Symbol:
Zhx1
Name:
zinc fingers and homeoboxes 1
RGD ID:
620010
Description:
Enables DNA binding activity. Involved in regulation of DNA-templated transcription. Located in nucleus. Orthologous to human ZHX1 (zinc fingers and homeoboxes 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4-tert-Octylphenol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
zinc finger and homeodomain protein 1; zinc fingers and homeoboxes protein 1; zinc-fingers and homeoboxes 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 91,472,193 - 91,501,984 (-) NCBI GRCr8 mRatBN7.2 7 89,582,363 - 89,611,337 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 89,582,243 - 89,611,264 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 91,459,215 - 91,487,312 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 93,660,497 - 93,688,594 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 93,478,605 - 93,506,719 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 97,915,280 - 97,944,787 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 97,915,581 - 97,944,491 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 98,521,607 - 98,550,754 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 94,753,899 - 94,775,384 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 94,788,129 - 94,809,611 (-) NCBI Celera 7 86,354,706 - 86,382,874 (-) NCBI Celera Cytogenetic Map 7 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Zhx1 Rat 1,2-dimethylhydrazine decreases expression ISO Zhx1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ZHX1 mRNA CTD PMID:22206623 Zhx1 Rat 17beta-estradiol increases expression ISO ZHX1 (Homo sapiens) 6480464 Estradiol results in increased expression of ZHX1 mRNA CTD PMID:31614463 Zhx1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Zhx1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ZHX1 mRNA CTD PMID:21570461 and PMID:24058054 Zhx1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ZHX1 mRNA CTD PMID:33387578 Zhx1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ZHX1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ZHX1 mRNA CTD PMID:29704546 Zhx1 Rat 4-tert-Octylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of ZHX1 mRNA CTD PMID:17011747 Zhx1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ZHX1 mRNA CTD PMID:30047161 Zhx1 Rat all-trans-retinoic acid increases expression ISO ZHX1 (Homo sapiens) 6480464 Tretinoin results in increased expression of ZHX1 mRNA CTD PMID:21934132 Zhx1 Rat all-trans-retinoic acid decreases expression ISO ZHX1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of ZHX1 mRNA CTD PMID:33167477 Zhx1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of ZHX1 mRNA CTD PMID:30047161 Zhx1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ZHX1 mRNA CTD PMID:16483693 Zhx1 Rat antimycin A decreases expression ISO Zhx1 (Mus musculus) 6480464 Antimycin A results in decreased expression of ZHX1 mRNA CTD PMID:19304788 Zhx1 Rat antirheumatic drug increases expression ISO ZHX1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of ZHX1 mRNA CTD PMID:24449571 Zhx1 Rat benzo[a]pyrene increases expression ISO Zhx1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ZHX1 mRNA CTD PMID:22228805 Zhx1 Rat benzo[a]pyrene decreases methylation ISO ZHX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ZHX1 promoter CTD PMID:27901495 Zhx1 Rat beta-lapachone increases expression ISO ZHX1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ZHX1 mRNA CTD PMID:38218311 Zhx1 Rat beta-lapachone decreases expression ISO ZHX1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of ZHX1 mRNA CTD PMID:38218311 Zhx1 Rat bisphenol A affects methylation ISO Zhx1 (Mus musculus) 6480464 bisphenol A affects the methylation of ZHX1 promoter CTD PMID:27334623 Zhx1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ZHX1 mRNA CTD PMID:30816183 Zhx1 Rat bisphenol F increases expression ISO Zhx1 (Mus musculus) 6480464 bisphenol F results in increased expression of ZHX1 mRNA CTD PMID:38685157 Zhx1 Rat copper(II) sulfate decreases expression ISO ZHX1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ZHX1 mRNA CTD PMID:19549813 Zhx1 Rat coumarin increases phosphorylation ISO ZHX1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of ZHX1 protein CTD PMID:35688186 Zhx1 Rat cyclosporin A decreases expression ISO Zhx1 (Mus musculus) 6480464 Cyclosporine results in decreased expression of ZHX1 mRNA CTD PMID:19770486 Zhx1 Rat cyclosporin A decreases expression ISO ZHX1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ZHX1 mRNA CTD PMID:25562108 Zhx1 Rat diazinon increases methylation ISO ZHX1 (Homo sapiens) 6480464 Diazinon results in increased methylation of ZHX1 gene CTD PMID:22964155 Zhx1 Rat dichloromethane affects expression ISO Zhx1 (Mus musculus) 6480464 Methylene Chloride affects the expression of ZHX1 mRNA CTD PMID:28392392 Zhx1 Rat dichloromethane increases expression ISO Zhx1 (Mus musculus) 6480464 Methylene Chloride results in increased expression of ZHX1 mRNA CTD PMID:28392392 Zhx1 Rat dicrotophos decreases expression ISO ZHX1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of ZHX1 mRNA CTD PMID:28302478 Zhx1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of ZHX1 mRNA CTD PMID:17011747 Zhx1 Rat dorsomorphin multiple interactions ISO ZHX1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Zhx1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ZHX1 mRNA CTD PMID:29391264 Zhx1 Rat entinostat decreases expression ISO ZHX1 (Homo sapiens) 6480464 entinostat results in decreased expression of ZHX1 mRNA CTD PMID:26272509 Zhx1 Rat entinostat multiple interactions ISO ZHX1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ZHX1 mRNA CTD PMID:27188386 Zhx1 Rat ethanol multiple interactions ISO Zhx1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of ZHX1 mRNA CTD PMID:30319688 Zhx1 Rat ethanol affects expression ISO Zhx1 (Mus musculus) 6480464 Ethanol affects the expression of ZHX1 mRNA CTD PMID:30319688 Zhx1 Rat folic acid decreases expression ISO Zhx1 (Mus musculus) 6480464 Folic Acid results in decreased expression of ZHX1 mRNA CTD PMID:25629700 Zhx1 Rat formaldehyde increases expression ISO ZHX1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of ZHX1 mRNA CTD PMID:23649840 Zhx1 Rat FR900359 affects phosphorylation ISO ZHX1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of ZHX1 protein CTD PMID:37730182 Zhx1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ZHX1 mRNA CTD PMID:33387578 Zhx1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of ZHX1 mRNA CTD PMID:30047161 Zhx1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ZHX1 gene CTD PMID:35440735 Zhx1 Rat methyl methanesulfonate increases expression ISO ZHX1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of ZHX1 mRNA CTD PMID:23649840 Zhx1 Rat methylmercury chloride decreases expression ISO ZHX1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of ZHX1 mRNA CTD PMID:28001369 Zhx1 Rat methylparaben decreases expression ISO ZHX1 (Homo sapiens) 6480464 methylparaben results in decreased expression of ZHX1 mRNA CTD PMID:31745603 Zhx1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of ZHX1 mRNA CTD PMID:20360939 Zhx1 Rat nitrates multiple interactions ISO Zhx1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ZHX1 mRNA CTD PMID:35964746 Zhx1 Rat p-chloromercuribenzoic acid decreases expression ISO ZHX1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of ZHX1 mRNA CTD PMID:26272509 Zhx1 Rat p-chloromercuribenzoic acid multiple interactions ISO ZHX1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ZHX1 mRNA CTD PMID:27188386 Zhx1 Rat p-tert-Amylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of ZHX1 mRNA CTD PMID:17011747 Zhx1 Rat paracetamol decreases expression ISO ZHX1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ZHX1 mRNA CTD PMID:26690555 Zhx1 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of ZHX1 mRNA CTD PMID:20360939 Zhx1 Rat pirinixic acid multiple interactions ISO Zhx1 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of ZHX1 mRNA CTD PMID:19710929 Zhx1 Rat rimonabant multiple interactions ISO Zhx1 (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of ZHX1 mRNA] CTD PMID:19030233 Zhx1 Rat rotenone decreases expression ISO Zhx1 (Mus musculus) 6480464 Rotenone results in decreased expression of ZHX1 mRNA CTD PMID:19304788 Zhx1 Rat SB 431542 multiple interactions ISO ZHX1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Zhx1 Rat sodium arsenite increases expression ISO ZHX1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ZHX1 mRNA CTD PMID:17879257 Zhx1 Rat sodium arsenite decreases expression ISO ZHX1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ZHX1 mRNA CTD PMID:38568856 Zhx1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of ZHX1 mRNA CTD PMID:30047161 Zhx1 Rat thiram decreases expression ISO ZHX1 (Homo sapiens) 6480464 Thiram results in decreased expression of ZHX1 mRNA CTD PMID:38568856 Zhx1 Rat titanium dioxide increases expression ISO Zhx1 (Mus musculus) 6480464 titanium dioxide results in increased expression of ZHX1 mRNA CTD PMID:23557971 Zhx1 Rat titanium dioxide decreases methylation ISO Zhx1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ZHX1 gene and titanium dioxide results in decreased methylation of ZHX1 promoter CTD PMID:35295148 Zhx1 Rat triphenyl phosphate affects expression ISO ZHX1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ZHX1 mRNA CTD PMID:37042841 Zhx1 Rat triptonide increases expression ISO Zhx1 (Mus musculus) 6480464 triptonide results in increased expression of ZHX1 mRNA CTD PMID:33045310 Zhx1 Rat valproic acid increases expression ISO ZHX1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ZHX1 mRNA CTD PMID:23179753 Zhx1 Rat valproic acid decreases expression ISO ZHX1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ZHX1 mRNA CTD PMID:28001369 and PMID:37505509
Zhx1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 91,472,193 - 91,501,984 (-) NCBI GRCr8 mRatBN7.2 7 89,582,363 - 89,611,337 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 89,582,243 - 89,611,264 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 91,459,215 - 91,487,312 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 93,660,497 - 93,688,594 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 93,478,605 - 93,506,719 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 97,915,280 - 97,944,787 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 97,915,581 - 97,944,491 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 98,521,607 - 98,550,754 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 94,753,899 - 94,775,384 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 94,788,129 - 94,809,611 (-) NCBI Celera 7 86,354,706 - 86,382,874 (-) NCBI Celera Cytogenetic Map 7 q33 NCBI
ZHX1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 123,248,456 - 123,275,541 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 123,248,451 - 123,275,541 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 124,260,696 - 124,287,781 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 124,329,877 - 124,355,728 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 124,329,883 - 124,355,728 NCBI Celera 8 120,449,735 - 120,475,585 (-) NCBI Celera Cytogenetic Map 8 q24.13 NCBI HuRef 8 119,587,157 - 119,614,189 (-) NCBI HuRef CHM1_1 8 124,300,977 - 124,328,068 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 124,379,593 - 124,406,678 (-) NCBI T2T-CHM13v2.0
Zhx1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 57,910,399 - 57,939,904 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 57,910,399 - 57,939,937 (-) Ensembl GRCm39 Ensembl GRCm38 15 58,047,003 - 58,076,508 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 58,047,003 - 58,076,541 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 57,878,558 - 57,908,044 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 57,877,091 - 57,899,438 (-) NCBI MGSCv36 mm8 Celera 15 59,567,020 - 59,596,509 (-) NCBI Celera Cytogenetic Map 15 D1 NCBI cM Map 15 24.25 NCBI
Zhx1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955540 2,123,437 - 2,149,212 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955540 2,123,437 - 2,149,212 (-) NCBI ChiLan1.0 ChiLan1.0
ZHX1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 140,682,534 - 140,709,408 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 116,193,697 - 116,221,081 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 119,945,909 - 119,972,926 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 122,701,948 - 122,728,485 (-) NCBI panpan1.1 PanPan1.1 panPan2
ZHX1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 21,627,904 - 21,634,864 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 21,592,880 - 21,617,370 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 21,967,523 - 21,992,044 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 21,967,485 - 21,992,606 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 21,695,838 - 21,720,330 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 21,798,744 - 21,822,982 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 22,042,007 - 22,066,533 (-) NCBI UU_Cfam_GSD_1.0
Zhx1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 16,632,821 - 16,658,425 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 24,059,863 - 24,084,535 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 24,058,718 - 24,084,535 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ZHX1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 16,119,333 - 16,121,951 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 16,100,773 - 16,134,222 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 16,844,917 - 16,878,310 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ZHX1
Zhx1
.
Predicted Target Of
Count of predictions: 528 Count of miRNA genes: 265 Interacting mature miRNAs: 321 Transcripts: ENSRNOT00000008454 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 631529 Tls2 T-lymphoma susceptibility QTL 2 0 0.001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 7 80221299 109401111 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1559283 Emca4 Estrogen-induced mammary cancer QTL 4 3.7 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 7 62004452 101773158 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 1641908 Teswt1 Testicular weight QTL 1 3.28 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 7 80221299 94811326 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 724537 Niddm52 Non-insulin dependent diabetes mellitus QTL 52 0.02 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 80221299 93595843 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 1576303 Ept7 Estrogen-induced pituitary tumorigenesis QTL 7 3.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 7 62004452 101773158 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
RH133269
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 89,582,822 - 89,583,036 (+) MAPPER mRatBN7.2 Rnor_6.0 7 97,915,740 - 97,915,953 NCBI Rnor6.0 Rnor_5.0 7 98,522,067 - 98,522,280 UniSTS Rnor5.0 RGSC_v3.4 7 94,754,059 - 94,754,272 UniSTS RGSC3.4 Celera 7 86,354,866 - 86,355,079 UniSTS RH 3.4 Map 7 607.5 UniSTS Cytogenetic Map 7 q33 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000008454 ⟹ ENSRNOP00000008454
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 89,582,362 - 89,611,091 (-) Ensembl Rnor_6.0 Ensembl 7 97,915,581 - 97,944,491 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095340 ⟹ ENSRNOP00000090025
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 89,582,362 - 89,610,318 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100253 ⟹ ENSRNOP00000079266
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 89,582,243 - 89,611,227 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102754 ⟹ ENSRNOP00000079752
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 89,582,243 - 89,611,264 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112281 ⟹ ENSRNOP00000084155
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 89,582,361 - 89,611,264 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117985 ⟹ ENSRNOP00000081548
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 89,582,361 - 89,611,264 (-) Ensembl
RefSeq Acc Id:
NM_133620 ⟹ NP_598304
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 91,472,193 - 91,500,468 (-) NCBI mRatBN7.2 7 89,582,663 - 89,610,941 (-) NCBI Rnor_6.0 7 97,915,580 - 97,944,491 (-) NCBI Rnor_5.0 7 98,521,607 - 98,550,754 (-) NCBI RGSC_v3.4 7 94,753,899 - 94,775,384 (-) RGD Celera 7 86,354,706 - 86,382,874 (-) RGD
Sequence:
CTCTGAAATGCAAGATGGCGGCGGCGAGGCGCTGAGGCGAGGCGGCCCCTGCAGAAGACTGCTAGCTACTTTGGGACAATTTGCAATGATGGCCTGAGCCAAGTACCTCATTTGAAGGGATAACCTTC
hide sequence
RefSeq Acc Id:
XM_017594643 ⟹ XP_017450132
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 91,472,193 - 91,493,771 (-) NCBI mRatBN7.2 7 89,582,363 - 89,611,330 (-) NCBI Rnor_6.0 7 97,915,280 - 97,944,787 (-) NCBI
Sequence:
GAGGGCGGGGCGGCGCACACCTCCCGCAGCGCAGGGTTCTAGAGGAGCGGCCTGGGTCGCATCC
hide sequence
RefSeq Acc Id:
XM_017594644 ⟹ XP_017450133
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 91,472,193 - 91,501,984 (-) NCBI mRatBN7.2 7 89,582,363 - 89,611,330 (-) NCBI Rnor_6.0 7 97,915,280 - 97,944,787 (-) NCBI
Sequence:
GAGGGCGGGGCGGCGCACACCTCCCGCAGCGCAGGGTTCTAGAGGAGCGGCCTGGGTCGCATCC
hide sequence
RefSeq Acc Id:
XM_063262951 ⟹ XP_063119021
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 91,472,193 - 91,493,771 (-) NCBI
RefSeq Acc Id:
XM_063262952 ⟹ XP_063119022
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 91,473,738 - 91,501,984 (-) NCBI
RefSeq Acc Id:
XR_010052934
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 91,472,193 - 91,501,984 (-) NCBI
RefSeq Acc Id:
NP_598304 ⟸ NM_133620
- UniProtKB:
Q8R515 (UniProtKB/Swiss-Prot), G3V6S9 (UniProtKB/TrEMBL), A6HRJ3 (UniProtKB/TrEMBL)
- Sequence:
MASRRKSTTPCMVLASEQDPDLELISDLEEGPPVLTPVENARAESVSSDEEVHESVDSDNQQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEHNLKYHPGE
hide sequence
RefSeq Acc Id:
XP_017450133 ⟸ XM_017594644
- Peptide Label:
isoform X1
- UniProtKB:
Q8R515 (UniProtKB/Swiss-Prot), G3V6S9 (UniProtKB/TrEMBL), A6HRJ3 (UniProtKB/TrEMBL)
- Sequence:
MASRRKSTTPCMVLASEQDPDLELISDLEEGPPVLTPVENARAESVSSDEEVHESVDSDNQQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEHNLKYHPGE
hide sequence
RefSeq Acc Id:
XP_017450132 ⟸ XM_017594643
- Peptide Label:
isoform X1
- UniProtKB:
Q8R515 (UniProtKB/Swiss-Prot), G3V6S9 (UniProtKB/TrEMBL), A6HRJ3 (UniProtKB/TrEMBL)
- Sequence:
MASRRKSTTPCMVLASEQDPDLELISDLEEGPPVLTPVENARAESVSSDEEVHESVDSDNQQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEHNLKYHPGE
hide sequence
Ensembl Acc Id:
ENSRNOP00000008454 ⟸ ENSRNOT00000008454
Ensembl Acc Id:
ENSRNOP00000079266 ⟸ ENSRNOT00000100253
Ensembl Acc Id:
ENSRNOP00000084155 ⟸ ENSRNOT00000112281
Ensembl Acc Id:
ENSRNOP00000079752 ⟸ ENSRNOT00000102754
Ensembl Acc Id:
ENSRNOP00000081548 ⟸ ENSRNOT00000117985
Ensembl Acc Id:
ENSRNOP00000090025 ⟸ ENSRNOT00000095340
RefSeq Acc Id:
XP_063119021 ⟸ XM_063262951
- Peptide Label:
isoform X1
- UniProtKB:
Q8R515 (UniProtKB/Swiss-Prot), A6HRJ3 (UniProtKB/TrEMBL), G3V6S9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119022 ⟸ XM_063262952
- Peptide Label:
isoform X1
- UniProtKB:
Q8R515 (UniProtKB/Swiss-Prot), A6HRJ3 (UniProtKB/TrEMBL), G3V6S9 (UniProtKB/TrEMBL)
RGD ID: 13695345 Promoter ID: EPDNEW_R5869 Type: multiple initiation site Name: Zhx1_1 Description: zinc fingers and homeoboxes 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 97,944,498 - 97,944,558 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-05-08
Zhx1
zinc fingers and homeoboxes 1
Zhx1
zinc fingers and homeoboxes protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-22
Zhx1
zinc fingers and homeoboxes protein 1
Zhx1
zinc-fingers and homeoboxes 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-12-14
Zhx1
zinc-fingers and homeoboxes 1
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Zhx1
zinc-fingers and homeoboxes 1
Symbol and Name status set to provisional
70820 PROVISIONAL
