Symbol:
Sparc
Name:
secreted protein acidic and cysteine rich
RGD ID:
3742
Description:
Enables calcium ion binding activity. Involved in several processes, including response to L-ascorbic acid; response to lead ion; and response to lipopolysaccharide. Located in extracellular space and vesicle. Is active in glutamatergic synapse. Biomarker of diabetic angiopathy; membranoproliferative glomerulonephritis; membranous glomerulonephritis; myocardial infarction; and stomach carcinoma. Human ortholog(s) of this gene implicated in cervix carcinoma; endometrial carcinoma; multiple myeloma; and osteogenesis imperfecta type 17. Orthologous to human SPARC (secreted protein acidic and cysteine rich); INTERACTS WITH 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
basement-membrane protein 40; BM-40; ON; osteonectin; Secreted acidic cystein-rich glycoprotein (osteonectin); secreted acidic cysteine rich glycoprotein; secreted protein acidic and rich in cysteine; secreted protein, acidic, cysteine-rich (osteonectin)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SPARC (secreted protein acidic and cysteine rich) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):
Sparc (secreted acidic cysteine rich glycoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sparc (secreted protein acidic and cysteine rich) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SPARC (secreted protein acidic and cysteine rich) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SPARC (secreted protein acidic and cysteine rich) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sparc (secreted protein acidic and cysteine rich) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SPARC (secreted protein acidic and cysteine rich) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SPARC (secreted protein acidic and cysteine rich) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sparc (secreted protein acidic and cysteine rich) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Sparc (secreted acidic cysteine rich glycoprotein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SPARC (secreted protein acidic and cysteine rich)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sparc (secreted protein, acidic, cysteine-rich (osteonectin))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ost-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
SPARC
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
sparc
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Candidate Gene For:
Vetf2 Vetf10
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 40,017,065 - 40,038,816 (-) NCBI GRCr8 mRatBN7.2 10 39,516,394 - 39,538,252 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 39,516,406 - 39,538,396 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 44,200,679 - 44,221,761 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 43,690,774 - 43,711,860 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 39,194,463 - 39,215,539 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 40,742,390 - 40,764,232 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 40,742,400 - 40,764,185 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 40,573,510 - 40,595,261 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 40,809,730 - 40,831,481 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 40,823,352 - 40,845,104 (-) NCBI Celera 10 38,848,158 - 38,869,906 (-) NCBI Celera RH 3.4 Map 10 414.6 RGD Cytogenetic Map 10 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sparc Rat (1->4)-beta-D-glucan multiple interactions ISO Sparc (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SPARC mRNA CTD PMID:36331819 Sparc Rat (R)-camphor affects expression ISO Sparc (Mus musculus) 6480464 Camphor analog affects the expression of SPARC mRNA CTD PMID:24704097 Sparc Rat 1,1-dichloroethene increases expression ISO Sparc (Mus musculus) 6480464 vinylidene chloride results in increased expression of SPARC mRNA CTD PMID:26682919 Sparc Rat 1,2-dimethylhydrazine increases expression ISO Sparc (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of SPARC mRNA CTD PMID:22206623 Sparc Rat 1,2-dimethylhydrazine multiple interactions ISO Sparc (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of SPARC mRNA] CTD PMID:22206623 Sparc Rat 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine increases expression EXP 6480464 chlorcyclizine results in increased expression of SPARC mRNA CTD PMID:21058326 Sparc Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of SPARC mRNA CTD PMID:25380136 Sparc Rat 17alpha-ethynylestradiol increases expression ISO Sparc (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SPARC mRNA CTD PMID:17942748 Sparc Rat 17alpha-ethynylestradiol multiple interactions ISO Sparc (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SPARC mRNA CTD PMID:17942748 Sparc Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of SPARC mRNA CTD PMID:17557909 Sparc Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of SPARC mRNA CTD PMID:16079270 Sparc Rat 17beta-estradiol multiple interactions ISO Sparc (Mus musculus) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of SPARC mRNA CTD PMID:19693291 Sparc Rat 17beta-estradiol multiple interactions ISO SPARC (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of SPARC mRNA CTD PMID:30165855 Sparc Rat 17beta-estradiol decreases expression ISO Sparc (Mus musculus) 6480464 Estradiol results in decreased expression of SPARC mRNA CTD PMID:19693291 Sparc Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Sparc (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Sparc Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Sparc (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SPARC mRNA CTD PMID:17942748 Sparc Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO SPARC (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of SPARC mRNA CTD PMID:36370075 Sparc Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SPARC mRNA CTD PMID:34747641 Sparc Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Sparc (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SPARC mRNA CTD PMID:33956508 Sparc Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Sparc (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SPARC mRNA CTD PMID:21570461 Sparc Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO SPARC (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SPARC mRNA CTD PMID:11489354 more ... Sparc Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SPARC mRNA CTD PMID:11752688 Sparc Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions ISO Sparc (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of SPARC mRNA] more ... CTD PMID:17994277 and PMID:18200517 Sparc Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Sparc (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of SPARC mRNA CTD PMID:17994277 and PMID:18200517 Sparc Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:20959002 Sparc Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of SPARC mRNA CTD PMID:19162173 Sparc Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of SPARC mRNA CTD PMID:25380136 Sparc Rat 4,4'-diaminodiphenylmethane decreases expression ISO Sparc (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of SPARC mRNA CTD PMID:18648102 Sparc Rat 4,4'-sulfonyldiphenol multiple interactions ISO Sparc (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of SPARC mRNA CTD PMID:30951980 Sparc Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SPARC mRNA CTD PMID:36041667 Sparc Rat 4,4'-sulfonyldiphenol increases methylation ISO SPARC (Homo sapiens) 6480464 bisphenol S results in increased methylation of SPARC gene CTD PMID:31601247 Sparc Rat 4,4'-sulfonyldiphenol increases methylation ISO Sparc (Mus musculus) 6480464 bisphenol S results in increased methylation of SPARC exon CTD PMID:33297965 Sparc Rat 4,4'-sulfonyldiphenol increases expression ISO Sparc (Mus musculus) 6480464 bisphenol S results in increased expression of SPARC mRNA CTD PMID:30951980 and PMID:39298647 Sparc Rat 4-hydroxyphenyl retinamide decreases expression ISO Sparc (Mus musculus) 6480464 Fenretinide results in decreased expression of SPARC mRNA CTD PMID:28973697 Sparc Rat 5-aza-2'-deoxycytidine increases expression ISO SPARC (Homo sapiens) 6480464 Decitabine results in increased expression of SPARC mRNA and Decitabine results in increased expression of SPARC protein CTD PMID:17397030 and PMID:19177197 Sparc Rat 5-aza-2'-deoxycytidine multiple interactions ISO SPARC (Homo sapiens) 6480464 [Decitabine affects the methylation of SPARC promoter] which affects the expression of SPARC mRNA more ... CTD PMID:18458674 and PMID:19177197 Sparc Rat 5-fluorouracil multiple interactions ISO SPARC (Homo sapiens) 6480464 [decitabine affects the methylation of SPARC promoter] which affects the susceptibility to Fluorouracil CTD PMID:18458674 Sparc Rat 5-fluorouracil affects expression ISO Sparc (Mus musculus) 6480464 Fluorouracil affects the expression of SPARC mRNA CTD PMID:24704097 Sparc Rat 5-fluorouracil increases response to substance ISO SPARC (Homo sapiens) 6480464 SPARC protein results in increased susceptibility to Fluorouracil CTD PMID:15902309 Sparc Rat acetylsalicylic acid multiple interactions ISO SPARC (Homo sapiens) 6480464 Aspirin inhibits the reaction [thrombin receptor-activating peptide SFLLRNPNDKY analog results in increased secretion of SPARC protein] CTD PMID:17303692 Sparc Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of SPARC mRNA CTD PMID:28959563 Sparc Rat aldehydo-D-glucose multiple interactions ISO SPARC (Homo sapiens) 6480464 cobaltiprotoporphyrin inhibits the reaction [Glucose results in decreased expression of SPARC mRNA] CTD PMID:19924377 Sparc Rat aldehydo-D-glucose decreases expression ISO SPARC (Homo sapiens) 6480464 Glucose results in decreased expression of SPARC mRNA CTD PMID:19924377 Sparc Rat alendronic acid affects expression EXP 6480464 Alendronate affects the expression of SPARC mRNA CTD PMID:16079270 Sparc Rat all-trans-retinoic acid multiple interactions ISO Sparc (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of SPARC mRNA more ... CTD PMID:17994277 and PMID:30951980 Sparc Rat all-trans-retinoic acid decreases expression ISO SPARC (Homo sapiens) 6480464 Tretinoin results in decreased expression of SPARC mRNA CTD PMID:33167477 Sparc Rat all-trans-retinoic acid affects expression ISO Sparc (Mus musculus) 6480464 Tretinoin affects the expression of SPARC mRNA CTD PMID:24704097 Sparc Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of SPARC mRNA CTD PMID:24977338 Sparc Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of SPARC mRNA CTD PMID:35163327 Sparc Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SPARC mRNA CTD PMID:16483693 Sparc Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of SPARC mRNA CTD PMID:30779732 Sparc Rat Ampullosporin multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of SPARC mRNA CTD PMID:16635253 Sparc Rat antirheumatic drug increases expression ISO SPARC (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of SPARC mRNA CTD PMID:24449571 Sparc Rat arachidonic acid decreases expression ISO SPARC (Homo sapiens) 6480464 Arachidonic Acid results in decreased expression of SPARC mRNA CTD PMID:16704987 Sparc Rat arsane affects methylation ISO SPARC (Homo sapiens) 6480464 Arsenic affects the methylation of SPARC gene CTD PMID:25304211 Sparc Rat arsenic atom affects methylation ISO SPARC (Homo sapiens) 6480464 Arsenic affects the methylation of SPARC gene CTD PMID:25304211 Sparc Rat arsenite(3-) decreases expression ISO SPARC (Homo sapiens) 6480464 arsenite results in decreased expression of SPARC mRNA and arsenite results in decreased expression of SPARC protein CTD PMID:23974009 and PMID:26783756 Sparc Rat arsenite(3-) increases methylation ISO SPARC (Homo sapiens) 6480464 arsenite results in increased methylation of SPARC promoter CTD PMID:23974009 Sparc Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of SPARC mRNA CTD PMID:36841081 Sparc Rat avobenzone increases expression ISO SPARC (Homo sapiens) 6480464 avobenzone results in increased expression of SPARC mRNA CTD PMID:31016361 Sparc Rat Azoxymethane multiple interactions ISO Sparc (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SPARC mRNA CTD PMID:29950665 Sparc Rat benzene multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in decreased expression of SPARC mRNA CTD PMID:17905399 Sparc Rat benzene decreases expression ISO SPARC (Homo sapiens) 6480464 Benzene results in decreased expression of SPARC mRNA CTD PMID:19162166 Sparc Rat benzo[a]pyrene increases expression ISO Sparc (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SPARC mRNA CTD PMID:22610609 and PMID:32417428 Sparc Rat benzo[a]pyrene increases methylation ISO SPARC (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SPARC promoter CTD PMID:27901495 Sparc Rat benzo[b]fluoranthene increases expression ISO Sparc (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of SPARC mRNA CTD PMID:26377693 Sparc Rat berberine increases expression ISO SPARC (Homo sapiens) 6480464 Berberine results in increased expression of SPARC mRNA CTD PMID:26478571 Sparc Rat bexarotene increases expression ISO SPARC (Homo sapiens) 6480464 bexarotene results in increased expression of SPARC mRNA CTD PMID:17178900 Sparc Rat bis(2-chloroethyl) sulfide increases expression ISO SPARC (Homo sapiens) 6480464 Mustard Gas results in increased expression of SPARC mRNA CTD PMID:33491125 Sparc Rat bis(2-ethylhexyl) phthalate increases expression ISO Sparc (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of SPARC mRNA CTD PMID:33754040 Sparc Rat bis(2-ethylhexyl) phthalate decreases expression ISO Sparc (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of SPARC mRNA CTD PMID:34319233 Sparc Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SPARC mRNA and bisphenol A affects the expression of SPARC protein CTD PMID:20219716 and PMID:25181051 Sparc Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SPARC mRNA CTD PMID:36041667 Sparc Rat bisphenol A decreases methylation ISO SPARC (Homo sapiens) 6480464 bisphenol A results in decreased methylation of SPARC gene CTD PMID:31601247 Sparc Rat bisphenol A increases expression ISO SPARC (Homo sapiens) 6480464 bisphenol A results in increased expression of SPARC mRNA and bisphenol A results in increased expression of SPARC protein CTD PMID:31715268 more ... Sparc Rat bisphenol A increases expression ISO Sparc (Mus musculus) 6480464 bisphenol A results in increased expression of SPARC mRNA CTD PMID:30951980 Sparc Rat bisphenol A decreases expression ISO SPARC (Homo sapiens) 6480464 bisphenol A results in decreased expression of SPARC mRNA CTD PMID:29275510 Sparc Rat bisphenol A affects expression ISO SPARC (Homo sapiens) 6480464 bisphenol A affects the expression of SPARC mRNA CTD PMID:30903817 Sparc Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SPARC mRNA and bisphenol A results in decreased expression of SPARC protein CTD PMID:20219716 more ... Sparc Rat bisphenol AF increases expression ISO SPARC (Homo sapiens) 6480464 bisphenol AF results in increased expression of SPARC protein CTD PMID:34186270 Sparc Rat bisphenol F increases expression ISO Sparc (Mus musculus) 6480464 bisphenol F results in increased expression of SPARC mRNA CTD PMID:30951980 Sparc Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SPARC mRNA CTD PMID:36041667 Sparc Rat bisphenol F multiple interactions ISO Sparc (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of SPARC mRNA CTD PMID:30951980 Sparc Rat bleomycin A2 increases response to substance ISO Sparc (Mus musculus) 6480464 SPARC protein results in increased susceptibility to Bleomycin CTD PMID:19446018 Sparc Rat boric acid affects expression ISO Sparc (Mus musculus) 6480464 boric acid affects the expression of SPARC mRNA CTD PMID:24704097 Sparc Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of SPARC mRNA CTD PMID:24136188 Sparc Rat cadmium atom decreases expression ISO SPARC (Homo sapiens) 6480464 Cadmium results in decreased expression of SPARC mRNA and Cadmium results in decreased expression of SPARC protein CTD PMID:20570719 more ... Sparc Rat cadmium atom multiple interactions ISO SPARC (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SPARC mRNA CTD PMID:29741670 Sparc Rat cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of SPARC mRNA CTD PMID:9232954 Sparc Rat cadmium dichloride decreases expression ISO SPARC (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SPARC mRNA and Cadmium Chloride results in decreased expression of SPARC protein CTD PMID:20837119 Sparc Rat cadmium dichloride multiple interactions ISO SPARC (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SPARC mRNA CTD PMID:29741670 Sparc Rat calciol multiple interactions ISO SPARC (Homo sapiens) 6480464 [Cholecalciferol co-treated with beta-glycerophosphoric acid co-treated with Ascorbic Acid] results in increased expression of SPARC protein CTD PMID:17692823 Sparc Rat calcitriol increases expression EXP 6480464 Calcitriol results in increased expression of SPARC protein CTD PMID:19092814 Sparc Rat camphor affects expression ISO Sparc (Mus musculus) 6480464 Camphor analog affects the expression of SPARC mRNA CTD PMID:24704097 Sparc Rat carbamazepine affects expression ISO SPARC (Homo sapiens) 6480464 Carbamazepine affects the expression of SPARC mRNA CTD PMID:25979313 Sparc Rat carbon nanotube decreases expression ISO Sparc (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of SPARC mRNA CTD PMID:25620056 Sparc Rat carmustine affects response to substance ISO SPARC (Homo sapiens) 6480464 SPARC mRNA affects the susceptibility to Carmustine CTD PMID:16365179 Sparc Rat carnosic acid decreases expression ISO Sparc (Mus musculus) 6480464 salvin results in decreased expression of SPARC protein CTD PMID:35926579 Sparc Rat casticin increases expression ISO Sparc (Mus musculus) 6480464 casticin results in increased expression of SPARC mRNA CTD PMID:28444820 Sparc Rat casticin decreases expression ISO SPARC (Homo sapiens) 6480464 casticin results in decreased expression of SPARC mRNA CTD PMID:27862857 Sparc Rat CGP 52608 multiple interactions ISO SPARC (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SPARC gene] CTD PMID:28238834 Sparc Rat chlorpyrifos decreases expression ISO Sparc (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of SPARC mRNA CTD PMID:20350560 Sparc Rat choline multiple interactions ISO Sparc (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SPARC mRNA CTD PMID:20938992 Sparc Rat cisplatin multiple interactions ISO SPARC (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of SPARC mRNA and [Cisplatin co-treated with Paclitaxel] results in decreased expression of SPARC mRNA CTD PMID:20705681 and PMID:27392435 Sparc Rat cisplatin decreases expression ISO SPARC (Homo sapiens) 6480464 Cisplatin results in decreased expression of SPARC mRNA CTD PMID:27392435 Sparc Rat copper atom multiple interactions ISO Sparc (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of SPARC mRNA CTD PMID:15467011 Sparc Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of SPARC mRNA CTD PMID:30556269 Sparc Rat copper atom increases expression ISO Sparc (Mus musculus) 6480464 Copper results in increased expression of SPARC mRNA CTD PMID:16629173 Sparc Rat copper atom decreases secretion ISO Sparc (Mus musculus) 6480464 Copper results in decreased secretion of SPARC protein CTD PMID:19635393 Sparc Rat copper(0) multiple interactions ISO Sparc (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of SPARC mRNA CTD PMID:15467011 Sparc Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of SPARC mRNA CTD PMID:30556269 Sparc Rat copper(0) increases expression ISO Sparc (Mus musculus) 6480464 Copper results in increased expression of SPARC mRNA CTD PMID:16629173 Sparc Rat copper(0) decreases secretion ISO Sparc (Mus musculus) 6480464 Copper results in decreased secretion of SPARC protein CTD PMID:19635393 Sparc Rat corn oil increases expression EXP 6480464 Corn Oil results in increased expression of SPARC mRNA CTD PMID:22760963 Sparc Rat crocidolite asbestos multiple interactions ISO Sparc (Mus musculus) 6480464 Asbestos more ... CTD PMID:19446018 Sparc Rat crocidolite asbestos decreases expression ISO Sparc (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of SPARC mRNA CTD PMID:29279043 Sparc Rat crocidolite asbestos decreases expression ISO SPARC (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of SPARC mRNA CTD PMID:28056339 Sparc Rat crocidolite asbestos increases response to substance ISO Sparc (Mus musculus) 6480464 SPARC protein results in increased susceptibility to Asbestos and Crocidolite CTD PMID:19446018 Sparc Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of SPARC mRNA CTD PMID:26577399 Sparc Rat curcumin multiple interactions ISO Sparc (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of SPARC mRNA] CTD PMID:18200517 Sparc Rat cyclophosphamide decreases expression ISO Sparc (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of SPARC mRNA CTD PMID:15331540 Sparc Rat cyclophosphamide increases expression ISO SPARC (Homo sapiens) 6480464 Cyclophosphamide results in increased expression of SPARC mRNA CTD PMID:17403535 Sparc Rat cyclosporin A decreases expression ISO SPARC (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SPARC mRNA CTD PMID:20106945 and PMID:25562108 Sparc Rat cytarabine decreases expression ISO SPARC (Homo sapiens) 6480464 Cytarabine results in decreased expression of SPARC mRNA CTD PMID:21198554 Sparc Rat D-glucose decreases expression ISO SPARC (Homo sapiens) 6480464 Glucose results in decreased expression of SPARC mRNA CTD PMID:19924377 Sparc Rat D-glucose multiple interactions ISO SPARC (Homo sapiens) 6480464 cobaltiprotoporphyrin inhibits the reaction [Glucose results in decreased expression of SPARC mRNA] CTD PMID:19924377 Sparc Rat DDE increases expression ISO SPARC (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of SPARC mRNA CTD PMID:38568856 Sparc Rat DDT increases expression ISO SPARC (Homo sapiens) 6480464 DDT results in increased expression of SPARC mRNA CTD PMID:25014179 Sparc Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of SPARC mRNA CTD PMID:9232954 Sparc Rat dextran sulfate multiple interactions ISO Sparc (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SPARC mRNA CTD PMID:29950665 Sparc Rat dioxygen increases expression ISO Sparc (Mus musculus) 6480464 Oxygen deficiency results in increased expression of SPARC mRNA CTD PMID:28174749 Sparc Rat dioxygen multiple interactions ISO Sparc (Mus musculus) 6480464 GPR68 protein affects the reaction [Oxygen deficiency results in increased expression of SPARC mRNA] CTD PMID:28174749 Sparc Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of SPARC mRNA CTD PMID:25152437 Sparc Rat diuron increases expression EXP 6480464 Diuron results in increased expression of SPARC mRNA CTD PMID:21551480 Sparc Rat dorsomorphin multiple interactions ISO SPARC (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SPARC mRNA CTD PMID:27188386 Sparc Rat doxorubicin increases expression ISO SPARC (Homo sapiens) 6480464 Doxorubicin results in increased expression of SPARC mRNA CTD PMID:15870702 Sparc Rat doxorubicin decreases expression ISO SPARC (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SPARC mRNA CTD PMID:29803840 Sparc Rat doxorubicin increases expression ISO Sparc (Mus musculus) 6480464 Doxorubicin results in increased expression of SPARC mRNA CTD PMID:15033991 Sparc Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of SPARC mRNA CTD PMID:29391264 Sparc Rat ethanol increases expression ISO SPARC (Homo sapiens) 6480464 Ethanol results in increased expression of SPARC mRNA CTD PMID:15963989 Sparc Rat ethanol decreases expression ISO Sparc (Mus musculus) 6480464 Ethanol results in decreased expression of SPARC mRNA CTD PMID:34755883 Sparc Rat ethanol increases expression ISO Sparc (Mus musculus) 6480464 Ethanol results in increased expression of SPARC mRNA CTD PMID:30319688 Sparc Rat Ethoxyacetic acid affects expression ISO Sparc (Mus musculus) 6480464 ethoxyacetic acid affects the expression of SPARC mRNA CTD PMID:24704097 Sparc Rat fenamidone increases expression ISO Sparc (Mus musculus) 6480464 fenamidone results in increased expression of SPARC mRNA CTD PMID:27029645 Sparc Rat fenthion increases expression ISO Sparc (Mus musculus) 6480464 Fenthion results in increased expression of SPARC mRNA CTD PMID:34813904 Sparc Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of SPARC mRNA CTD PMID:34044035 Sparc Rat folic acid multiple interactions ISO Sparc (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SPARC mRNA more ... CTD PMID:20938992 and PMID:22206623 Sparc Rat folic acid decreases expression ISO Sparc (Mus musculus) 6480464 Folic Acid results in decreased expression of SPARC mRNA CTD PMID:25629700 Sparc Rat folic acid increases expression ISO SPARC (Homo sapiens) 6480464 Folic Acid results in increased expression of SPARC mRNA CTD PMID:28752528 Sparc Rat formaldehyde decreases expression ISO SPARC (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SPARC mRNA CTD PMID:23649840 Sparc Rat fulvestrant multiple interactions ISO SPARC (Homo sapiens) 6480464 fulvestrant inhibits the reaction [notoginsenoside R1 results in increased expression of SPARC mRNA] CTD PMID:26362186 Sparc Rat furan increases expression EXP 6480464 furan results in increased expression of SPARC mRNA CTD PMID:27387713 Sparc Rat furosemide increases expression EXP 6480464 Furosemide results in increased expression of SPARC mRNA CTD PMID:16526316 Sparc Rat gallocatechin increases expression EXP 6480464 gallocatechol results in increased expression of SPARC mRNA CTD PMID:21877759 Sparc Rat gamma-aminobutyric acid affects expression EXP 6480464 gamma-Aminobutyric Acid affects the expression of SPARC mRNA CTD PMID:24098073 Sparc Rat gamma-Oryzanol (TN) affects expression EXP 6480464 gamma-oryzanol affects the expression of SPARC mRNA CTD PMID:24098073 Sparc Rat genistein increases expression EXP 6480464 Genistein results in increased expression of SPARC mRNA CTD PMID:21877759 Sparc Rat glucose decreases expression ISO SPARC (Homo sapiens) 6480464 Glucose results in decreased expression of SPARC mRNA CTD PMID:19924377 Sparc Rat glucose multiple interactions ISO SPARC (Homo sapiens) 6480464 cobaltiprotoporphyrin inhibits the reaction [Glucose results in decreased expression of SPARC mRNA] CTD PMID:19924377 Sparc Rat glycerol 2-phosphate multiple interactions ISO SPARC (Homo sapiens) 6480464 [Cholecalciferol co-treated with beta-glycerophosphoric acid co-treated with Ascorbic Acid] results in increased expression of SPARC protein CTD PMID:17692823 Sparc Rat hydrogen peroxide increases expression ISO SPARC (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of SPARC mRNA CTD PMID:34581912 Sparc Rat indometacin multiple interactions ISO Sparc (Mus musculus) 6480464 Indomethacin promotes the reaction [Trinitrobenzenesulfonic Acid results in increased expression of SPARC mRNA] CTD PMID:17994277 Sparc Rat isoflavones affects expression ISO SPARC (Homo sapiens) 6480464 Isoflavones affects the expression of SPARC mRNA CTD PMID:16365062 Sparc Rat ketamine multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of SPARC mRNA CTD PMID:16635253 Sparc Rat L-ascorbic acid multiple interactions ISO SPARC (Homo sapiens) 6480464 [Cholecalciferol co-treated with beta-glycerophosphoric acid co-treated with Ascorbic Acid] results in increased expression of SPARC protein CTD PMID:17692823 Sparc Rat L-ascorbic acid 2-phosphate decreases expression ISO SPARC (Homo sapiens) 6480464 ascorbate-2-phosphate results in decreased expression of SPARC mRNA CTD PMID:17306970 Sparc Rat L-methionine multiple interactions ISO Sparc (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SPARC mRNA CTD PMID:20938992 Sparc Rat lipopolysaccharide increases expression ISO Sparc (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of SPARC mRNA CTD PMID:27339419 Sparc Rat losartan decreases expression EXP 6480464 Losartan results in decreased expression of SPARC mRNA CTD PMID:15100363 Sparc Rat magnesium atom increases expression ISO SPARC (Homo sapiens) 6480464 Magnesium results in increased expression of SPARC protein CTD PMID:10397942 Sparc Rat methamphetamine decreases expression ISO Sparc (Mus musculus) 6480464 Methamphetamine results in decreased expression of SPARC mRNA CTD PMID:36914120 Sparc Rat methyl methanesulfonate decreases expression ISO SPARC (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SPARC mRNA CTD PMID:23649840 Sparc Rat methylmercury chloride decreases expression ISO SPARC (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of SPARC mRNA CTD PMID:23179753 Sparc Rat methylmercury(1+) increases expression EXP 6480464 methylmercury II results in increased expression of SPARC mRNA CTD PMID:17905399 Sparc Rat methylmercury(1+) multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in decreased expression of SPARC mRNA CTD PMID:17905399 Sparc Rat N-ethyl-N-nitrosourea increases expression EXP 6480464 Ethylnitrosourea results in increased expression of SPARC mRNA CTD PMID:15954086 Sparc Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of SPARC mRNA CTD PMID:28801915 Sparc Rat N-methyl-N'-nitro-N-nitrosoguanidine decreases expression ISO SPARC (Homo sapiens) 6480464 Methylnitronitrosoguanidine results in decreased expression of SPARC mRNA CTD PMID:12634122 Sparc Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of SPARC mRNA CTD PMID:19638242 Sparc Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of SPARC mRNA CTD PMID:28943392 Sparc Rat N-nitrosodiethylamine increases expression ISO Sparc (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of SPARC mRNA CTD PMID:24535843 Sparc Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of SPARC mRNA CTD PMID:25380136 Sparc Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of SPARC mRNA CTD PMID:24136188 Sparc Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of SPARC mRNA CTD PMID:24136188 Sparc Rat notoginsenoside R1 multiple interactions ISO SPARC (Homo sapiens) 6480464 fulvestrant inhibits the reaction [notoginsenoside R1 results in increased expression of SPARC mRNA] CTD PMID:26362186 Sparc Rat notoginsenoside R1 increases expression ISO SPARC (Homo sapiens) 6480464 notoginsenoside R1 results in increased expression of SPARC mRNA CTD PMID:26362186 Sparc Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SPARC mRNA CTD PMID:25729387 Sparc Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of SPARC mRNA CTD PMID:25729387 Sparc Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of SPARC mRNA CTD PMID:27638505 Sparc Rat paclitaxel multiple interactions ISO SPARC (Homo sapiens) 6480464 [Cisplatin co-treated with Paclitaxel] results in decreased expression of SPARC mRNA CTD PMID:20705681 Sparc Rat paclitaxel increases expression ISO SPARC (Homo sapiens) 6480464 Paclitaxel results in increased expression of SPARC mRNA CTD PMID:19682730 Sparc Rat palbociclib increases expression ISO SPARC (Homo sapiens) 6480464 palbociclib results in increased expression of SPARC mRNA CTD PMID:28620137 Sparc Rat paracetamol affects expression ISO Sparc (Mus musculus) 6480464 Acetaminophen affects the expression of SPARC mRNA CTD PMID:17562736 Sparc Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SPARC mRNA CTD PMID:33387578 Sparc Rat paracetamol decreases expression ISO SPARC (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SPARC mRNA CTD PMID:29067470 Sparc Rat perfluorononanoic acid decreases expression ISO SPARC (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of SPARC mRNA CTD PMID:32588087 Sparc Rat perfluorooctane-1-sulfonic acid affects expression ISO SPARC (Homo sapiens) 6480464 perfluorooctane sulfonic acid affects the expression of SPARC mRNA CTD PMID:30738844 Sparc Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Sparc (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SPARC mRNA CTD PMID:36331819 Sparc Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of SPARC mRNA CTD PMID:35163327 Sparc Rat phenobarbital affects expression ISO SPARC (Homo sapiens) 6480464 Phenobarbital affects the expression of SPARC mRNA CTD PMID:19159669 Sparc Rat phenylmercury acetate increases expression ISO SPARC (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of SPARC mRNA CTD PMID:26272509 Sparc Rat phenylmercury acetate multiple interactions ISO SPARC (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SPARC mRNA CTD PMID:27188386 Sparc Rat piroxicam decreases expression ISO SPARC (Homo sapiens) 6480464 Piroxicam results in decreased expression of SPARC mRNA CTD PMID:21858171 Sparc Rat poly(vinylpyrrolidone) multiple interactions EXP 6480464 [Silver analog co-treated with Povidone] results in decreased expression of SPARC mRNA CTD PMID:25194297 Sparc Rat potassium dichromate increases expression ISO Sparc (Mus musculus) 6480464 Potassium Dichromate results in increased expression of SPARC mRNA CTD PMID:23608068 Sparc Rat progesterone multiple interactions ISO Sparc (Mus musculus) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of SPARC mRNA CTD PMID:19693291 Sparc Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Air Pollutants and Occupational results in decreased expression of SPARC mRNA] CTD PMID:37467934 Sparc Rat raloxifene affects expression EXP 6480464 Raloxifene Hydrochloride affects the expression of SPARC mRNA CTD PMID:16079270 Sparc Rat resveratrol decreases expression ISO SPARC (Homo sapiens) 6480464 resveratrol results in decreased expression of SPARC mRNA and resveratrol results in decreased expression of SPARC protein CTD PMID:16084059 Sparc Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of SPARC mRNA CTD PMID:19228061 Sparc Rat rimonabant multiple interactions ISO Sparc (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of SPARC mRNA] CTD PMID:19030233 Sparc Rat rimonabant affects expression ISO Sparc (Mus musculus) 6480464 Rimonabant affects the expression of SPARC mRNA CTD PMID:19030233 Sparc Rat rotenone affects expression EXP 6480464 Rotenone affects the expression of SPARC mRNA CTD PMID:28374803 Sparc Rat SB 431542 multiple interactions ISO SPARC (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Sparc Rat serpentine asbestos decreases expression ISO SPARC (Homo sapiens) 6480464 Asbestos and Serpentine results in decreased expression of SPARC mRNA CTD PMID:21148743 Sparc Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of SPARC mRNA CTD PMID:22431001 Sparc Rat silicon dioxide increases expression ISO Sparc (Mus musculus) 6480464 Silicon Dioxide results in increased expression of SPARC mRNA and Silicon Dioxide results in increased expression of SPARC protein CTD PMID:38403151 Sparc Rat silver atom multiple interactions EXP 6480464 [Silver analog co-treated with Povidone] results in decreased expression of SPARC mRNA CTD PMID:25194297 Sparc Rat silver(0) multiple interactions EXP 6480464 [Silver analog co-treated with Povidone] results in decreased expression of SPARC mRNA CTD PMID:25194297 Sparc Rat sodium arsenite multiple interactions ISO SPARC (Homo sapiens) 6480464 [sodium arsenite affects the acetylation of H3-4 protein] which affects the methylation of SPARC promoter CTD PMID:18448484 Sparc Rat sodium arsenite increases expression ISO SPARC (Homo sapiens) 6480464 sodium arsenite results in increased expression of SPARC mRNA CTD PMID:20371982 Sparc Rat sodium arsenite decreases expression ISO SPARC (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SPARC mRNA and sodium arsenite results in decreased expression of SPARC protein CTD PMID:20837119 and PMID:38568856 Sparc Rat sodium arsenite decreases expression ISO Sparc (Mus musculus) 6480464 sodium arsenite results in decreased expression of SPARC mRNA CTD PMID:18812580 and PMID:36209798 Sparc Rat sodium fluoride increases expression EXP 6480464 Sodium Fluoride results in increased expression of SPARC mRNA CTD PMID:24300170 Sparc Rat sodium fluoride multiple interactions EXP 6480464 DKK1 protein inhibits the reaction [Sodium Fluoride results in increased expression of SPARC mRNA] CTD PMID:24300170 Sparc Rat Soman increases expression EXP 6480464 Soman results in increased expression of SPARC mRNA CTD PMID:19281266 Sparc Rat streptozocin increases expression ISO Sparc (Mus musculus) 6480464 Streptozocin results in increased expression of SPARC mRNA and Streptozocin results in increased expression of SPARC protein CTD PMID:12660331 Sparc Rat sunitinib decreases expression ISO SPARC (Homo sapiens) 6480464 Sunitinib results in decreased expression of SPARC mRNA CTD PMID:31533062 Sparc Rat temozolomide affects response to substance ISO SPARC (Homo sapiens) 6480464 SPARC mRNA affects the susceptibility to temozolomide CTD PMID:16365179 Sparc Rat tert-butyl hydroperoxide decreases expression ISO SPARC (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of SPARC mRNA CTD PMID:15336504 Sparc Rat tert-butyl hydroperoxide increases expression ISO SPARC (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of SPARC mRNA CTD PMID:15963989 Sparc Rat testosterone increases expression ISO Sparc (Mus musculus) 6480464 Testosterone results in increased expression of SPARC mRNA CTD PMID:19693291 Sparc Rat tetrachloromethane affects expression ISO Sparc (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of SPARC mRNA CTD PMID:17484886 Sparc Rat tetrachloromethane increases expression ISO Sparc (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of SPARC mRNA CTD PMID:27339419 more ... Sparc Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SPARC mRNA CTD PMID:16239168 and PMID:17056239 Sparc Rat thioacetamide affects response to substance ISO Sparc (Mus musculus) 6480464 SPARC protein affects the susceptibility to Thioacetamide CTD PMID:23408952 Sparc Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of SPARC mRNA CTD PMID:28943392 Sparc Rat thioacetamide multiple interactions ISO Sparc (Mus musculus) 6480464 SPARC protein affects the reaction [Thioacetamide results in increased expression of COL1A2 mRNA] more ... CTD PMID:23408952 Sparc Rat thioacetamide increases expression ISO Sparc (Mus musculus) 6480464 Thioacetamide results in increased expression of SPARC mRNA CTD PMID:23408952 Sparc Rat thiram decreases expression ISO SPARC (Homo sapiens) 6480464 Thiram results in decreased expression of SPARC mRNA CTD PMID:38568856 Sparc Rat titanium dioxide decreases expression ISO Sparc (Mus musculus) 6480464 titanium dioxide results in decreased expression of SPARC mRNA CTD PMID:23557971 Sparc Rat titanium dioxide multiple interactions ISO Sparc (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SPARC mRNA CTD PMID:29950665 Sparc Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of SPARC mRNA CTD PMID:25729387 Sparc Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SPARC mRNA CTD PMID:25729387 Sparc Rat Trapidil multiple interactions EXP 6480464 Trapidil affects the reaction [PTH protein affects the expression of SPARC mRNA] CTD PMID:18635661 Sparc Rat triacsin C decreases expression ISO SPARC (Homo sapiens) 6480464 triacsin C results in decreased expression of SPARC mRNA CTD PMID:16704987 Sparc Rat trichloroethene multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in decreased expression of SPARC mRNA CTD PMID:17905399 Sparc Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of SPARC mRNA CTD PMID:19448997 Sparc Rat triclosan increases expression ISO SPARC (Homo sapiens) 6480464 Triclosan results in increased expression of SPARC mRNA CTD PMID:30510588 Sparc Rat triphenyl phosphate affects expression ISO SPARC (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SPARC mRNA CTD PMID:37042841 Sparc Rat triptonide decreases expression ISO Sparc (Mus musculus) 6480464 triptonide results in decreased expression of SPARC mRNA CTD PMID:33045310 Sparc Rat valproic acid affects expression ISO Sparc (Mus musculus) 6480464 Valproic Acid affects the expression of SPARC mRNA CTD PMID:17963808 Sparc Rat valproic acid increases expression ISO SPARC (Homo sapiens) 6480464 Valproic Acid results in increased expression of SPARC mRNA CTD PMID:23179753 and PMID:27188386 Sparc Rat valproic acid affects expression ISO SPARC (Homo sapiens) 6480464 Valproic Acid affects the expression of SPARC mRNA CTD PMID:25979313 Sparc Rat valproic acid decreases expression ISO SPARC (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SPARC mRNA CTD PMID:23179753 and PMID:29154799 Sparc Rat vancomycin decreases expression ISO Sparc (Mus musculus) 6480464 Vancomycin results in decreased expression of SPARC mRNA CTD PMID:18930951
(1->4)-beta-D-glucan (ISO) (R)-camphor (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP,ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) acetylsalicylic acid (ISO) acrylamide (EXP) aldehydo-D-glucose (ISO) alendronic acid (EXP) all-trans-retinoic acid (EXP,ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) amphetamine (EXP) Ampullosporin (EXP) antirheumatic drug (ISO) arachidonic acid (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (EXP) avobenzone (ISO) Azoxymethane (ISO) benzene (EXP,ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) berberine (ISO) bexarotene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP,ISO) bleomycin A2 (ISO) boric acid (ISO) buspirone (EXP) cadmium atom (EXP,ISO) cadmium dichloride (ISO) calciol (ISO) calcitriol (EXP) camphor (ISO) carbamazepine (ISO) carbon nanotube (ISO) carmustine (ISO) carnosic acid (ISO) casticin (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) corn oil (EXP) crocidolite asbestos (ISO) Cuprizon (EXP) curcumin (ISO) cyclophosphamide (ISO) cyclosporin A (ISO) cytarabine (ISO) D-glucose (ISO) DDE (ISO) DDT (ISO) dexamethasone (EXP) dextran sulfate (ISO) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) Ethoxyacetic acid (ISO) fenamidone (ISO) fenthion (ISO) fipronil (EXP) folic acid (ISO) formaldehyde (ISO) fulvestrant (ISO) furan (EXP) furosemide (EXP) gallocatechin (EXP) gamma-aminobutyric acid (EXP) gamma-Oryzanol (TN) (EXP) genistein (EXP) glucose (ISO) glycerol 2-phosphate (ISO) hydrogen peroxide (ISO) indometacin (ISO) isoflavones (ISO) ketamine (EXP) L-ascorbic acid (ISO) L-ascorbic acid 2-phosphate (ISO) L-methionine (ISO) lipopolysaccharide (ISO) losartan (EXP) magnesium atom (ISO) methamphetamine (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) methylmercury(1+) (EXP) N-ethyl-N-nitrosourea (EXP) N-methyl-4-phenylpyridinium (EXP) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) nefazodone (EXP) nimesulide (EXP) notoginsenoside R1 (ISO) oxaliplatin (EXP) p-toluidine (EXP) paclitaxel (ISO) palbociclib (ISO) paracetamol (EXP,ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) piroxicam (ISO) poly(vinylpyrrolidone) (EXP) potassium dichromate (ISO) progesterone (ISO) quercetin (EXP) raloxifene (EXP) resveratrol (EXP,ISO) rimonabant (ISO) rotenone (EXP) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (EXP,ISO) silver atom (EXP) silver(0) (EXP) sodium arsenite (ISO) sodium fluoride (EXP) Soman (EXP) streptozocin (ISO) sunitinib (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP,ISO) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) Trapidil (EXP) triacsin C (ISO) trichloroethene (EXP) triclosan (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vancomycin (ISO)
Cellular Component
basement membrane (IEA) cell surface (IEA,ISO) cytoplasm (IEA,ISO) extracellular matrix (ISO) extracellular region (IEA) extracellular space (IBA,IDA,IEA,ISO) glutamatergic synapse (EXP,IDA) intracellular membrane-bounded organelle (IEA,ISO) mitochondrion (ISO) nuclear matrix (IEA,ISO) plasma membrane (ISO) platelet alpha granule (IEA,ISO) platelet alpha granule membrane (IEA,ISO) synapse (EXP,IDA) vesicle (IDA)
1.
SPARC from olfactory ensheathing cells stimulates Schwann cells to promote neurite outgrowth and enhances spinal cord repair.
Au E, etal., J Neurosci. 2007 Jul 4;27(27):7208-21.
2.
Secreted protein, acidic and rich in cysteine (SPARC) and thrombospondin in the developing follicle and corpus luteum of the rat.
Bagavandoss P, etal., J Histochem Cytochem. 1998 Sep;46(9):1043-49.
3.
Activation of SPARC expression in reactive stroma associated with human epithelial ovarian cancer.
Brown TJ, etal., Gynecol Oncol. 1999 Oct;75(1):25-33.
4.
Adenovirus-mediated inhibition of SPARC attenuates liver fibrosis in rats.
Camino AM, etal., J Gene Med. 2008 Sep;10(9):993-1004.
5.
Extracellular Ca(2+)-sensing receptors modulate matrix production and mineralization in chondrogenic RCJ3.1C5.18 cells.
Chang W, etal., Endocrinology. 2002 Apr;143(4):1467-74.
6.
Purification of a calcium binding protein (rat SPARC) from primary Sertoli cell-enriched culture medium.
Cheng CY Biochem Biophys Res Commun. 1990 Mar 30;167(3):1393-9.
7.
Relative and absolute quantification of postsynaptic density proteome isolated from rat forebrain and cerebellum.
Cheng D, etal., Mol Cell Proteomics. 2006 Jun;5(6):1158-70. doi: 10.1074/mcp.D500009-MCP200. Epub 2006 Feb 28.
8.
Coordinate gene expression during neonatal rat heart development. A possible role for the myocyte in extracellular matrix biogenesis and capillary angiogenesis.
Engelmann GL Cardiovasc Res. 1993 Sep;27(9):1598-605.
9.
Regulation of selenoprotein P mRNA expression in comparison with metallothionein and osteonectin mRNAs following cadmium and dexamethasone administration.
Fujii M, etal., Kobe J Med Sci. 1997 Feb;43(1):13-23.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
SPARC gene expression is reduced in early diabetes-related kidney growth.
Gilbert RE, etal., Kidney Int. 1995 Oct;48(4):1216-25.
12.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
13.
Combined genealogical, mapping, and expression approaches to identify spontaneously hypertensive rat hypertension candidate genes.
Hinojos CA, etal., Hypertension 2005 Apr;45(4):698-704. Epub 2005 Feb 14.
14.
Osteonectin gene expression in fibrotic liver.
Inagaki H, etal., Life Sci. 1996;58(11):927-34.
15.
Gene expression and immunohistochemical localization of osteonectin in association with early bone formation in the developing mandible.
Ishigaki R, etal., Histochem J. 2002 Jan-Feb;34(1-2):57-66.
16.
SPARC gene expression is increased in diabetes-related mesenteric vascular hypertrophy.
Jandeleit-Dahm K, etal., Microvasc Res. 2000 Jan;59(1):61-71.
17.
Global methylation analysis identifies prognostically important epigenetically inactivated tumor suppressor genes in multiple myeloma.
Kaiser MF, etal., Blood. 2013 Jul 11;122(2):219-26. doi: 10.1182/blood-2013-03-487884. Epub 2013 May 22.
18.
Middle East Respiratory Syndrome-Coronavirus Infection into Established hDPP4-Transgenic Mice Accelerates Lung Damage Via Activation of the Pro-Inflammatory Response and Pulmonary Fibrosis.
Kim J, etal., J Microbiol Biotechnol. 2020 Mar 28;30(3):427-438. doi: 10.4014/jmb.1910.10055.
19.
The expression of molecular mediators in the idiopathic cutaneous calcification and ossification.
Kim SY, etal., J Cutan Pathol. 2008 Sep;35(9):826-31. doi: 10.1111/j.1600-0560.2007.00904.x. Epub 2008 Apr 18.
20.
Spatially and temporally different expression of osteonectin and osteopontin in the infarct zone of experimentally induced myocardial infarction in rats.
Komatsubara I, etal., Cardiovasc Pathol. 2003 Jul-Aug;12(4):186-94.
21.
Control of excitatory CNS synaptogenesis by astrocyte-secreted proteins Hevin and SPARC.
Kucukdereli H, etal., Proc Natl Acad Sci U S A. 2011 Aug 9;108(32):E440-9. doi: 10.1073/pnas.1104977108. Epub 2011 Jul 25.
22.
Microgravity signal ensnarls cell adhesion, cytoskeleton, and matrix proteins of rat osteoblasts: osteopontin, CD44, osteonectin, and alpha-tubulin.
Kumei Y, etal., Ann N Y Acad Sci. 2006 Dec;1090:311-7.
23.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
24.
Regional differences in expression of osteonectin mRNA after administration of cadmium to rats.
Lee MJ, etal., Arch Toxicol 1995;69(9):590-5.
25.
Gene expression profile of rat adipose tissue at the onset of high-fat-diet obesity.
Li J, etal., Am J Physiol Endocrinol Metab 2002 Jun;282(6):E1334-41.
26.
Osteonectin RNA and collagen alpha1(I) RNA in the developing rat maxilla.
Liao H, etal., Eur J Oral Sci 1998 Jan;106 Suppl 1:418-23.
27.
Appearance of osteonectin-expressing fibroblastic cells in early rat stomach carcinogenesis and stomach tumors induced with N-methyl-N'-nitro-N-nitrosoguanidine.
Maeng HY, etal., Jpn J Cancer Res. 2002 Sep;93(9):960-7.
28.
SPARC/osteonectin mRNA is induced in blood vessels following injury to the adult rat cerebral cortex.
Mendis DB, etal., Neurochem Res. 1998 Aug;23(8):1117-23.
29.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
30.
Expression of mRNA encoding extracellular matrix glycoproteins SPARC and SC1 is temporally and spatially regulated in the developing cochlea of the rat inner ear.
Mothe AJ and Brown IR, Hear Res. 2001 May;155(1-2):161-74.
31.
Matrix vesicles are carriers of bone morphogenetic proteins (BMPs), vascular endothelial growth factor (VEGF), and noncollagenous matrix proteins.
Nahar NN, etal., J Bone Miner Metab. 2008;26(5):514-9. Epub 2008 Aug 30.
32.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
33.
CD34+ fibrocytes in chronic cystitis and noninvasive and invasive urothelial carcinomas of the urinary bladder.
Nimphius W, etal., Virchows Arch. 2007 Feb;450(2):179-85.
34.
Molecular profile of catabolic versus anabolic treatment regimens of parathyroid hormone (PTH) in rat bone: an analysis by DNA microarray.
Onyia JE, etal., J Cell Biochem. 2005 May 15;95(2):403-18.
35.
SPARC is expressed by mesangial cells in experimental mesangial proliferative nephritis and inhibits platelet-derived-growth-factor-medicated mesangial cell proliferation in vitro.
Pichler RH, etal., Am J Pathol. 1996 Apr;148(4):1153-67.
36.
SPARC is expressed in renal interstitial fibrosis and in renal vascular injury.
Pichler RH, etal., Kidney Int. 1996 Dec;50(6):1978-89.
37.
Expression of SPARC (secreted protein, acidic and rich in cysteine) in healing intestinal anastomoses and short bowel syndrome in rats.
Puolakkainen P, etal., Dig Dis Sci. 1999 Aug;44(8):1554-64.
38.
Differential expression of SPARC and thrombospondin 1 in wound repair: immunolocalization and in situ hybridization.
Reed MJ, etal., J Histochem Cytochem. 1993 Oct;41(10):1467-77.
39.
GOA pipeline
RGD automated data pipeline
40.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
41.
Overexpression of SPARC protein contrasts with its transcriptional silencing by aberrant hypermethylation of SPARC CpG-rich region in endometrial carcinoma.
Rodriguez-Jimenez FJ, etal., Oncol Rep. 2007 Jun;17(6):1301-7.
42.
Normalization of the ovarian cancer microenvironment by SPARC.
Said N, etal., Mol Cancer Res. 2007 Oct;5(10):1015-30.
43.
SPARC expression in primary human renal cell carcinoma: upregulation of SPARC in sarcomatoid renal carcinoma.
Sakai N, etal., Hum Pathol. 2001 Oct;32(10):1064-70.
44.
Lead inhibits secretion of osteonectin/SPARC without significantly altering collagen or Hsp47 production in osteoblast-like ROS 17/2.8 cells.
Sauk JJ, etal., Toxicol Appl Pharmacol. 1992 Oct;116(2):240-7.
45.
Secreted protein acidic and rich in cysteine deficiency ameliorates renal inflammation and fibrosis in angiotensin hypertension.
Socha MJ, etal., Am J Pathol. 2007 Oct;171(4):1104-12. Epub 2007 Aug 23.
46.
Discovery of novel methylation biomarkers in cervical carcinoma by global demethylation and microarray analysis.
Sova P, etal., Cancer Epidemiol Biomarkers Prev. 2006 Jan;15(1):114-23.
47.
SPARC participates in the branching morphogenesis of developing fetal rat lung.
Strandjord TP, etal., Am J Respir Cell Mol Biol. 1995 Sep;13(3):279-87.
48.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
49.
Impaired expression of noncollagenous bone matrix protein mRNAs during fracture healing in ascorbic acid-deficient rats.
Sugimoto M, etal., J Bone Miner Res. 1998 Feb;13(2):271-8.
50.
The matricellular protein SPARC/osteonectin as a newly identified factor up-regulated in obesity.
Tartare-Deckert S, etal., J Biol Chem. 2001 Jun 22;276(25):22231-7. Epub 2001 Apr 9.
51.
Effects of parathyroid hormone on bone formation in a rat model for chronic alcohol abuse.
Turner RT, etal., Alcohol Clin Exp Res. 2001 May;25(5):667-71.
52.
Downregulation of SPARC expression is mediated by nitric oxide in rat mesangial cells and during endotoxemia in the rat.
Walpen S, etal., J Am Soc Nephrol. 2000 Mar;11(3):468-76.
53.
Analysis of the gene expression of SPARC and its prognostic value for bladder cancer.
Yamanaka M, etal., J Urol. 2001 Dec;166(6):2495-9.
Sparc Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 40,017,065 - 40,038,816 (-) NCBI GRCr8 mRatBN7.2 10 39,516,394 - 39,538,252 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 39,516,406 - 39,538,396 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 44,200,679 - 44,221,761 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 43,690,774 - 43,711,860 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 39,194,463 - 39,215,539 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 40,742,390 - 40,764,232 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 40,742,400 - 40,764,185 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 40,573,510 - 40,595,261 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 40,809,730 - 40,831,481 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 40,823,352 - 40,845,104 (-) NCBI Celera 10 38,848,158 - 38,869,906 (-) NCBI Celera RH 3.4 Map 10 414.6 RGD Cytogenetic Map 10 q22 NCBI
SPARC Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 151,661,096 - 151,686,915 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 151,661,096 - 151,686,975 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 151,040,657 - 151,066,476 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 151,021,201 - 151,046,710 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 151,021,203 - 151,046,710 NCBI Celera 5 147,122,406 - 147,147,929 (-) NCBI Celera Cytogenetic Map 5 q33.1 NCBI HuRef 5 146,186,043 - 146,212,010 (-) NCBI HuRef CHM1_1 5 150,473,070 - 150,499,042 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 152,200,073 - 152,225,896 (-) NCBI T2T-CHM13v2.0
Sparc Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 55,284,985 - 55,310,906 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 55,285,326 - 55,314,009 (-) Ensembl GRCm39 Ensembl GRCm38 11 55,394,159 - 55,420,080 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 55,394,500 - 55,423,183 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 55,208,003 - 55,233,582 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 55,237,924 - 55,263,289 (-) NCBI MGSCv36 mm8 Celera 11 59,982,920 - 59,995,424 (-) NCBI Celera Cytogenetic Map 11 B1.3 NCBI cM Map 11 33.04 NCBI
Sparc Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955408 6,099,003 - 6,122,459 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955408 6,100,123 - 6,122,460 (-) NCBI ChiLan1.0 ChiLan1.0
SPARC Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 146,892,751 - 146,917,550 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 145,032,296 - 145,057,021 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 147,087,903 - 147,112,466 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 153,091,160 - 153,115,745 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 153,090,181 - 153,115,750 (-) Ensembl panpan1.1 panPan2
SPARC Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 57,659,541 - 57,682,147 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 57,659,650 - 57,681,711 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 57,479,010 - 57,501,597 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 58,102,077 - 58,124,747 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 58,101,302 - 58,124,748 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 57,918,069 - 57,940,655 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 58,016,600 - 58,039,187 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 58,519,992 - 58,542,658 (+) NCBI UU_Cfam_GSD_1.0
Sparc Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 112,576,762 - 112,597,465 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936515 11,025,724 - 11,046,849 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936515 11,026,156 - 11,046,812 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SPARC Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 71,357,586 - 71,381,161 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 71,368,164 - 71,380,972 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 77,576,864 - 77,584,734 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SPARC Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 54,224,003 - 54,248,869 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 54,222,838 - 54,238,006 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 23,456,066 - 23,481,034 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sparc
.
Predicted Target Of
Count of predictions: 303 Count of miRNA genes: 175 Interacting mature miRNAs: 209 Transcripts: ENSRNOT00000017486 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61332 Eau3 Experimental allergic uveoretinitis QTL 3 0.004 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 34490559 45579777 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 1354614 Hpcl1 Hepatic cholesterol level QTL 1 3.3 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 35392267 51793994 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
RH128632
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 40,017,215 - 40,017,404 (+) Marker Load Pipeline mRatBN7.2 10 39,516,544 - 39,516,733 (+) MAPPER mRatBN7.2 Rnor_6.0 10 40,742,541 - 40,742,729 NCBI Rnor6.0 Rnor_5.0 10 40,573,661 - 40,573,849 UniSTS Rnor5.0 RGSC_v3.4 10 40,809,881 - 40,810,069 UniSTS RGSC3.4 Celera 10 38,848,309 - 38,848,497 UniSTS RH 3.4 Map 10 408.7 UniSTS Cytogenetic Map 10 q22 UniSTS
RH94599
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 39,516,435 - 39,516,593 (+) MAPPER mRatBN7.2 Rnor_6.0 10 40,742,432 - 40,742,589 NCBI Rnor6.0 Rnor_5.0 10 40,573,552 - 40,573,709 UniSTS Rnor5.0 RGSC_v3.4 10 40,809,772 - 40,809,929 UniSTS RGSC3.4 Celera 10 38,848,200 - 38,848,357 UniSTS RH 3.4 Map 10 414.6 UniSTS Cytogenetic Map 10 q22 UniSTS
RH140308
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 39,516,913 - 39,517,093 (+) MAPPER mRatBN7.2 Rnor_6.0 10 40,742,910 - 40,743,089 NCBI Rnor6.0 Rnor_5.0 10 40,574,030 - 40,574,209 UniSTS Rnor5.0 RGSC_v3.4 10 40,810,250 - 40,810,429 UniSTS RGSC3.4 Celera 10 38,848,678 - 38,848,857 UniSTS RH 3.4 Map 10 408.0 UniSTS Cytogenetic Map 10 q22 UniSTS
PMC151926P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 39,517,071 - 39,518,238 (+) MAPPER mRatBN7.2 Rnor_6.0 10 40,743,068 - 40,744,234 NCBI Rnor6.0 Rnor_5.0 10 40,574,188 - 40,575,354 UniSTS Rnor5.0 RGSC_v3.4 10 40,810,408 - 40,811,574 UniSTS RGSC3.4 Celera 10 38,848,836 - 38,850,002 UniSTS Cytogenetic Map 10 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017486 ⟹ ENSRNOP00000017486
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 39,516,416 - 39,538,242 (-) Ensembl Rnor_6.0 Ensembl 10 40,742,400 - 40,764,185 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098312 ⟹ ENSRNOP00000094410
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 39,516,406 - 39,538,396 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099801 ⟹ ENSRNOP00000083269
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 39,516,406 - 39,526,241 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115607 ⟹ ENSRNOP00000093140
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 39,517,585 - 39,538,180 (-) Ensembl
RefSeq Acc Id:
NM_012656 ⟹ NP_036788
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 40,017,065 - 40,038,816 (-) NCBI mRatBN7.2 10 39,516,394 - 39,538,149 (-) NCBI Rnor_6.0 10 40,742,390 - 40,764,141 (-) NCBI Rnor_5.0 10 40,573,510 - 40,595,261 (-) NCBI RGSC_v3.4 10 40,809,730 - 40,831,481 (-) RGD Celera 10 38,848,158 - 38,869,906 (-) RGD
Sequence:
TCTGCTGCCTGCCCAACTGCCTGCCTGCCTGTGCCGAGAGTTCCCAGCACCATGAGGGCCTGGATCTTCTTTCTCCTTTGCCTGGCCGGGAGGGCCCTGGCAGCGCCTCAGACGGAAGCTGCAGAAGA
hide sequence
RefSeq Acc Id:
NP_036788 ⟸ NM_012656
- Peptide Label:
precursor
- UniProtKB:
O08953 (UniProtKB/Swiss-Prot), Q6GSZ4 (UniProtKB/Swiss-Prot), P16975 (UniProtKB/Swiss-Prot), A6HEL9 (UniProtKB/TrEMBL), A0A8I6ALJ7 (UniProtKB/TrEMBL)
- Sequence:
MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKC
hide sequence
Ensembl Acc Id:
ENSRNOP00000017486 ⟸ ENSRNOT00000017486
Ensembl Acc Id:
ENSRNOP00000094410 ⟸ ENSRNOT00000098312
Ensembl Acc Id:
ENSRNOP00000083269 ⟸ ENSRNOT00000099801
Ensembl Acc Id:
ENSRNOP00000093140 ⟸ ENSRNOT00000115607
RGD ID: 13697202 Promoter ID: EPDNEW_R7726 Type: initiation region Name: Sparc_1 Description: secreted protein acidic and cysteine rich SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 40,764,175 - 40,764,235 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-03
Sparc
secreted protein acidic and cysteine rich
Sparc
secreted protein, acidic, cysteine-rich (osteonectin)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-18
Sparc
secreted protein, acidic, cysteine-rich (osteonectin)
Sparc
secreted acidic cysteine rich glycoprotein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Sparc
Secreted acidic cystein-rich glycoprotein (osteonectin)
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
mRNA expressed in osteoblasts, odontoblasts, and fibroblasts during development
730043
gene_expression
expression is increased 2.2 fold in SHR compared with WKY rats
1357414
gene_regulation
expression increases at the onset of high-fat-diet obesity
625747
