Symbol:
Plcb4
Name:
phospholipase C, beta 4
RGD ID:
3345
Description:
Enables mitogen-activated protein kinase binding activity. Involved in negative regulation of potassium ion transport. Predicted to be located in dendrite; nucleus; and plasma membrane. Predicted to be active in several cellular components, including glutamatergic synapse; parallel fiber to Purkinje cell synapse; and postsynaptic density. Orthologous to human PLCB4 (phospholipase C beta 4); PARTICIPATES IN G protein mediated signaling pathway via Galphaq family; protein kinase C (PKC) signaling pathway; Alzheimer's disease pathway; INTERACTS WITH 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-4; Beta4aa; phosphoinositide phospholipase C; phosphoinositide phospholipase C-beta-4; Phospholipase C (BETA4); Phospholipase C beta4; phospholipase C-beta-4; PLC-beta-4; RATBETA4AA
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PLCB4 (phospholipase C beta 4) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Plcb4 (phospholipase C, beta 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Plcb4 (phospholipase C beta 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PLCB4 (phospholipase C beta 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PLCB4 (phospholipase C beta 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Plcb4 (phospholipase C beta 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PLCB4 (phospholipase C beta 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PLCB4 (phospholipase C beta 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Plcb4 (phospholipase C beta 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NME5 (NME/NM23 family member 5) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Plcb4 (phospholipase C, beta 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PLCB4 (phospholipase C beta 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
egl-8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
norpA
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PLC1
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
plcb4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Allele / Splice:
Plcb4_v1
Plcb4_v2
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 143,405,721 - 143,775,129 (+) NCBI GRCr8 mRatBN7.2 3 122,952,965 - 123,322,522 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 122,953,196 - 123,322,392 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 126,861,256 - 127,230,065 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 135,448,283 - 135,807,045 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 133,116,870 - 133,485,687 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 128,601,163 - 128,971,720 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 128,756,799 - 128,971,746 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 135,089,551 - 135,459,248 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 123,706,313 - 124,077,381 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 123,611,885 - 123,982,941 (+) NCBI Celera 3 121,694,557 - 122,062,160 (+) NCBI Celera Cytogenetic Map 3 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Plcb4 Rat (+)-catechin multiple interactions ISO PLCB4 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of PLCB4 mRNA CTD PMID:24763279 Plcb4 Rat (+)-pilocarpine increases expression ISO Plcb4 (Mus musculus) 6480464 Pilocarpine results in increased expression of PLCB4 protein CTD PMID:18774262 Plcb4 Rat 1,2-dichloroethane decreases expression ISO Plcb4 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PLCB4 mRNA CTD PMID:28960355 Plcb4 Rat 1,3-dinitrobenzene decreases expression EXP 6480464 3-dinitrobenzene results in decreased expression of PLCB4 protein CTD PMID:24140754 Plcb4 Rat 17beta-estradiol multiple interactions ISO PLCB4 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of PLCB4 mRNA CTD PMID:30165855 Plcb4 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Plcb4 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Plcb4 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Plcb4 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Plcb4 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Plcb4 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Plcb4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO PLCB4 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of PLCB4 mRNA CTD PMID:22574217 Plcb4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLCB4 mRNA CTD PMID:34747641 Plcb4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Plcb4 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of PLCB4 mRNA CTD PMID:25975270 Plcb4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Plcb4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PLCB4 mRNA CTD PMID:24680724 Plcb4 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO PLCB4 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Plcb4 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 and PMID:32119087 Plcb4 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PLCB4 mRNA CTD PMID:24780913 more ... Plcb4 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of PLCB4 protein CTD PMID:33236894 Plcb4 Rat aflatoxin B1 decreases methylation ISO PLCB4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PLCB4 intron CTD PMID:30157460 Plcb4 Rat Aflatoxin B2 alpha increases methylation ISO PLCB4 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PLCB4 intron CTD PMID:30157460 Plcb4 Rat aflatoxin M1 decreases expression ISO PLCB4 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of PLCB4 mRNA CTD PMID:30928695 Plcb4 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PLCB4 mRNA CTD PMID:30047161 Plcb4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PLCB4 mRNA CTD PMID:16483693 Plcb4 Rat antirheumatic drug increases expression ISO PLCB4 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PLCB4 mRNA CTD PMID:24449571 Plcb4 Rat aristolochic acid A decreases expression ISO PLCB4 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PLCB4 mRNA CTD PMID:33212167 Plcb4 Rat arsenite(3-) decreases expression ISO Plcb4 (Mus musculus) 6480464 arsenite results in decreased expression of PLCB4 mRNA CTD PMID:33053406 Plcb4 Rat arsenite(3-) multiple interactions ISO PLCB4 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PLCB4 mRNA] CTD PMID:32406909 Plcb4 Rat arsenous acid decreases expression ISO Plcb4 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of PLCB4 mRNA and Arsenic Trioxide results in decreased expression of PLCB4 protein CTD PMID:24831965 Plcb4 Rat asbestos decreases expression ISO PLCB4 (Homo sapiens) 6480464 Asbestos results in decreased expression of PLCB4 mRNA CTD PMID:22398240 Plcb4 Rat Azoxymethane multiple interactions ISO Plcb4 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PLCB4 mRNA CTD PMID:29950665 Plcb4 Rat benzo[a]pyrene increases expression ISO PLCB4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PLCB4 mRNA CTD PMID:22316170 Plcb4 Rat benzo[a]pyrene affects methylation ISO PLCB4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PLCB4 5' UTR and Benzo(a)pyrene affects the methylation of PLCB4 intron CTD PMID:27901495 and PMID:30157460 Plcb4 Rat benzo[a]pyrene decreases methylation ISO PLCB4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PLCB4 promoter CTD PMID:27901495 Plcb4 Rat benzo[a]pyrene increases expression ISO Plcb4 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PLCB4 mRNA CTD PMID:22228805 Plcb4 Rat benzo[a]pyrene diol epoxide I decreases expression ISO PLCB4 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Plcb4 Rat benzo[b]fluoranthene decreases expression ISO Plcb4 (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of PLCB4 mRNA CTD PMID:26377693 Plcb4 Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of PLCB4 mRNA CTD PMID:15651846 Plcb4 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of PLCB4 mRNA CTD PMID:35810816 Plcb4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PLCB4 mRNA CTD PMID:25181051 more ... Plcb4 Rat bisphenol A decreases expression ISO Plcb4 (Mus musculus) 6480464 bisphenol A results in decreased expression of PLCB4 protein CTD PMID:36656826 Plcb4 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of PLCB4 mRNA CTD PMID:31129395 Plcb4 Rat bisphenol A increases methylation ISO Plcb4 (Mus musculus) 6480464 bisphenol A results in increased methylation of PLCB4 promoter CTD PMID:27312807 Plcb4 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PLCB4 gene CTD PMID:28505145 Plcb4 Rat bisphenol A increases expression ISO Plcb4 (Mus musculus) 6480464 bisphenol A results in increased expression of PLCB4 mRNA CTD PMID:25594700 Plcb4 Rat bisphenol F decreases expression ISO Plcb4 (Mus musculus) 6480464 bisphenol F results in decreased expression of PLCB4 mRNA CTD PMID:38685157 Plcb4 Rat butanal decreases expression ISO PLCB4 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PLCB4 mRNA CTD PMID:26079696 Plcb4 Rat cadmium dichloride decreases expression ISO Plcb4 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of PLCB4 mRNA CTD PMID:24982889 Plcb4 Rat calcitriol increases expression ISO PLCB4 (Homo sapiens) 6480464 Calcitriol results in increased expression of PLCB4 mRNA CTD PMID:26485663 Plcb4 Rat carbon nanotube decreases expression ISO Plcb4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Plcb4 Rat chloroprene increases expression ISO Plcb4 (Mus musculus) 6480464 Chloroprene results in increased expression of PLCB4 mRNA CTD PMID:23125180 Plcb4 Rat chromium(6+) multiple interactions ISO PLCB4 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of PLCB4 mRNA CTD PMID:38479592 Plcb4 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of PLCB4 mRNA CTD PMID:22023808 Plcb4 Rat cisplatin multiple interactions ISO PLCB4 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of PLCB4 mRNA CTD PMID:27392435 Plcb4 Rat cisplatin decreases expression ISO PLCB4 (Homo sapiens) 6480464 Cisplatin results in decreased expression of PLCB4 mRNA CTD PMID:27392435 Plcb4 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of PLCB4 mRNA CTD PMID:24386269 Plcb4 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of PLCB4 mRNA CTD PMID:30556269 Plcb4 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of PLCB4 mRNA CTD PMID:30556269 Plcb4 Rat crocidolite asbestos decreases expression ISO Plcb4 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of PLCB4 mRNA CTD PMID:29279043 Plcb4 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of PLCB4 mRNA CTD PMID:23914054 Plcb4 Rat dextran sulfate multiple interactions ISO Plcb4 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PLCB4 mRNA CTD PMID:29950665 Plcb4 Rat diallyl trisulfide increases expression ISO PLCB4 (Homo sapiens) 6480464 diallyl trisulfide results in increased expression of PLCB4 mRNA CTD PMID:34995734 Plcb4 Rat diarsenic trioxide decreases expression ISO Plcb4 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of PLCB4 mRNA and Arsenic Trioxide results in decreased expression of PLCB4 protein CTD PMID:24831965 Plcb4 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of PLCB4 mRNA CTD PMID:21266533 Plcb4 Rat doxorubicin decreases expression ISO PLCB4 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PLCB4 mRNA CTD PMID:29803840 Plcb4 Rat elemental selenium decreases expression ISO PLCB4 (Homo sapiens) 6480464 Selenium results in decreased expression of PLCB4 mRNA CTD PMID:19244175 Plcb4 Rat elemental selenium multiple interactions ISO PLCB4 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of PLCB4 mRNA CTD PMID:19244175 Plcb4 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PLCB4 mRNA CTD PMID:29391264 Plcb4 Rat epoxiconazole increases expression ISO Plcb4 (Mus musculus) 6480464 epoxiconazole results in increased expression of PLCB4 mRNA CTD PMID:35436446 Plcb4 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of PLCB4 mRNA CTD PMID:20655511 Plcb4 Rat ethanol affects splicing ISO Plcb4 (Mus musculus) 6480464 Ethanol affects the splicing of PLCB4 mRNA CTD PMID:30319688 Plcb4 Rat fingolimod hydrochloride multiple interactions ISO PLCB4 (Homo sapiens) 6480464 Fingolimod Hydrochloride inhibits the reaction [sphingosine 1-phosphate results in increased expression of PLCB4 protein] CTD PMID:25980589 Plcb4 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of PLCB4 mRNA CTD PMID:18035473 Plcb4 Rat folic acid decreases expression ISO Plcb4 (Mus musculus) 6480464 Folic Acid results in decreased expression of PLCB4 mRNA CTD PMID:25629700 Plcb4 Rat FR900359 decreases phosphorylation ISO PLCB4 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of PLCB4 protein CTD PMID:37730182 Plcb4 Rat hexachlorophene increases methylation ISO Plcb4 (Mus musculus) 6480464 Hexachlorophene results in increased methylation of PLCB4 promoter CTD PMID:29301063 Plcb4 Rat hydrogen cyanide decreases expression ISO Plcb4 (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of PLCB4 mRNA CTD PMID:33914522 Plcb4 Rat isoprenaline increases expression ISO Plcb4 (Mus musculus) 6480464 Isoproterenol results in increased expression of PLCB4 mRNA CTD PMID:20003209 Plcb4 Rat malathion increases expression ISO PLCB4 (Homo sapiens) 6480464 Malathion results in increased expression of PLCB4 mRNA CTD PMID:37047231 Plcb4 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PLCB4 mRNA CTD PMID:30047161 Plcb4 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PLCB4 gene CTD PMID:35440735 Plcb4 Rat methylmercury chloride decreases expression ISO PLCB4 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PLCB4 mRNA CTD PMID:28001369 Plcb4 Rat methylseleninic acid increases expression ISO PLCB4 (Homo sapiens) 6480464 methylselenic acid results in increased expression of PLCB4 mRNA CTD PMID:12517777 Plcb4 Rat mitoxantrone affects response to substance ISO PLCB4 (Homo sapiens) 6480464 PLCB4 protein affects the susceptibility to Mitoxantrone CTD PMID:16217747 Plcb4 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PLCB4 gene CTD PMID:33148267 Plcb4 Rat nickel atom decreases expression ISO PLCB4 (Homo sapiens) 6480464 Nickel results in decreased expression of PLCB4 mRNA CTD PMID:24768652 and PMID:25583101 Plcb4 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PLCB4 mRNA CTD PMID:25729387 Plcb4 Rat paracetamol decreases expression ISO PLCB4 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PLCB4 mRNA CTD PMID:26690555 Plcb4 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PLCB4 mRNA CTD PMID:33387578 Plcb4 Rat PCB138 multiple interactions ISO Plcb4 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Plcb4 Rat perfluorooctanoic acid decreases expression ISO Plcb4 (Mus musculus) 6480464 perfluorooctanoic acid results in decreased expression of PLCB4 mRNA CTD PMID:17681415 Plcb4 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PLCB4 gene CTD PMID:33148267 Plcb4 Rat pirinixic acid increases expression ISO Plcb4 (Mus musculus) 6480464 pirinixic acid results in increased expression of PLCB4 mRNA CTD PMID:18301758 Plcb4 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of PLCB4 mRNA CTD PMID:19162173 Plcb4 Rat potassium dichromate decreases expression ISO PLCB4 (Homo sapiens) 6480464 Potassium Dichromate results in decreased expression of PLCB4 protein CTD PMID:23718831 Plcb4 Rat potassium dichromate increases expression ISO Plcb4 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of PLCB4 mRNA CTD PMID:23608068 Plcb4 Rat progesterone increases expression ISO Plcb4 (Mus musculus) 6480464 Progesterone results in increased expression of PLCB4 mRNA CTD PMID:22238285 Plcb4 Rat propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of PLCB4 mRNA CTD PMID:30047161 Plcb4 Rat selenium atom decreases expression ISO PLCB4 (Homo sapiens) 6480464 Selenium results in decreased expression of PLCB4 mRNA CTD PMID:19244175 Plcb4 Rat selenium atom multiple interactions ISO PLCB4 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of PLCB4 mRNA CTD PMID:19244175 Plcb4 Rat sodium arsenate increases expression ISO Plcb4 (Mus musculus) 6480464 sodium arsenate results in increased expression of PLCB4 mRNA CTD PMID:21795629 Plcb4 Rat sodium arsenite decreases expression ISO PLCB4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PLCB4 mRNA CTD PMID:22714537 Plcb4 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of PLCB4 protein CTD PMID:29459688 Plcb4 Rat sodium fluoride increases expression ISO Plcb4 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of PLCB4 protein CTD PMID:28918527 Plcb4 Rat sphingosine 1-phosphate increases expression ISO PLCB4 (Homo sapiens) 6480464 sphingosine 1-phosphate results in increased expression of PLCB4 protein CTD PMID:25980589 Plcb4 Rat sphingosine 1-phosphate multiple interactions ISO PLCB4 (Homo sapiens) 6480464 Fingolimod Hydrochloride inhibits the reaction [sphingosine 1-phosphate results in increased expression of PLCB4 protein] and Phytochemicals analog inhibits the reaction [sphingosine 1-phosphate results in increased expression of PLCB4 protein] CTD PMID:25980589 Plcb4 Rat succimer multiple interactions ISO Plcb4 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of PLCB4 mRNA CTD PMID:21641980 Plcb4 Rat sunitinib increases expression ISO PLCB4 (Homo sapiens) 6480464 Sunitinib results in increased expression of PLCB4 mRNA CTD PMID:31533062 Plcb4 Rat thimerosal decreases expression ISO PLCB4 (Homo sapiens) 6480464 Thimerosal results in decreased expression of PLCB4 mRNA CTD PMID:27188386 Plcb4 Rat titanium dioxide multiple interactions ISO Plcb4 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PLCB4 mRNA CTD PMID:29950665 Plcb4 Rat toluene affects expression EXP 6480464 Toluene affects the expression of PLCB4 mRNA CTD PMID:21827849 Plcb4 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PLCB4 mRNA CTD PMID:25729387 Plcb4 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of PLCB4 mRNA CTD PMID:31129395 Plcb4 Rat trichostatin A increases expression ISO PLCB4 (Homo sapiens) 6480464 trichostatin A results in increased expression of PLCB4 mRNA CTD PMID:24935251 Plcb4 Rat trichostatin A affects expression ISO PLCB4 (Homo sapiens) 6480464 trichostatin A affects the expression of PLCB4 mRNA CTD PMID:28542535 Plcb4 Rat triptonide decreases expression ISO Plcb4 (Mus musculus) 6480464 triptonide results in decreased expression of PLCB4 mRNA CTD PMID:33045310 Plcb4 Rat valproic acid affects expression ISO PLCB4 (Homo sapiens) 6480464 Valproic Acid affects the expression of PLCB4 mRNA CTD PMID:25979313 Plcb4 Rat valproic acid decreases methylation ISO PLCB4 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of PLCB4 gene CTD PMID:29154799 Plcb4 Rat valproic acid increases expression ISO PLCB4 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PLCB4 mRNA CTD PMID:23179753 and PMID:24935251 Plcb4 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of PLCB4 gene CTD PMID:31682807 Plcb4 Rat vitamin E multiple interactions ISO PLCB4 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of PLCB4 mRNA CTD PMID:19244175 Plcb4 Rat vitamin E decreases expression ISO PLCB4 (Homo sapiens) 6480464 Vitamin E results in decreased expression of PLCB4 mRNA CTD PMID:19244175 Plcb4 Rat vorinostat decreases expression ISO PLCB4 (Homo sapiens) 6480464 vorinostat results in decreased expression of PLCB4 mRNA CTD PMID:27188386 Plcb4 Rat XL147 multiple interactions ISO Plcb4 (Mus musculus) 6480464 XL147 inhibits the reaction [N-nitroso-tris-chloroethylurea results in increased expression of PLCB4 mRNA] CTD PMID:29891994 Plcb4 Rat zinc atom increases expression EXP 6480464 Zinc results in increased expression of PLCB4 mRNA CTD PMID:17074742 Plcb4 Rat zinc sulfate increases expression EXP 6480464 Zinc Sulfate results in increased expression of PLCB4 mRNA CTD PMID:17074742 Plcb4 Rat zinc(0) increases expression EXP 6480464 Zinc results in increased expression of PLCB4 mRNA CTD PMID:17074742
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) (+)-pilocarpine (ISO) 1,2-dichloroethane (ISO) 1,3-dinitrobenzene (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 6-propyl-2-thiouracil (EXP) aconitine (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aflatoxin M1 (ISO) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) asbestos (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) chloroprene (ISO) chromium(6+) (ISO) cisplatin (EXP,ISO) cobalt dichloride (EXP) copper atom (EXP) copper(0) (EXP) crocidolite asbestos (ISO) decabromodiphenyl ether (EXP) dextran sulfate (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (EXP,ISO) fingolimod hydrochloride (ISO) flavonoids (EXP) folic acid (ISO) FR900359 (ISO) hexachlorophene (ISO) hydrogen cyanide (ISO) isoprenaline (ISO) malathion (ISO) methimazole (EXP) methoxychlor (EXP) methylmercury chloride (ISO) methylseleninic acid (ISO) mitoxantrone (ISO) N,N-diethyl-m-toluamide (EXP) nickel atom (ISO) oxaliplatin (EXP) paracetamol (EXP,ISO) PCB138 (ISO) perfluorooctanoic acid (ISO) permethrin (EXP) pirinixic acid (EXP,ISO) potassium dichromate (ISO) progesterone (ISO) propiconazole (EXP) selenium atom (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium fluoride (ISO) sphingosine 1-phosphate (ISO) succimer (ISO) sunitinib (ISO) thimerosal (ISO) titanium dioxide (ISO) toluene (EXP) topotecan (EXP) tributylstannane (EXP) trichostatin A (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO) XL147 (ISO) zinc atom (EXP) zinc sulfate (EXP) zinc(0) (EXP)
1.
A unique isoform of phospholipase Cbeta4 highly expressed in the cerebellum and eye.
Adamski FM, etal., Biochim Biophys Acta 1999 Jan 18;1444(1):55-60.
2.
Fear conditioning is associated with altered integration of PLC and ERK signaling in the hippocampus.
Buckley CT and Caldwell KK, Pharmacol Biochem Behav. 2004 Dec;79(4):633-40.
3.
Stimulation of 5-HT(2) receptors in prefrontal pyramidal neurons inhibits Ca(v)1.2 L type Ca(2+) currents via a PLCbeta/IP3/calcineurin signaling cascade.
Day M, etal., J Neurophysiol 2002 May;87(5):2490-504.
4.
Stimulation of phospholipase Cbeta by membrane interactions, interdomain movement, and G protein binding--how many ways can you activate an enzyme?
Drin G and Scarlata S, Cell Signal. 2007 Jul;19(7):1383-92. Epub 2007 Apr 29.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Bradykinin, but not muscarinic, inhibition of M-current in rat sympathetic ganglion neurons involves phospholipase C-beta 4.
Haley JE, etal., J Neurosci. 2000 Nov 1;20(21):RC105.
7.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
8.
Cloning of cDNA encoding rat phospholipase C-beta 4, a new member of the phospholipase C.
Kim MJ, etal., Biochem Biophys Res Commun 1993 Jul 30;194(2):706-12.
9.
A cytosolic, galphaq- and betagamma-insensitive splice variant of phospholipase C-beta4.
Kim MJ, etal., J Biol Chem 1998 Feb 6;273(6):3618-24.
10.
Purification, molecular cloning, and sequencing of phospholipase C-beta 4.
Lee CW, etal., J Biol Chem 1993 Oct 5;268(28):21318-27.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
14.
Translation of clock rhythmicity into neural firing in suprachiasmatic nucleus requires mGluR-PLCbeta4 signaling.
Park D, etal., Nat Neurosci 2003 Apr;6(4):337-8.
15.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
16.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
Regulation of phosphoinositide-specific phospholipase C.
Rhee SG Annu Rev Biochem. 2001;70:281-312.
19.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Plcb4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 143,405,721 - 143,775,129 (+) NCBI GRCr8 mRatBN7.2 3 122,952,965 - 123,322,522 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 122,953,196 - 123,322,392 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 126,861,256 - 127,230,065 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 135,448,283 - 135,807,045 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 133,116,870 - 133,485,687 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 128,601,163 - 128,971,720 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 128,756,799 - 128,971,746 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 135,089,551 - 135,459,248 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 123,706,313 - 124,077,381 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 123,611,885 - 123,982,941 (+) NCBI Celera 3 121,694,557 - 122,062,160 (+) NCBI Celera Cytogenetic Map 3 q36 NCBI
PLCB4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 9,068,678 - 9,480,808 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 9,067,825 - 9,504,593 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 9,049,325 - 9,461,455 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 9,024,932 - 9,409,463 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 9,024,931 - 9,409,460 NCBI Celera 20 9,119,817 - 9,531,474 (+) NCBI Celera Cytogenetic Map 20 p12.3-p12.2 NCBI HuRef 20 9,001,542 - 9,413,398 (+) NCBI HuRef CHM1_1 20 9,050,899 - 9,462,613 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 9,111,633 - 9,523,716 (+) NCBI T2T-CHM13v2.0
Plcb4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 135,500,523 - 135,856,522 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 135,500,931 - 135,856,513 (+) Ensembl GRCm39 Ensembl GRCm38 2 135,658,603 - 136,014,602 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 135,659,011 - 136,014,593 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 135,567,566 - 135,838,804 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 135,433,271 - 135,704,509 (+) NCBI MGSCv36 mm8 Celera 2 136,939,191 - 137,211,347 (+) NCBI Celera Cytogenetic Map 2 F3 NCBI cM Map 2 66.64 NCBI
Plcb4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 19,310,917 - 19,463,098 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 19,108,120 - 19,462,084 (+) NCBI ChiLan1.0 ChiLan1.0
PLCB4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 9,967,849 - 10,403,434 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 9,964,676 - 10,400,261 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 9,042,127 - 9,454,207 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 8,846,152 - 9,456,443 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 9,192,061 - 9,456,443 (+) Ensembl panpan1.1 panPan2
PLCB4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 12,750,631 - 13,169,697 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 12,752,083 - 13,169,745 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 12,575,552 - 12,993,940 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 13,157,425 - 13,576,878 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 13,157,425 - 13,576,868 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 12,769,385 - 13,187,876 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 12,868,981 - 13,288,064 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 13,206,767 - 13,626,337 (-) NCBI UU_Cfam_GSD_1.0
Plcb4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 161,560,396 - 161,921,708 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936485 9,991,299 - 10,353,123 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936485 9,991,731 - 10,353,231 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PLCB4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 17,916,110 - 18,402,532 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 17,915,984 - 18,402,540 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 20,428,956 - 20,770,454 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PLCB4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 28,650,604 - 29,059,435 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 28,650,421 - 28,915,290 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666071 15,510,020 - 15,919,543 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Plcb4
.
Predicted Target Of
Count of predictions: 626 Count of miRNA genes: 187 Interacting mature miRNAs: 226 Transcripts: ENSRNOT00000042853, ENSRNOT00000045393, ENSRNOT00000049855 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1358204 Insglur1 Insulin/glucose ratio QTL 1 3.8 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 3 115638168 135181505 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1331758 Bp207 Blood pressure QTL 207 2.848 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 112287552 135181505 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
D3Wox21
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 123,321,035 - 123,321,202 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,970,363 - 128,970,529 NCBI Rnor6.0 Rnor_5.0 3 135,457,891 - 135,458,057 UniSTS Rnor5.0 RGSC_v3.4 3 124,076,024 - 124,076,190 UniSTS RGSC3.4 Celera 3 122,060,803 - 122,060,969 UniSTS Cytogenetic Map 3 q36 UniSTS
D3Rat112
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 123,217,730 - 123,217,913 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,867,047 - 128,867,229 NCBI Rnor6.0 Rnor_5.0 3 135,354,182 - 135,354,364 UniSTS Rnor5.0 RGSC_v3.4 3 123,971,719 - 123,971,902 RGD RGSC3.4 RGSC_v3.4 3 123,971,720 - 123,971,902 UniSTS RGSC3.4 RGSC_v3.1 3 123,877,293 - 123,877,475 RGD Celera 3 121,956,650 - 121,956,832 UniSTS RH 3.4 Map 3 1081.6 RGD RH 3.4 Map 3 1081.6 UniSTS RH 2.0 Map 3 724.8 RGD SHRSP x BN Map 3 60.7499 RGD Cytogenetic Map 3 q36 UniSTS
D3Rat157
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 143,520,350 - 143,520,503 (+) Marker Load Pipeline mRatBN7.2 3 123,067,607 - 123,067,760 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,716,357 - 128,716,509 NCBI Rnor6.0 Rnor_5.0 3 135,204,992 - 135,205,144 UniSTS Rnor5.0 RGSC_v3.4 3 123,822,201 - 123,822,354 RGD RGSC3.4 RGSC_v3.4 3 123,822,202 - 123,822,354 UniSTS RGSC3.4 RGSC_v3.1 3 123,727,775 - 123,727,927 RGD Celera 3 121,808,597 - 121,808,709 UniSTS RH 3.4 Map 3 1079.6 RGD RH 3.4 Map 3 1079.6 UniSTS RH 2.0 Map 3 721.1 RGD SHRSP x BN Map 3 60.7899 RGD FHH x ACI Map 3 76.92 RGD Cytogenetic Map 3 q36 UniSTS
D3Rat255
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 122,980,747 - 122,980,996 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,628,848 - 128,629,098 NCBI Rnor6.0 Rnor_5.0 3 135,117,504 - 135,117,754 UniSTS Rnor5.0 RGSC_v3.4 3 123,734,009 - 123,734,258 RGD RGSC3.4 RGSC_v3.4 3 123,734,008 - 123,734,258 UniSTS RGSC3.4 RGSC_v3.1 3 123,639,335 - 123,639,846 RGD Celera 3 121,722,146 - 121,722,386 UniSTS SHRSP x BN Map 3 59.6699 RGD SHRSP x BN Map 3 59.6699 UniSTS Cytogenetic Map 3 q36 UniSTS
RH143113
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 143,690,824 - 143,690,950 (+) Marker Load Pipeline mRatBN7.2 3 123,238,090 - 123,238,217 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,887,410 - 128,887,536 NCBI Rnor6.0 Rnor_5.0 3 135,374,545 - 135,374,671 UniSTS Rnor5.0 RGSC_v3.4 3 123,992,083 - 123,992,209 UniSTS RGSC3.4 Celera 3 121,977,081 - 121,977,207 UniSTS RH 3.4 Map 3 1084.4 UniSTS Cytogenetic Map 3 q36 UniSTS
AW534127
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 143,591,979 - 143,592,128 (+) Marker Load Pipeline mRatBN7.2 3 123,139,242 - 123,139,391 (+) MAPPER mRatBN7.2 Rnor_6.0 3 128,788,971 - 128,789,119 NCBI Rnor6.0 Rnor_5.0 3 135,276,034 - 135,276,182 UniSTS Rnor5.0 RGSC_v3.4 3 123,893,184 - 123,893,332 UniSTS RGSC3.4 Celera 3 121,878,575 - 121,878,723 UniSTS RH 3.4 Map 3 1081.6 UniSTS Cytogenetic Map 3 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000042853 ⟹ ENSRNOP00000048553
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 123,107,067 - 123,322,377 (+) Ensembl Rnor_6.0 Ensembl 3 128,756,799 - 128,971,704 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000045393 ⟹ ENSRNOP00000045972
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 123,178,791 - 123,322,392 (+) Ensembl Rnor_6.0 Ensembl 3 128,828,331 - 128,971,746 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000049855 ⟹ ENSRNOP00000048775
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 123,107,067 - 123,321,123 (+) Ensembl Rnor_6.0 Ensembl 3 128,756,799 - 128,970,450 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095786 ⟹ ENSRNOP00000091621
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 123,107,067 - 123,322,377 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097572 ⟹ ENSRNOP00000087693
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 122,953,196 - 123,320,907 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105709 ⟹ ENSRNOP00000076875
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 123,040,696 - 123,322,383 (+) Ensembl
RefSeq Acc Id:
NM_024353 ⟹ NP_077329
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,405,973 - 143,775,124 (+) NCBI mRatBN7.2 3 122,953,220 - 123,322,393 (+) NCBI Rnor_6.0 3 128,601,330 - 128,971,720 (+) NCBI Rnor_5.0 3 135,089,551 - 135,459,248 (+) NCBI RGSC_v3.4 3 123,706,313 - 124,077,381 (+) RGD Celera 3 121,694,557 - 122,062,160 (+) RGD
Sequence:
GAATTCCGCCGCGCCGCAAACAGGCTCTTACAGGCGCGCACACAGACACGCGCGCGCGCACACAGCGGGGTTCCCGGAGGCGGCGGTGGCCGCATCCCCAGCAGCGACTCGCCTCGAAGTGACAGGAG
hide sequence
RefSeq Acc Id:
XM_006235083 ⟹ XP_006235145
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,406,022 - 143,775,129 (+) NCBI mRatBN7.2 3 122,953,169 - 123,320,907 (+) NCBI Rnor_6.0 3 128,601,284 - 128,971,720 (+) NCBI Rnor_5.0 3 135,089,551 - 135,459,248 (+) NCBI
Sequence:
GGCCGCGGCGGCGGGGAGGGGGTGGCGGCGCGCGAGCGGCTAAGGAGCCGCGCCGCAAACAGGC
hide sequence
RefSeq Acc Id:
XM_006235085 ⟹ XP_006235147
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,405,782 - 143,775,129 (+) NCBI mRatBN7.2 3 122,952,965 - 123,320,907 (+) NCBI Rnor_6.0 3 128,601,163 - 128,971,720 (+) NCBI Rnor_5.0 3 135,089,551 - 135,459,248 (+) NCBI
Sequence:
GCGGGAGCGGCGGGCGGGCGGAGCCCTGGGCAGCGGGCGGACGAGGAGCCTGCTGGCTAGTTTCTCTGTGAGTGCTGAAAACCATTTGAGAGGATTCTCAACAAAGCACCCTGGGGTCTGTGCACAGG
hide sequence
RefSeq Acc Id:
XM_006235088 ⟹ XP_006235150
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,515,131 - 143,775,129 (+) NCBI mRatBN7.2 3 123,060,160 - 123,320,907 (+) NCBI Rnor_6.0 3 128,711,100 - 128,971,720 (+) NCBI Rnor_5.0 3 135,089,551 - 135,459,248 (+) NCBI
Sequence:
TTTCTCCAGCCTCTGTATTTTTTAATTTTTTTTAATGGAAAAAAGGATGGTTCTAGGGCTTGAT
hide sequence
RefSeq Acc Id:
XM_006235094 ⟹ XP_006235156
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,406,022 - 143,775,129 (+) NCBI mRatBN7.2 3 122,953,307 - 123,321,152 (+) NCBI Rnor_6.0 3 128,601,284 - 128,971,720 (+) NCBI Rnor_5.0 3 135,089,551 - 135,459,248 (+) NCBI
Sequence:
GGCCGCGGCGGCGGGGAGGGGGTGGCGGCGCGCGAGCGGCTAAGGAGCCGCGCCGCAAACAGGC
hide sequence
RefSeq Acc Id:
XM_039104317 ⟹ XP_038960245
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,406,022 - 143,775,129 (+) NCBI mRatBN7.2 3 122,953,169 - 123,320,907 (+) NCBI
RefSeq Acc Id:
XM_039104319 ⟹ XP_038960247
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,523,410 - 143,775,129 (+) NCBI mRatBN7.2 3 123,070,667 - 123,320,907 (+) NCBI
RefSeq Acc Id:
XM_039104320 ⟹ XP_038960248
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,479,865 - 143,775,129 (+) NCBI mRatBN7.2 3 123,027,100 - 123,320,907 (+) NCBI
RefSeq Acc Id:
XM_039104321 ⟹ XP_038960249
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,405,934 - 143,775,129 (+) NCBI mRatBN7.2 3 122,953,169 - 123,320,907 (+) NCBI
RefSeq Acc Id:
XM_039104322 ⟹ XP_038960250
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,406,035 - 143,775,129 (+) NCBI mRatBN7.2 3 122,953,169 - 123,320,907 (+) NCBI
RefSeq Acc Id:
XM_039104323 ⟹ XP_038960251
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,405,934 - 143,775,129 (+) NCBI mRatBN7.2 3 122,953,169 - 123,320,907 (+) NCBI
RefSeq Acc Id:
XM_039104324 ⟹ XP_038960252
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,515,131 - 143,775,129 (+) NCBI mRatBN7.2 3 123,060,160 - 123,320,907 (+) NCBI
RefSeq Acc Id:
XM_039104325 ⟹ XP_038960253
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,405,786 - 143,775,129 (+) NCBI mRatBN7.2 3 122,952,965 - 123,320,907 (+) NCBI
RefSeq Acc Id:
XM_039104328 ⟹ XP_038960256
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,699,917 - 143,775,129 (+) NCBI mRatBN7.2 3 123,247,184 - 123,322,522 (+) NCBI
RefSeq Acc Id:
XM_063283129 ⟹ XP_063139199
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,405,721 - 143,775,129 (+) NCBI
RefSeq Acc Id:
XM_063283130 ⟹ XP_063139200
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,523,410 - 143,775,129 (+) NCBI
RefSeq Acc Id:
XM_063283131 ⟹ XP_063139201
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,405,782 - 143,775,129 (+) NCBI
RefSeq Acc Id:
XM_063283132 ⟹ XP_063139202
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,405,721 - 143,775,129 (+) NCBI
RefSeq Acc Id:
XM_063283133 ⟹ XP_063139203
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,515,131 - 143,775,129 (+) NCBI
RefSeq Acc Id:
XM_063283134 ⟹ XP_063139204
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,405,932 - 143,775,129 (+) NCBI
RefSeq Acc Id:
XM_063283135 ⟹ XP_063139205
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,406,022 - 143,775,129 (+) NCBI
RefSeq Acc Id:
XM_063283136 ⟹ XP_063139206
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 143,406,022 - 143,775,129 (+) NCBI
RefSeq Acc Id:
NP_077329 ⟸ NM_024353
- UniProtKB:
Q9Z0G6 (UniProtKB/Swiss-Prot), Q9QW07 (UniProtKB/Swiss-Prot), O88356 (UniProtKB/Swiss-Prot), F1LNK2 (UniProtKB/TrEMBL)
- Sequence:
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRLAAIPKDPKILAALESVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEITKQWVEG
hide sequence
RefSeq Acc Id:
XP_006235147 ⟸ XM_006235085
- Peptide Label:
isoform X1
- UniProtKB:
D4A8C5 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
- Sequence:
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSL
hide sequence
RefSeq Acc Id:
XP_006235145 ⟸ XM_006235083
- Peptide Label:
isoform X1
- Sequence:
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRLAAIPKDPKILAALESVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEITKQWVEG
hide sequence
RefSeq Acc Id:
XP_006235156 ⟸ XM_006235094
- Peptide Label:
isoform X4
- Sequence:
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSL
hide sequence
RefSeq Acc Id:
XP_006235150 ⟸ XM_006235088
- Peptide Label:
isoform X1
- UniProtKB:
D4A8C5 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
- Sequence:
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRLAAIPKDPKILAALESVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEITKQWVEG
hide sequence
Ensembl Acc Id:
ENSRNOP00000045972 ⟸ ENSRNOT00000045393
Ensembl Acc Id:
ENSRNOP00000048775 ⟸ ENSRNOT00000049855
Ensembl Acc Id:
ENSRNOP00000048553 ⟸ ENSRNOT00000042853
RefSeq Acc Id:
XP_038960253 ⟸ XM_039104325
- Peptide Label:
isoform X1
- UniProtKB:
D4A8C5 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038960245 ⟸ XM_039104317
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038960250 ⟸ XM_039104322
- Peptide Label:
isoform X1
- UniProtKB:
D4A8C5 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038960251 ⟸ XM_039104323
- Peptide Label:
isoform X1
- UniProtKB:
D4A8C5 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038960249 ⟸ XM_039104321
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038960248 ⟸ XM_039104320
- Peptide Label:
isoform X1
- UniProtKB:
D4A8C5 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038960252 ⟸ XM_039104324
- Peptide Label:
isoform X1
- UniProtKB:
D4A8C5 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038960247 ⟸ XM_039104319
- Peptide Label:
isoform X1
- UniProtKB:
D4A8C5 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038960256 ⟸ XM_039104328
- Peptide Label:
isoform X5
Ensembl Acc Id:
ENSRNOP00000091621 ⟸ ENSRNOT00000095786
Ensembl Acc Id:
ENSRNOP00000076875 ⟸ ENSRNOT00000105709
Ensembl Acc Id:
ENSRNOP00000087693 ⟸ ENSRNOT00000097572
RefSeq Acc Id:
XP_063139199 ⟸ XM_063283129
- Peptide Label:
isoform X1
- UniProtKB:
D4A8C5 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139202 ⟸ XM_063283132
- Peptide Label:
isoform X1
- UniProtKB:
D4A8C5 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139201 ⟸ XM_063283131
- Peptide Label:
isoform X1
- UniProtKB:
D4A8C5 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139204 ⟸ XM_063283134
- Peptide Label:
isoform X2
- UniProtKB:
A6HQJ1 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139206 ⟸ XM_063283136
- Peptide Label:
isoform X3
- UniProtKB:
Q9Z0G6 (UniProtKB/Swiss-Prot), Q9QW07 (UniProtKB/Swiss-Prot), O88356 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063139205 ⟸ XM_063283135
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063139203 ⟸ XM_063283133
- Peptide Label:
isoform X2
- UniProtKB:
A6HQJ1 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139200 ⟸ XM_063283130
- Peptide Label:
isoform X1
- UniProtKB:
D4A8C5 (UniProtKB/TrEMBL), A0A8I5Y961 (UniProtKB/TrEMBL)
BioCyc Gene G2FUF-47732 BioCyc
BioCyc Pathway PWY-6351 [D-myo-inositol (1,4,5)-trisphosphate biosynthesis] BioCyc
PWY-6367 [D-myo-inositol-5-phosphate metabolism] BioCyc
PWY-8052 [2-arachidonoylglycerol biosynthesis] BioCyc
BioCyc Pathway Image PWY-6351 BioCyc
PWY-6367 BioCyc
PWY-8052 BioCyc
Ensembl Genes ENSRNOG00000033119 Ensembl, ENTREZGENE
Ensembl Transcript ENSRNOT00000042853 ENTREZGENE
ENSRNOT00000045393 ENTREZGENE
ENSRNOT00000097572 ENTREZGENE
ENSRNOT00000105709 ENTREZGENE
Gene3D-CATH 1.20.1230.10 UniProtKB/Swiss-Prot
2.30.29.240 UniProtKB/Swiss-Prot
2.60.40.150 UniProtKB/Swiss-Prot
3.20.20.190 UniProtKB/Swiss-Prot
EF-hand UniProtKB/Swiss-Prot
InterPro C2_dom UniProtKB/Swiss-Prot
C2_domain_sf UniProtKB/Swiss-Prot
EF-hand-dom_pair UniProtKB/Swiss-Prot
PI-PLC_fam UniProtKB/Swiss-Prot
PLC-beta UniProtKB/Swiss-Prot
PLC-beta_C UniProtKB/Swiss-Prot
PLC-beta_C_sf UniProtKB/Swiss-Prot
PLC-beta_PH UniProtKB/Swiss-Prot
PLC-like_Pdiesterase_TIM-brl UniProtKB/Swiss-Prot
PLCB1-4-like_EFh UniProtKB/Swiss-Prot
PLipase_C_PInositol-sp_X_dom UniProtKB/Swiss-Prot
PLipase_C_Pinositol-sp_Y UniProtKB/Swiss-Prot
KEGG Report rno:25031 UniProtKB/Swiss-Prot
NCBI Gene 25031 ENTREZGENE
PANTHER 1-PHOSPHATIDYLINOSITOL 4,5-BISPHOSPHATE PHOSPHODIESTERASE BETA-4 UniProtKB/Swiss-Prot
PTHR10336 UniProtKB/Swiss-Prot
Pfam PF00168 UniProtKB/Swiss-Prot
PH_14 UniProtKB/Swiss-Prot
PI-PLC-X UniProtKB/Swiss-Prot
PI-PLC-Y UniProtKB/Swiss-Prot
PLC-beta_C UniProtKB/Swiss-Prot
PLCB1-4-like_EFh UniProtKB/Swiss-Prot
PhenoGen Plcb4 PhenoGen
PIRSF PLC-beta UniProtKB/Swiss-Prot
PRINTS PHPHLIPASEC UniProtKB/Swiss-Prot
PROSITE PIPLC_X_DOMAIN UniProtKB/Swiss-Prot
PIPLC_Y_DOMAIN UniProtKB/Swiss-Prot
PS50004 UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000033119 RatGTEx
SMART PLCXc UniProtKB/Swiss-Prot
PLCYc UniProtKB/Swiss-Prot
SM00239 UniProtKB/Swiss-Prot
Superfamily-SCOP C-terminal domain of PLC-beta UniProtKB/Swiss-Prot
PH domain-like UniProtKB/Swiss-Prot
SSF47473 UniProtKB/Swiss-Prot
SSF49562 UniProtKB/Swiss-Prot
SSF51695 UniProtKB/Swiss-Prot
TIGR TC217862
UniProt A0A8I5Y961 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6A4W1_RAT UniProtKB/TrEMBL
A0A8I6AGH0_RAT UniProtKB/TrEMBL
A6HQJ1 ENTREZGENE, UniProtKB/TrEMBL
A6HQJ4 ENTREZGENE, UniProtKB/TrEMBL
D3ZCI6_RAT UniProtKB/TrEMBL
D4A8C5 ENTREZGENE, UniProtKB/TrEMBL
F1LNK2 ENTREZGENE, UniProtKB/TrEMBL
O88356 ENTREZGENE
PLCB4_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Q9Z0G6 ENTREZGENE
UniProt Secondary O88356 UniProtKB/Swiss-Prot
Q9Z0G6 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Plcb4
Phospholipase C , beta4
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_homology
has 50% amino acid identity with D. melanogastar norpA
633574
