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 3,639,353 - 3,644,399 (+) NCBI GRCr8 mRatBN7.2 20 3,634,680 - 3,639,731 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 3,634,749 - 3,637,997 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 4,334,461 - 4,337,695 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 3,696,519 - 3,699,751 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 4,234,124 - 4,237,360 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 5,175,213 - 5,179,352 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 5,176,016 - 5,179,263 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 7,248,563 - 7,252,609 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 3,698,568 - 3,701,564 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 3,698,794 - 3,701,713 (+) NCBI Celera 20 4,387,819 - 4,391,014 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lst1 Rat (E)-thiamethoxam increases expression ISO Lst1 (Mus musculus) 6480464 Thiamethoxam results in increased expression of LST1 mRNA CTD PMID:33533595 Lst1 Rat 1,2-dimethylhydrazine increases expression ISO Lst1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of LST1 mRNA CTD PMID:22206623 Lst1 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of LST1 mRNA CTD PMID:32741896 Lst1 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of LST1 mRNA CTD PMID:32741896 Lst1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of LST1 mRNA] CTD PMID:21215274 Lst1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of LST1 mRNA CTD PMID:27913140 Lst1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Lst1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of LST1 mRNA CTD PMID:21570461 Lst1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of LST1 mRNA CTD PMID:21215274 and PMID:34747641 Lst1 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Lst1 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of LST1 mRNA CTD PMID:17982090 Lst1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Lst1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Lst1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Lst1 (Mus musculus) 6480464 bisphenol S results in decreased expression of LST1 mRNA CTD PMID:39298647 Lst1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO LST1 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of LST1 gene CTD PMID:31601247 Lst1 Rat 4-hydroxyphenyl retinamide increases expression ISO Lst1 (Mus musculus) 6480464 Fenretinide results in increased expression of LST1 mRNA CTD PMID:28973697 Lst1 Rat 5-aza-2'-deoxycytidine increases expression ISO LST1 (Homo sapiens) 6480464 Decitabine results in increased expression of LST1 mRNA CTD PMID:19194470 Lst1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of LST1 mRNA CTD PMID:31881176 Lst1 Rat aldehydo-D-glucose multiple interactions ISO Lst1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of LST1 mRNA CTD PMID:37567420 Lst1 Rat all-trans-retinoic acid increases expression ISO LST1 (Homo sapiens) 6480464 Tretinoin results in increased expression of LST1 mRNA CTD PMID:15498508 more ... Lst1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of LST1 mRNA CTD PMID:35163327 Lst1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of LST1 mRNA CTD PMID:16483693 Lst1 Rat antirheumatic drug decreases expression ISO LST1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of LST1 mRNA CTD PMID:24449571 Lst1 Rat aristolochic acid A increases expression ISO LST1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of LST1 mRNA CTD PMID:33212167 Lst1 Rat arsane affects methylation ISO LST1 (Homo sapiens) 6480464 Arsenic affects the methylation of LST1 gene CTD PMID:25304211 Lst1 Rat arsenic atom affects methylation ISO LST1 (Homo sapiens) 6480464 Arsenic affects the methylation of LST1 gene CTD PMID:25304211 Lst1 Rat benzalkonium chloride increases expression ISO Lst1 (Mus musculus) 6480464 Benzalkonium Compounds results in increased expression of LST1 mRNA CTD PMID:30171875 Lst1 Rat benzo[a]pyrene decreases expression ISO Lst1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of LST1 mRNA CTD PMID:21569818 Lst1 Rat benzo[a]pyrene increases methylation ISO LST1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of LST1 promoter CTD PMID:27901495 Lst1 Rat benzo[a]pyrene multiple interactions ISO Lst1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of LST1 mRNA CTD PMID:27858113 Lst1 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of LST1 mRNA CTD PMID:21839799 Lst1 Rat benzo[b]fluoranthene increases expression ISO Lst1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of LST1 mRNA CTD PMID:26377693 Lst1 Rat benzo[b]fluoranthene multiple interactions ISO Lst1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of LST1 mRNA CTD PMID:27858113 Lst1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LST1 mRNA CTD PMID:25181051 Lst1 Rat bisphenol A decreases methylation ISO LST1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of LST1 gene CTD PMID:31601247 Lst1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of LST1 mRNA CTD PMID:32145629 Lst1 Rat bortezomib decreases expression ISO LST1 (Homo sapiens) 6480464 Bortezomib results in decreased expression of LST1 mRNA CTD PMID:20977926 Lst1 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of LST1 mRNA CTD PMID:32479839 Lst1 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of LST1 promoter CTD PMID:22457795 Lst1 Rat cadmium dichloride decreases expression ISO LST1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of LST1 mRNA CTD PMID:38382870 Lst1 Rat carbon nanotube decreases expression ISO Lst1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Lst1 Rat carbon nanotube increases expression ISO Lst1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Lst1 Rat chrysene multiple interactions ISO Lst1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of LST1 mRNA CTD PMID:27858113 Lst1 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of LST1 mRNA CTD PMID:30556269 Lst1 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of LST1 mRNA CTD PMID:30556269 Lst1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of LST1 mRNA CTD PMID:27523638 Lst1 Rat D-glucose multiple interactions ISO Lst1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of LST1 mRNA CTD PMID:37567420 Lst1 Rat diuron decreases expression ISO LST1 (Homo sapiens) 6480464 Diuron results in decreased expression of LST1 mRNA CTD PMID:35967413 Lst1 Rat dorsomorphin multiple interactions ISO LST1 (Homo sapiens) 6480464 [NOG protein co-treated with Mercuric Chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of LST1 mRNA CTD PMID:27188386 Lst1 Rat ferric oxide decreases expression ISO Lst1 (Mus musculus) 6480464 ferric oxide analog results in decreased expression of LST1 mRNA CTD PMID:24525745 Lst1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of LST1 mRNA CTD PMID:24136188 Lst1 Rat fructose multiple interactions ISO Lst1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of LST1 mRNA CTD PMID:37567420 Lst1 Rat fulvestrant multiple interactions ISO LST1 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of LST1 gene CTD PMID:31601247 Lst1 Rat glucose multiple interactions ISO Lst1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of LST1 mRNA CTD PMID:37567420 Lst1 Rat glyphosate multiple interactions ISO Lst1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of LST1 mRNA CTD PMID:37567420 Lst1 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of LST1 mRNA CTD PMID:35283115 Lst1 Rat mercury dichloride multiple interactions ISO LST1 (Homo sapiens) 6480464 [NOG protein co-treated with Mercuric Chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of LST1 mRNA CTD PMID:27188386 Lst1 Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of LST1 mRNA CTD PMID:31378766 Lst1 Rat nickel atom increases expression ISO LST1 (Homo sapiens) 6480464 Nickel results in increased expression of LST1 mRNA CTD PMID:25583101 Lst1 Rat ozone decreases expression ISO Lst1 (Mus musculus) 6480464 Ozone results in decreased expression of LST1 mRNA CTD PMID:17095637 Lst1 Rat ozone multiple interactions ISO Lst1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of LST1 mRNA CTD PMID:34911549 Lst1 Rat paracetamol affects expression ISO Lst1 (Mus musculus) 6480464 Acetaminophen affects the expression of LST1 mRNA CTD PMID:17562736 Lst1 Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of LST1 mRNA CTD PMID:18692542 Lst1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of LST1 mRNA CTD PMID:35163327 Lst1 Rat pirinixic acid multiple interactions ISO Lst1 (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in decreased expression of LST1 mRNA CTD PMID:20813756 Lst1 Rat pirinixic acid decreases expression ISO Lst1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of LST1 mRNA CTD PMID:20813756 Lst1 Rat propanal increases expression ISO LST1 (Homo sapiens) 6480464 propionaldehyde results in increased expression of LST1 mRNA CTD PMID:26079696 Lst1 Rat resveratrol multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of LST1 mRNA CTD PMID:25905778 Lst1 Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of LST1 mRNA CTD PMID:25905778 Lst1 Rat SB 431542 multiple interactions ISO LST1 (Homo sapiens) 6480464 [NOG protein co-treated with Mercuric Chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of LST1 mRNA CTD PMID:27188386 Lst1 Rat sodium dichromate decreases expression ISO LST1 (Homo sapiens) 6480464 sodium bichromate results in decreased expression of LST1 mRNA CTD PMID:17685462 Lst1 Rat streptozocin multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of LST1 mRNA CTD PMID:25905778 Lst1 Rat sulforaphane increases expression ISO LST1 (Homo sapiens) 6480464 sulforaphane results in increased expression of LST1 mRNA CTD PMID:26833863 Lst1 Rat tamibarotene increases expression ISO LST1 (Homo sapiens) 6480464 tamibarotene results in increased expression of LST1 mRNA CTD PMID:15498508 Lst1 Rat testosterone increases expression ISO LST1 (Homo sapiens) 6480464 Testosterone results in increased expression of LST1 mRNA CTD PMID:33359661 Lst1 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of LST1 mRNA CTD PMID:32741896 Lst1 Rat testosterone increases expression ISO Lst1 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of LST1 mRNA CTD PMID:33848595 Lst1 Rat tetraphene multiple interactions ISO Lst1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of LST1 mRNA CTD PMID:27858113 Lst1 Rat tetrathiomolybdate(2-) increases expression ISO LST1 (Homo sapiens) 6480464 tetrathiomolybdate results in increased expression of LST1 mRNA CTD PMID:37290678 Lst1 Rat theophylline increases expression ISO LST1 (Homo sapiens) 6480464 Theophylline results in increased expression of LST1 mRNA CTD PMID:16083514 Lst1 Rat thiamethoxam increases expression ISO Lst1 (Mus musculus) 6480464 Thiamethoxam results in increased expression of LST1 mRNA CTD PMID:33533595 Lst1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of LST1 mRNA CTD PMID:23411599 Lst1 Rat titanium dioxide increases expression ISO Lst1 (Mus musculus) 6480464 titanium dioxide results in increased expression of LST1 mRNA CTD PMID:23557971 Lst1 Rat titanium dioxide decreases expression ISO Lst1 (Mus musculus) 6480464 titanium dioxide analog results in decreased expression of LST1 mRNA CTD PMID:25111187 Lst1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of LST1 mRNA CTD PMID:33387578 Lst1 Rat triphenyl phosphate affects expression ISO LST1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of LST1 mRNA CTD PMID:37042841 Lst1 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of LST1 gene CTD PMID:31079544
(E)-thiamethoxam (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) acetamide (EXP) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzalkonium chloride (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) bortezomib (ISO) bromobenzene (EXP) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) chrysene (ISO) copper atom (EXP) copper(0) (EXP) Cuprizon (EXP) D-glucose (ISO) diuron (ISO) dorsomorphin (ISO) ferric oxide (ISO) flutamide (EXP) fructose (ISO) fulvestrant (ISO) glucose (ISO) glyphosate (ISO) lidocaine (EXP) mercury dichloride (ISO) methylmercury chloride (EXP) nickel atom (ISO) ozone (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (EXP) pirinixic acid (ISO) propanal (ISO) resveratrol (EXP) SB 431542 (ISO) sodium dichromate (ISO) streptozocin (EXP) sulforaphane (ISO) tamibarotene (ISO) testosterone (EXP,ISO) tetraphene (ISO) tetrathiomolybdate(2-) (ISO) theophylline (ISO) thiamethoxam (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) vinclozolin (EXP)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
The genomic sequence and comparative analysis of the rat major histocompatibility complex.
Hurt P, etal., Genome Res 2004 Apr;14(4):631-9.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Cytokine gene polymorphisms associating with severe acute graft-versus-host disease in HLA-identical sibling transplants.
Middleton PG, etal., Blood. 1998 Nov 15;92(10):3943-8.
5.
LST1 and NCR3 expression in autoimmune inflammation and in response to IFN-gamma, LPS and microbial infection.
Mulcahy H, etal., Immunogenetics. 2006 Jan;57(12):893-903. Epub 2005 Dec 17.
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
A new member of the Ig superfamily and a V-ATPase G subunit are among the predicted products of novel genes close to the TNF locus in the human MHC.
Neville MJ and Campbell RD, J Immunol 1999 Apr 15;162(8):4745-54.
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Comprehensive gene review and curation
RGD comprehensive gene curation
Lst1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 3,639,353 - 3,644,399 (+) NCBI GRCr8 mRatBN7.2 20 3,634,680 - 3,639,731 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 3,634,749 - 3,637,997 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 4,334,461 - 4,337,695 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 3,696,519 - 3,699,751 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 4,234,124 - 4,237,360 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 5,175,213 - 5,179,352 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 5,176,016 - 5,179,263 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 7,248,563 - 7,252,609 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 3,698,568 - 3,701,564 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 3,698,794 - 3,701,713 (+) NCBI Celera 20 4,387,819 - 4,391,014 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
LST1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 31,586,277 - 31,588,909 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 31,586,124 - 31,588,909 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 31,554,054 - 31,556,686 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 31,661,950 - 31,664,665 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 31,661,949 - 31,664,664 NCBI Celera 6 33,152,171 - 33,154,901 (+) NCBI Celera Cytogenetic Map 6 p21.33 NCBI HuRef 6 31,340,690 - 31,343,417 (+) NCBI HuRef CHM1_1 6 31,556,091 - 31,558,821 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 31,439,327 - 31,441,957 (+) NCBI T2T-CHM13v2.0
Lst1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 35,404,071 - 35,407,416 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 35,404,071 - 35,407,415 (-) Ensembl GRCm39 Ensembl GRCm38 17 35,185,095 - 35,188,440 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 35,185,095 - 35,188,439 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 35,322,040 - 35,325,385 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 34,793,147 - 34,796,492 (-) NCBI MGSCv36 mm8 Celera 17 38,282,028 - 38,285,369 (-) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 18.59 NCBI
Lst1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955437 127,430 - 129,835 (+) NCBI ChiLan1.0 ChiLan1.0
LST1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 46,058,087 - 46,065,828 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 42,019,663 - 42,027,402 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 31,242,230 - 31,249,961 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 32,137,214 - 32,139,995 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 32,137,214 - 32,139,995 (+) Ensembl panpan1.1 panPan2
LST1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 1,084,739 - 1,086,182 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 1,221,123 - 1,222,617 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 1,229,927 - 1,231,422 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 1,230,026 - 1,231,352 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 1,088,656 - 1,090,142 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 1,156,602 - 1,158,089 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 1,223,402 - 1,224,931 (+) NCBI UU_Cfam_GSD_1.0
Lst1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 35,634,852 - 35,636,745 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936727 1,924,681 - 1,925,977 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936727 1,924,599 - 1,928,169 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LST1
LST1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666044 31,488,975 - 31,491,841 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lst1
.
Predicted Target Of
Count of predictions: 69 Count of miRNA genes: 57 Interacting mature miRNAs: 60 Transcripts: ENSRNOT00000065940 Prediction methods: Microtar, Rnahybrid Result types: miRGate_prediction
61472 Aia1 Adjuvant induced arthritis QTL 1 18 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 2646395 4597031 Rat 2306850 Pia40 Pristane induced arthritis QTL 40 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 1527959 5304575 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 61448 Ciaa1 CIA Autoantibody QTL 1 30 0.001 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 20 2646395 4597031 Rat 1331772 Cdexp2 CD45RC expression in CD8 T cells QTL 2 5.7 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 20 3621649 10078919 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 1300152 Bp195 Blood pressure QTL 195 3.46 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 3621649 9243559 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat 737973 Pia21 Pristane induced arthritis QTL 21 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 4606812 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
7
45
101
91
90
59
25
59
6
210
92
81
45
57
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000065940 ⟹ ENSRNOP00000060414
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 3,634,801 - 3,637,997 (+) Ensembl Rnor_6.0 Ensembl 20 5,176,016 - 5,179,217 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000092443 ⟹ ENSRNOP00000075782
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 3,634,801 - 3,637,919 (+) Ensembl Rnor_6.0 Ensembl 20 5,176,016 - 5,179,263 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119251 ⟹ ENSRNOP00000085666
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 3,634,749 - 3,637,919 (+) Ensembl
RefSeq Acc Id:
NM_022634 ⟹ NP_072156
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,639,474 - 3,642,669 (+) NCBI mRatBN7.2 20 3,634,801 - 3,637,997 (+) NCBI Rnor_6.0 20 5,176,016 - 5,179,211 (-) NCBI Rnor_5.0 20 7,248,563 - 7,252,609 (-) NCBI RGSC_v3.4 20 3,698,568 - 3,701,564 (+) RGD Celera 20 4,387,819 - 4,391,014 (-) RGD
Sequence:
ATGACAAGAATGCCACCTTGTGACTGGGGAGAGGCACTCAAGACATGGGGCTGTAAGGATCTGAAGTTCACCAATACTTGGCTACTAGAGAAACAGTGTTACCTGCTGTTGGGGAGCCTGGTACTGGG
hide sequence
RefSeq Acc Id:
XM_006256078 ⟹ XP_006256140
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,639,355 - 3,644,399 (+) NCBI mRatBN7.2 20 3,634,684 - 3,639,731 (+) NCBI Rnor_6.0 20 5,175,213 - 5,179,352 (-) NCBI Rnor_5.0 20 7,248,563 - 7,252,609 (-) NCBI
Sequence:
AGGATTGTAACAGAGCCCCTTGCCTCAGAGATGGGGAACTTGGGGACACGTGACTAACCCAAGG
hide sequence
RefSeq Acc Id:
XM_006256080 ⟹ XP_006256142
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,639,353 - 3,642,669 (+) NCBI mRatBN7.2 20 3,634,680 - 3,637,997 (+) NCBI Rnor_6.0 20 5,176,016 - 5,179,351 (-) NCBI Rnor_5.0 20 7,248,563 - 7,252,609 (-) NCBI
Sequence:
GGATTGTAACAGAGCCCCTTGCCTCAGAGATGGGGAACTTGGGGACACGTGACTAACCCAAGGC
hide sequence
RefSeq Acc Id:
XM_063279496 ⟹ XP_063135566
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,639,353 - 3,644,399 (+) NCBI
RefSeq Acc Id:
NP_072156 ⟸ NM_022634
- UniProtKB:
Q6MG46 (UniProtKB/TrEMBL), E9PST7 (UniProtKB/TrEMBL), A0A9K3Y6U3 (UniProtKB/TrEMBL), Q9QXI4 (UniProtKB/TrEMBL)
- Sequence:
MTRMPPCDWGEALKTWGCKDLKFTNTWLLEKQCYLLLGSLVLGGLLLLLVIILFACLCRFYQRVKRLERNAQVSGQELHYASLQKLPASSSDMEGRGEGEGVKEDASTDYACIVLNKPN
hide sequence
RefSeq Acc Id:
XP_006256140 ⟸ XM_006256078
- Peptide Label:
isoform X1
- UniProtKB:
Q6MG46 (UniProtKB/TrEMBL), E9PST7 (UniProtKB/TrEMBL), A0A9K3Y6U3 (UniProtKB/TrEMBL), Q9QXI4 (UniProtKB/TrEMBL)
- Sequence:
MTRMPPCDWGEALKTWGCKDLKFTNTWLLEKQCYLLLGSLVLGGLLLLLVIILFACLCRFYQRVKRLERNAQVSGQELHYASLQKLPASSSDMEGRGEGEGVKEDASTDYACIVLNKPN
hide sequence
RefSeq Acc Id:
XP_006256142 ⟸ XM_006256080
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A4K1 (UniProtKB/TrEMBL)
- Sequence:
MTRMPPCDWGEEKQCYLLLGSLVLGGLLLLLVIILFACLCRFYQRVKRLERNAQVSGQELHYASLQKLPASSSDMEGRGEGEGVKEDASTDYACIVLNKPN
hide sequence
Ensembl Acc Id:
ENSRNOP00000075782 ⟸ ENSRNOT00000092443
Ensembl Acc Id:
ENSRNOP00000060414 ⟸ ENSRNOT00000065940
Ensembl Acc Id:
ENSRNOP00000085666 ⟸ ENSRNOT00000119251
RefSeq Acc Id:
XP_063135566 ⟸ XM_063279496
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A4K1 (UniProtKB/TrEMBL)
RGD ID: 13701403 Promoter ID: EPDNEW_R11925 Type: multiple initiation site Name: Lst1_1 Description: leukocyte specific transcript 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 5,179,258 - 5,179,318 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-22
Lst1
leukocyte specific transcript 1
Lst1
leucocyte specific transcript 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Lst1
leucocyte specific transcript 1
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Lst1
leucocyte specific transcript 1
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_mapping
found within the rat major histocompatibility RT1 complex
1300431
