Symbol:
Nes
Name:
nestin
RGD ID:
3162
Description:
Enables CCR5 chemokine receptor binding activity. Involved in several processes, including positive regulation of intermediate filament depolymerization; positive regulation of neural precursor cell proliferation; and response to ionizing radiation. Located in intermediate filament. Biomarker of acute kidney failure; brain infarction; brain ischemia; and nephrosis. Orthologous to human NES (nestin); INTERACTS WITH 1,3-dinitrobenzene; 15-deoxy-Delta(12,14)-prostaglandin J2; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC100910255; nestin-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NES (nestin) HGNC
Ensembl, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Nes (nestin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nes (nestin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NES (nestin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NES (nestin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nes (nestin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NES (nestin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NES (nestin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nes (nestin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Nes (nestin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NES (nestin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nes (nestin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
nes
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 175,735,715 - 175,745,631 (+) NCBI GRCr8 mRatBN7.2 2 173,437,867 - 173,447,777 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 173,438,734 - 173,447,777 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 180,583,526 - 180,592,569 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 178,605,885 - 178,614,928 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 173,205,949 - 173,214,992 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 187,343,109 - 187,352,972 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 187,344,056 - 187,352,969 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 206,746,885 - 206,755,989 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 180,051,907 - 180,060,947 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 180,002,012 - 180,011,053 (+) NCBI Celera 2 167,386,159 - 167,395,202 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nes Rat 1,3-dinitrobenzene affects expression EXP 6480464 3-dinitrobenzene affects the expression of NES mRNA CTD PMID:24140754 Nes Rat 15-deoxy-Delta(12,14)-prostaglandin J2 increases expression EXP 6480464 15-deoxy-delta(12 and 14)-prostaglandin J2 results in increased expression of NES protein CTD PMID:15212945 Nes Rat 17alpha-ethynylestradiol increases expression ISO Nes (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of NES mRNA CTD PMID:17942748 Nes Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of NES mRNA CTD PMID:29097150 Nes Rat 17alpha-ethynylestradiol multiple interactions ISO Nes (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NES mRNA CTD PMID:17942748 Nes Rat 17beta-estradiol increases expression ISO NES (Homo sapiens) 6480464 Estradiol results in increased expression of NES mRNA and Estradiol results in increased expression of NES protein CTD PMID:27271280 Nes Rat 17beta-estradiol multiple interactions ISO NES (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of NES mRNA CTD PMID:30165855 Nes Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO NES (Homo sapiens) 6480464 2 more ... CTD PMID:31326446 Nes Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Nes (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NES mRNA CTD PMID:17942748 and PMID:28922406 Nes Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NES mRNA CTD PMID:34747641 Nes Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Nes (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NES mRNA CTD PMID:17942748 Nes Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Nes Rat 2,6-dimethyl-4-tridecylmorpholine increases expression ISO Nes (Mus musculus) 6480464 tridemorph results in increased expression of NES mRNA CTD PMID:34737147 Nes Rat 2-butoxyethanol increases expression ISO Nes (Mus musculus) 6480464 n-butoxyethanol results in increased expression of NES mRNA CTD PMID:19812364 Nes Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO NES (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of NES mRNA CTD PMID:31326446 Nes Rat 3,5,6-trichloro-2-pyridinol affects expression ISO Nes (Mus musculus) 6480464 3 more ... CTD PMID:25137620 Nes Rat 3,5,6-trichloro-2-pyridinol increases expression ISO Nes (Mus musculus) 6480464 3 more ... CTD PMID:23220036 Nes Rat 3,5,6-trichloro-2-pyridinol decreases expression ISO Nes (Mus musculus) 6480464 3 more ... CTD PMID:23220036 Nes Rat 3,5,6-trichloropyridine-2-one decreases expression ISO Nes (Mus musculus) 6480464 3 more ... CTD PMID:23220036 Nes Rat 3,5,6-trichloropyridine-2-one affects expression ISO Nes (Mus musculus) 6480464 3 more ... CTD PMID:25137620 Nes Rat 3,5,6-trichloropyridine-2-one increases expression ISO Nes (Mus musculus) 6480464 3 more ... CTD PMID:23220036 Nes Rat 4,4'-diaminodiphenylmethane decreases expression ISO Nes (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of NES mRNA CTD PMID:18648102 Nes Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of NES mRNA CTD PMID:30723492 Nes Rat 4,4'-sulfonyldiphenol increases expression ISO Nes (Mus musculus) 6480464 bisphenol S results in increased expression of NES mRNA CTD PMID:30951980 Nes Rat 4-[3-(4-tert-butylphenyl)-2-methylpropyl]-2,6-dimethylmorpholine increases expression ISO Nes (Mus musculus) 6480464 fenpropimorph results in increased expression of NES mRNA CTD PMID:34737147 Nes Rat 4-hydroxyphenyl retinamide increases expression ISO Nes (Mus musculus) 6480464 Fenretinide results in increased expression of NES mRNA CTD PMID:28973697 Nes Rat 5-aza-2'-deoxycytidine decreases methylation ISO Nes (Mus musculus) 6480464 Decitabine results in decreased methylation of NES gene CTD PMID:19415779 Nes Rat 5-aza-2'-deoxycytidine increases expression ISO Nes (Mus musculus) 6480464 Decitabine results in increased expression of NES mRNA CTD PMID:19415779 Nes Rat 5-aza-2'-deoxycytidine increases acetylation ISO Nes (Mus musculus) 6480464 Decitabine results in increased acetylation of NES enhancer CTD PMID:19415779 Nes Rat 5-aza-2'-deoxycytidine affects expression ISO NES (Homo sapiens) 6480464 Decitabine affects the expression of NES mRNA CTD PMID:25922126 Nes Rat 5-fluorouracil decreases expression ISO Nes (Mus musculus) 6480464 Fluorouracil results in decreased expression of NES mRNA and Fluorouracil results in decreased expression of NES protein CTD PMID:21296659 and PMID:26272751 Nes Rat 7,12-dimethyltetraphene increases expression ISO Nes (Mus musculus) 6480464 9 more ... CTD PMID:38307155 Nes Rat 9-cis-retinoic acid decreases expression ISO NES (Homo sapiens) 6480464 Alitretinoin results in decreased expression of NES mRNA and Alitretinoin results in decreased expression of NES protein CTD PMID:36805303 Nes Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of NES mRNA CTD PMID:36328537 Nes Rat acrylamide decreases expression ISO NES (Homo sapiens) 6480464 Acrylamide results in decreased expression of NES mRNA CTD PMID:32763439 Nes Rat aflatoxin B1 increases expression ISO NES (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of NES mRNA CTD PMID:22100608 Nes Rat all-trans-retinoic acid increases expression ISO Nes (Mus musculus) 6480464 Tretinoin results in increased expression of NES mRNA and Tretinoin results in increased expression of NES protein CTD PMID:16806298 more ... Nes Rat all-trans-retinoic acid decreases expression ISO NES (Homo sapiens) 6480464 Tretinoin results in decreased expression of NES mRNA and Tretinoin results in decreased expression of NES protein CTD PMID:34519134 more ... Nes Rat all-trans-retinoic acid affects expression ISO NES (Homo sapiens) 6480464 Tretinoin affects the expression of NES mRNA CTD PMID:31600526 Nes Rat all-trans-retinoic acid decreases expression ISO Nes (Mus musculus) 6480464 Tretinoin results in decreased expression of NES mRNA CTD PMID:26272751 Nes Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of NES protein CTD PMID:16944780 Nes Rat all-trans-retinoic acid multiple interactions ISO NES (Homo sapiens) 6480464 [NTF3 protein co-treated with Tretinoin] results in increased expression of NES protein and anatoxin a promotes the reaction [Tretinoin results in decreased expression of NES mRNA] CTD PMID:16996685 and PMID:38070836 Nes Rat all-trans-retinoic acid increases expression ISO NES (Homo sapiens) 6480464 Tretinoin results in increased expression of NES mRNA CTD PMID:18599177 more ... Nes Rat aluminium atom multiple interactions EXP 6480464 [Aluminum Chloride results in increased abundance of Aluminum] which results in decreased expression of NES protein and Sildenafil Citrate inhibits the reaction [[Aluminum Chloride results in increased abundance of Aluminum] which results in decreased expression of NES protein] CTD PMID:32959702 Nes Rat aluminium(0) multiple interactions EXP 6480464 [Aluminum Chloride results in increased abundance of Aluminum] which results in decreased expression of NES protein and Sildenafil Citrate inhibits the reaction [[Aluminum Chloride results in increased abundance of Aluminum] which results in decreased expression of NES protein] CTD PMID:32959702 Nes Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NES mRNA CTD PMID:16483693 Nes Rat Anatoxin a multiple interactions ISO NES (Homo sapiens) 6480464 anatoxin a promotes the reaction [Tretinoin results in decreased expression of NES mRNA] CTD PMID:38070836 Nes Rat aristolochic acid A increases expression ISO NES (Homo sapiens) 6480464 aristolochic acid I results in increased expression of NES mRNA CTD PMID:33212167 Nes Rat arsane decreases expression ISO NES (Homo sapiens) 6480464 Arsenic results in decreased expression of NES mRNA CTD PMID:25922126 Nes Rat arsane increases methylation ISO NES (Homo sapiens) 6480464 Arsenic results in increased methylation of NES gene CTD PMID:25922126 Nes Rat arsenic atom decreases expression ISO NES (Homo sapiens) 6480464 Arsenic results in decreased expression of NES mRNA CTD PMID:25922126 Nes Rat arsenic atom increases methylation ISO NES (Homo sapiens) 6480464 Arsenic results in increased methylation of NES gene CTD PMID:25922126 Nes Rat arsenite(3-) multiple interactions ISO NES (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to NES protein] CTD PMID:32406909 Nes Rat arsenous acid increases expression ISO NES (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NES mRNA CTD PMID:22521957 Nes Rat benzo[a]pyrene increases expression ISO Nes (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NES mRNA CTD PMID:21569818 more ... Nes Rat benzo[a]pyrene increases expression ISO NES (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of NES mRNA CTD PMID:32234424 Nes Rat benzo[a]pyrene increases methylation ISO NES (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NES promoter CTD PMID:27901495 Nes Rat benzo[a]pyrene decreases methylation ISO NES (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of NES exon CTD PMID:27901495 Nes Rat benzo[b]fluoranthene increases expression ISO Nes (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of NES mRNA CTD PMID:26377693 Nes Rat benzylpenicillin affects expression ISO Nes (Mus musculus) 6480464 Penicillin G affects the expression of NES mRNA CTD PMID:25137620 Nes Rat benzylpenicillin increases expression EXP 6480464 Penicillin G results in increased expression of NES protein CTD PMID:16137769 and PMID:16369854 Nes Rat beta-amyrin decreases expression EXP 6480464 beta-amyrin results in decreased expression of NES mRNA CTD PMID:32081053 Nes Rat beta-amyrin multiple interactions EXP 6480464 beta-amyrin inhibits the reaction [Glycerol results in increased expression of NES mRNA] CTD PMID:32081053 Nes Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of NES mRNA CTD PMID:26316063 Nes Rat bisphenol A decreases expression ISO Nes (Mus musculus) 6480464 bisphenol A results in decreased expression of NES mRNA CTD PMID:24090592 and PMID:31574244 Nes Rat bisphenol A increases expression ISO Nes (Mus musculus) 6480464 bisphenol A results in increased expression of NES mRNA CTD PMID:30951980 Nes Rat bisphenol A multiple interactions ISO NES (Homo sapiens) 6480464 [bisphenol A co-treated with decabromobiphenyl ether] results in decreased expression of NES protein more ... CTD PMID:27271280 more ... Nes Rat bisphenol A decreases expression ISO NES (Homo sapiens) 6480464 bisphenol A results in decreased expression of NES mRNA and bisphenol A results in decreased expression of NES protein CTD PMID:27271280 more ... Nes Rat bisphenol A increases expression ISO NES (Homo sapiens) 6480464 bisphenol A results in increased expression of NES mRNA and bisphenol A results in increased expression of NES protein CTD PMID:27685785 more ... Nes Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NES mRNA and bisphenol A results in decreased expression of NES protein CTD PMID:25381574 more ... Nes Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NES mRNA CTD PMID:25181051 and PMID:25381574 Nes Rat bisphenol A multiple interactions EXP 6480464 Curcumin inhibits the reaction [bisphenol A results in decreased expression of NES mRNA] CTD PMID:25963729 Nes Rat bisphenol AF increases expression ISO NES (Homo sapiens) 6480464 bisphenol AF results in increased expression of NES protein CTD PMID:34186270 Nes Rat Bisphenol B increases expression ISO NES (Homo sapiens) 6480464 bisphenol B results in increased expression of NES protein CTD PMID:34186270 Nes Rat bisphenol F increases expression ISO Nes (Mus musculus) 6480464 bisphenol F results in increased expression of NES mRNA CTD PMID:30951980 Nes Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of NES mRNA CTD PMID:12628495 Nes Rat butanal increases expression ISO NES (Homo sapiens) 6480464 butyraldehyde results in increased expression of NES mRNA CTD PMID:26079696 Nes Rat cadmium atom decreases expression ISO NES (Homo sapiens) 6480464 Cadmium results in decreased expression of NES mRNA CTD PMID:25922126 Nes Rat cadmium atom multiple interactions ISO Nes (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NES mRNA CTD PMID:37325564 Nes Rat cadmium atom increases methylation ISO NES (Homo sapiens) 6480464 Cadmium results in increased methylation of NES gene CTD PMID:25922126 Nes Rat cadmium dichloride increases expression ISO NES (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of NES mRNA CTD PMID:38568856 Nes Rat cadmium dichloride multiple interactions ISO Nes (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NES mRNA CTD PMID:37325564 Nes Rat caffeine affects phosphorylation ISO NES (Homo sapiens) 6480464 Caffeine affects the phosphorylation of NES protein CTD PMID:35688186 Nes Rat cannabidiol multiple interactions ISO NES (Homo sapiens) 6480464 [Cannabidiol co-treated with moringin] results in increased expression of NES protein CTD PMID:30096889 Nes Rat cannabidiol increases expression ISO NES (Homo sapiens) 6480464 Cannabidiol results in increased expression of NES mRNA CTD PMID:27918106 Nes Rat carbofuran decreases expression EXP 6480464 Carbofuran results in decreased expression of NES mRNA CTD PMID:22240977 and PMID:28982980 Nes Rat carbon nanotube decreases expression ISO Nes (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of NES mRNA CTD PMID:25554681 Nes Rat carbonyl sulfide increases expression EXP 6480464 carbonyl sulfide results in increased expression of NES mRNA CTD PMID:19395590 Nes Rat carmustine increases expression EXP 6480464 Carmustine results in increased expression of NES protein CTD PMID:17572393 Nes Rat carmustine multiple interactions EXP 6480464 Melatonin inhibits the reaction [Carmustine results in increased expression of NES protein] CTD PMID:17572393 Nes Rat CHIR 99021 multiple interactions ISO Nes (Mus musculus) 6480464 [2-(2-chloro-4-iodophenylamino)-N-cyclopropylmethoxy-3 and 4-difluorobenzamide co-treated with SU 5402 co-treated with Chir 99021] results in decreased expression of NES mRNA CTD PMID:20865013 Nes Rat chlorpyrifos decreases expression ISO Nes (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of NES mRNA CTD PMID:25137620 Nes Rat chlorpyrifos increases expression ISO Nes (Mus musculus) 6480464 Chlorpyrifos results in increased expression of NES mRNA CTD PMID:23220036 more ... Nes Rat choline multiple interactions ISO Nes (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NES gene CTD PMID:20938992 Nes Rat cisplatin multiple interactions ISO NES (Homo sapiens) 6480464 [Cisplatin co-treated with Paclitaxel] results in increased expression of NES mRNA more ... CTD PMID:20705681 and PMID:21342274 Nes Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of NES mRNA CTD PMID:22023808 Nes Rat clozapine decreases expression ISO NES (Homo sapiens) 6480464 Clozapine results in decreased expression of NES protein CTD PMID:34122009 Nes Rat cobalt dichloride decreases expression ISO Nes (Mus musculus) 6480464 cobaltous chloride results in decreased expression of NES mRNA and cobaltous chloride results in decreased expression of NES protein CTD PMID:16772336 Nes Rat cobalt dichloride decreases expression ISO NES (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of NES mRNA CTD PMID:19320972 Nes Rat colforsin daropate hydrochloride decreases expression ISO NES (Homo sapiens) 6480464 Colforsin results in decreased expression of NES protein CTD PMID:34897981 Nes Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of NES mRNA and Copper results in increased expression of NES mRNA CTD PMID:26033743 and PMID:30556269 Nes Rat copper atom multiple interactions ISO NES (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of NES mRNA CTD PMID:20971185 Nes Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of NES mRNA and Copper results in increased expression of NES mRNA CTD PMID:26033743 and PMID:30556269 Nes Rat copper(0) multiple interactions ISO NES (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of NES mRNA CTD PMID:20971185 Nes Rat copper(II) sulfate increases expression ISO NES (Homo sapiens) 6480464 Copper Sulfate results in increased expression of NES mRNA CTD PMID:19549813 Nes Rat coumarin increases phosphorylation ISO NES (Homo sapiens) 6480464 coumarin results in increased phosphorylation of NES protein CTD PMID:35688186 Nes Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of NES mRNA CTD PMID:27523638 Nes Rat curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [bisphenol A results in decreased expression of NES mRNA] and Curcumin inhibits the reaction [Gentamicins results in increased expression of NES mRNA] CTD PMID:25963729 and PMID:38056816 Nes Rat curcumin increases expression EXP 6480464 Curcumin results in increased expression of NES mRNA CTD PMID:25963729 Nes Rat cyclosporin A increases expression ISO NES (Homo sapiens) 6480464 Cyclosporine results in increased expression of NES mRNA CTD PMID:25562108 Nes Rat cytarabine increases expression ISO NES (Homo sapiens) 6480464 Cytarabine results in increased expression of NES mRNA CTD PMID:21198554 Nes Rat cytarabine decreases expression ISO NES (Homo sapiens) 6480464 Cytarabine results in decreased expression of NES protein CTD PMID:21198554 Nes Rat decabromodiphenyl ether increases expression ISO NES (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of NES mRNA CTD PMID:31326446 Nes Rat decabromodiphenyl ether decreases expression ISO NES (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of NES protein CTD PMID:28597690 Nes Rat decabromodiphenyl ether multiple interactions ISO NES (Homo sapiens) 6480464 [bisphenol A co-treated with decabromobiphenyl ether] results in decreased expression of NES protein CTD PMID:28597690 Nes Rat desferrioxamine B decreases expression ISO Nes (Mus musculus) 6480464 Deferoxamine results in decreased expression of NES mRNA CTD PMID:16772336 Nes Rat desipramine increases expression EXP 6480464 Desipramine results in increased expression of NES mRNA CTD PMID:17510525 Nes Rat dexamethasone decreases expression ISO NES (Homo sapiens) 6480464 Dexamethasone results in decreased expression of NES protein CTD PMID:22048647 Nes Rat dexamethasone increases expression ISO NES (Homo sapiens) 6480464 Dexamethasone results in increased expression of NES mRNA CTD PMID:34742744 Nes Rat diarsenic trioxide increases expression ISO NES (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NES mRNA CTD PMID:22521957 Nes Rat dibenz[a,h]anthracene increases expression ISO Nes (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Nes Rat dibutyl phthalate increases expression ISO Nes (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of NES mRNA CTD PMID:21266533 Nes Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of NES mRNA CTD PMID:21266533 Nes Rat dicrotophos increases expression ISO NES (Homo sapiens) 6480464 dicrotophos results in increased expression of NES mRNA CTD PMID:28302478 Nes Rat dimethyl sulfoxide decreases expression ISO NES (Homo sapiens) 6480464 Dimethyl Sulfoxide results in decreased expression of NES mRNA CTD PMID:22105179 Nes Rat dioxygen decreases expression ISO NES (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of NES mRNA CTD PMID:26516004 Nes Rat disodium selenite multiple interactions ISO Nes (Mus musculus) 6480464 Sodium Selenite inhibits the reaction [Hydrogen Peroxide results in decreased expression of NES mRNA] CTD PMID:17997286 Nes Rat diuron increases expression EXP 6480464 Diuron results in increased expression of NES mRNA CTD PMID:21551480 Nes Rat dorsomorphin multiple interactions ISO NES (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nes Rat doxorubicin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Doxorubicin results in increased expression of NES protein] CTD PMID:29474904 Nes Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of NES protein CTD PMID:29474904 Nes Rat eckol decreases expression ISO NES (Homo sapiens) 6480464 eckol results in decreased expression of NES protein CTD PMID:21514314 Nes Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of NES mRNA CTD PMID:29391264 Nes Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of NES mRNA and Ethanol results in increased expression of NES protein CTD PMID:29769550 Nes Rat ethanol increases expression ISO Nes (Mus musculus) 6480464 Ethanol results in increased expression of NES mRNA CTD PMID:30319688 Nes Rat ethosuximide increases expression EXP 6480464 Ethosuximide results in increased expression of NES mRNA CTD PMID:26420483 Nes Rat ethosuximide multiple interactions EXP 6480464 Ethosuximide inhibits the reaction [APP protein modified form results in decreased expression of NES mRNA] CTD PMID:26420483 Nes Rat fenamidone increases expression ISO Nes (Mus musculus) 6480464 fenamidone results in increased expression of NES mRNA CTD PMID:27029645 Nes Rat fenpropidin increases expression ISO Nes (Mus musculus) 6480464 fenpropidine results in increased expression of NES mRNA CTD PMID:34737147 Nes Rat flusilazole increases expression ISO Nes (Mus musculus) 6480464 flusilazole results in increased expression of NES mRNA CTD PMID:34537371 and PMID:34737147 Nes Rat folic acid multiple interactions ISO Nes (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NES gene CTD PMID:20938992 Nes Rat FR900359 affects phosphorylation ISO NES (Homo sapiens) 6480464 FR900359 affects the phosphorylation of NES protein CTD PMID:37730182 Nes Rat fulvestrant multiple interactions ISO NES (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NES gene CTD PMID:31601247 Nes Rat furan decreases expression EXP 6480464 furan results in decreased expression of NES mRNA CTD PMID:25539665 Nes Rat furan increases expression EXP 6480464 furan results in increased expression of NES mRNA CTD PMID:27387713 Nes Rat gefitinib multiple interactions EXP 6480464 Gefitinib inhibits the reaction [astragaloside VI results in increased expression of NES protein] CTD PMID:30088176 Nes Rat geldanamycin increases expression ISO NES (Homo sapiens) 6480464 geldanamycin results in increased expression of NES mRNA CTD PMID:26705709 Nes Rat gentamycin multiple interactions EXP 6480464 Curcumin inhibits the reaction [Gentamicins results in increased expression of NES mRNA] CTD PMID:38056816 Nes Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NES mRNA CTD PMID:38056816 Nes Rat glycerol multiple interactions EXP 6480464 beta-amyrin inhibits the reaction [Glycerol results in increased expression of NES mRNA] CTD PMID:32081053 Nes Rat glycerol increases expression EXP 6480464 Glycerol results in increased expression of NES mRNA CTD PMID:32081053 Nes Rat glyphosate increases expression ISO NES (Homo sapiens) 6480464 Glyphosate results in increased expression of NES mRNA and Glyphosate results in increased expression of NES protein CTD PMID:35485992 Nes Rat hydrogen peroxide decreases expression ISO Nes (Mus musculus) 6480464 Hydrogen Peroxide results in decreased expression of NES mRNA CTD PMID:17997286 Nes Rat hydrogen peroxide multiple interactions ISO Nes (Mus musculus) 6480464 [Hydrogen Peroxide co-treated with N-(oxo-5 more ... CTD PMID:17997286 and PMID:31494107 Nes Rat imidacloprid decreases expression EXP 6480464 imidacloprid results in decreased expression of NES mRNA CTD PMID:39002876 Nes Rat isoprenaline decreases expression ISO Nes (Mus musculus) 6480464 Isoproterenol results in decreased expression of NES mRNA CTD PMID:20003209 Nes Rat ivermectin decreases expression ISO NES (Homo sapiens) 6480464 Ivermectin results in decreased expression of NES protein CTD PMID:32959892 Nes Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of NES mRNA CTD PMID:20080153 Nes Rat L-ascorbic acid decreases expression EXP 6480464 Ascorbic Acid results in decreased expression of NES protein CTD PMID:15372504 Nes Rat L-methionine multiple interactions ISO Nes (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NES gene CTD PMID:20938992 Nes Rat lead diacetate increases expression ISO Nes (Mus musculus) 6480464 lead acetate results in increased expression of NES mRNA CTD PMID:24260418 and PMID:25496477 Nes Rat lead(0) affects expression ISO NES (Homo sapiens) 6480464 Lead affects the expression of NES mRNA CTD PMID:28903495 Nes Rat lead(0) decreases expression ISO NES (Homo sapiens) 6480464 Lead results in decreased expression of NES protein CTD PMID:37467947 Nes Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of NES mRNA CTD PMID:35283115 Nes Rat lipopolysaccharide multiple interactions ISO NES (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Nes Rat lithium chloride increases expression ISO Nes (Mus musculus) 6480464 Lithium Chloride results in increased expression of NES mRNA CTD PMID:26272751 Nes Rat lupeol decreases expression ISO Nes (Mus musculus) 6480464 lupeol results in decreased expression of NES protein CTD PMID:20979057 Nes Rat LY294002 decreases expression ISO Nes (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased expression of NES protein CTD PMID:29129800 Nes Rat melatonin decreases expression ISO NES (Homo sapiens) 6480464 Melatonin results in decreased expression of NES protein CTD PMID:21269327 Nes Rat melatonin decreases expression EXP 6480464 Melatonin results in decreased expression of NES protein CTD PMID:16369854 Nes Rat melatonin multiple interactions EXP 6480464 Melatonin inhibits the reaction [Carmustine results in increased expression of NES protein] CTD PMID:17572393 Nes Rat methylmercury chloride affects expression EXP 6480464 methylmercuric chloride affects the expression of NES mRNA CTD PMID:20864626 Nes Rat methylmercury chloride increases expression ISO NES (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of NES mRNA CTD PMID:28001369 Nes Rat methylmercury chloride increases expression ISO Nes (Mus musculus) 6480464 methylmercuric chloride results in increased expression of NES mRNA CTD PMID:22555245 Nes Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of NES mRNA CTD PMID:19651682 Nes Rat monocrotophos increases expression ISO NES (Homo sapiens) 6480464 Monocrotophos results in increased expression of NES protein CTD PMID:33569802 Nes Rat monocrotophos decreases expression ISO NES (Homo sapiens) 6480464 Monocrotophos results in decreased expression of NES mRNA CTD PMID:33569802 Nes Rat morphine decreases expression ISO Nes (Mus musculus) 6480464 Morphine results in decreased expression of NES mRNA CTD PMID:26877219 Nes Rat N-methyl-4-phenylpyridinium increases expression ISO Nes (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of NES protein CTD PMID:26558463 Nes Rat N-methyl-N-nitrosourea increases expression EXP 6480464 Methylnitrosourea results in increased expression of NES protein CTD PMID:18155124 Nes Rat N-methyl-N-nitrosourea increases methylation ISO NES (Homo sapiens) 6480464 Methylnitrosourea results in increased methylation of NES gene CTD PMID:25922126 Nes Rat O-methyleugenol increases expression ISO NES (Homo sapiens) 6480464 methyleugenol results in increased expression of NES mRNA CTD PMID:32234424 Nes Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of NES mRNA CTD PMID:21703336 Nes Rat ochratoxin A multiple interactions EXP 6480464 SHH protein modified form inhibits the reaction [ochratoxin A results in decreased expression of NES mRNA] CTD PMID:21703336 Nes Rat oxybenzone decreases expression ISO Nes (Mus musculus) 6480464 oxybenzone results in decreased expression of NES protein CTD PMID:39343157 Nes Rat paclitaxel multiple interactions ISO NES (Homo sapiens) 6480464 [Cisplatin co-treated with Paclitaxel] results in increased expression of NES mRNA CTD PMID:20705681 Nes Rat paracetamol affects expression ISO Nes (Mus musculus) 6480464 Acetaminophen affects the expression of NES mRNA CTD PMID:17562736 Nes Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of NES mRNA CTD PMID:33387578 Nes Rat paraoxon increases expression ISO Nes (Mus musculus) 6480464 Paraoxon results in increased expression of NES mRNA CTD PMID:27117976 Nes Rat paraquat decreases expression ISO NES (Homo sapiens) 6480464 Paraquat results in decreased expression of NES mRNA CTD PMID:25314302 Nes Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of NES mRNA CTD PMID:32680482 Nes Rat perfluorooctane-1-sulfonic acid decreases expression ISO Nes (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of NES mRNA CTD PMID:25510869 Nes Rat phenytoin decreases expression ISO Nes (Mus musculus) 6480464 Phenytoin results in decreased expression of NES mRNA CTD PMID:26272751 Nes Rat progesterone decreases expression ISO NES (Homo sapiens) 6480464 Progesterone results in decreased expression of NES mRNA CTD PMID:21795739 Nes Rat progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of NES mRNA CTD PMID:20726854 Nes Rat quercetin affects expression EXP 6480464 Quercetin affects the expression of NES mRNA CTD PMID:18178720 Nes Rat quercetin decreases expression ISO NES (Homo sapiens) 6480464 Quercetin results in decreased expression of NES protein CTD PMID:22422628 Nes Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Doxorubicin results in increased expression of NES protein] CTD PMID:29474904 Nes Rat resveratrol decreases expression ISO NES (Homo sapiens) 6480464 resveratrol results in decreased expression of NES mRNA and resveratrol results in decreased expression of NES protein CTD PMID:18089832 more ... Nes Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of NES protein CTD PMID:24464877 Nes Rat rimonabant multiple interactions ISO Nes (Mus musculus) 6480464 [Rimonabant co-treated with Dronabinol] results in increased expression of NES mRNA CTD PMID:36529297 Nes Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO NES (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Nes Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO NES (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of NES mRNA CTD PMID:35811015 Nes Rat saccharin increases expression ISO Nes (Mus musculus) 6480464 Saccharin results in increased expression of NES mRNA CTD PMID:26272751 Nes Rat SB 431542 decreases expression ISO NES (Homo sapiens) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in decreased expression of NES mRNA CTD PMID:25670856 Nes Rat SB 431542 multiple interactions ISO NES (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Nes Rat sildenafil citrate multiple interactions EXP 6480464 Sildenafil Citrate inhibits the reaction [[Aluminum Chloride results in increased abundance of Aluminum] which results in decreased expression of NES protein] CTD PMID:32959702 Nes Rat silver atom increases expression ISO Nes (Mus musculus) 6480464 Silver results in increased expression of NES mRNA CTD PMID:27131904 Nes Rat silver(0) increases expression ISO Nes (Mus musculus) 6480464 Silver results in increased expression of NES mRNA CTD PMID:27131904 Nes Rat sodium arsenite affects methylation ISO NES (Homo sapiens) 6480464 sodium arsenite affects the methylation of NES gene CTD PMID:28589171 Nes Rat sodium arsenite increases expression ISO NES (Homo sapiens) 6480464 sodium arsenite results in increased expression of NES mRNA CTD PMID:34032870 and PMID:38568856 Nes Rat sodium arsenite increases expression ISO Nes (Mus musculus) 6480464 sodium arsenite results in increased expression of NES mRNA CTD PMID:28370166 Nes Rat sodium arsenite decreases expression ISO NES (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NES mRNA and sodium arsenite results in decreased expression of NES protein CTD PMID:19615344 and PMID:23219847 Nes Rat sodium arsenite multiple interactions ISO NES (Homo sapiens) 6480464 monoisoamyl-2 and 3-dimercaptosuccinate inhibits the reaction [sodium arsenite results in decreased expression of NES mRNA] CTD PMID:19615344 Nes Rat Soman increases expression EXP 6480464 Soman results in increased expression of NES mRNA CTD PMID:19281266 Nes Rat sotorasib multiple interactions ISO NES (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of NES mRNA CTD PMID:36139627 Nes Rat streptozocin multiple interactions ISO NES (Homo sapiens) 6480464 INS protein inhibits the reaction [Streptozocin results in decreased expression of NES mRNA] CTD PMID:19388005 Nes Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of NES mRNA and Streptozocin results in decreased expression of NES protein CTD PMID:19388005 Nes Rat sulforaphane decreases expression ISO NES (Homo sapiens) 6480464 sulforaphane results in decreased expression of NES mRNA CTD PMID:31838189 Nes Rat sunitinib decreases expression ISO NES (Homo sapiens) 6480464 Sunitinib results in decreased expression of NES mRNA CTD PMID:31533062 Nes Rat Tanshinone I decreases expression ISO NES (Homo sapiens) 6480464 tanshinone results in decreased expression of NES mRNA and tanshinone results in decreased expression of NES protein CTD PMID:16955220 Nes Rat temozolomide increases expression ISO NES (Homo sapiens) 6480464 Temozolomide results in increased expression of NES mRNA CTD PMID:31758290 Nes Rat tert-butyl hydroperoxide increases expression ISO Nes (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of NES mRNA CTD PMID:15003993 Nes Rat testosterone enanthate affects expression ISO NES (Homo sapiens) 6480464 testosterone enanthate affects the expression of NES mRNA CTD PMID:17440010 Nes Rat thapsigargin decreases expression ISO NES (Homo sapiens) 6480464 Thapsigargin results in decreased expression of NES mRNA CTD PMID:22378314 Nes Rat thimerosal decreases expression ISO NES (Homo sapiens) 6480464 Thimerosal results in decreased expression of NES mRNA CTD PMID:27188386 Nes Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NES mRNA CTD PMID:34492290 Nes Rat thymoquinone decreases expression ISO NES (Homo sapiens) 6480464 thymoquinone results in decreased expression of NES protein CTD PMID:31298468 Nes Rat titanium dioxide decreases methylation ISO Nes (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NES promoter CTD PMID:35295148 Nes Rat trametinib multiple interactions ISO NES (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of NES mRNA CTD PMID:36139627 Nes Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of NES mRNA CTD PMID:33387578 Nes Rat trichostatin A decreases methylation ISO Nes (Mus musculus) 6480464 trichostatin A results in decreased methylation of NES gene CTD PMID:19415779 Nes Rat trichostatin A multiple interactions ISO NES (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NES mRNA CTD PMID:27188386 Nes Rat trichostatin A decreases expression ISO NES (Homo sapiens) 6480464 trichostatin A results in decreased expression of NES mRNA CTD PMID:24935251 and PMID:26272509 Nes Rat trichostatin A increases expression ISO Nes (Mus musculus) 6480464 trichostatin A results in increased expression of NES mRNA CTD PMID:19415779 Nes Rat trichostatin A increases acetylation ISO Nes (Mus musculus) 6480464 trichostatin A results in increased acetylation of NES enhancer CTD PMID:19415779 Nes Rat triclosan decreases expression ISO NES (Homo sapiens) 6480464 Triclosan results in decreased expression of NES mRNA CTD PMID:30510588 Nes Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of NES mRNA CTD PMID:33078273 Nes Rat triphenyl phosphate decreases expression ISO Nes (Mus musculus) 6480464 triphenyl phosphate results in decreased expression of NES mRNA CTD PMID:35752650 Nes Rat trovafloxacin decreases expression ISO Nes (Mus musculus) 6480464 trovafloxacin results in decreased expression of NES mRNA CTD PMID:35537566 Nes Rat tunicamycin decreases expression ISO NES (Homo sapiens) 6480464 Tunicamycin results in decreased expression of NES mRNA CTD PMID:22378314 Nes Rat urethane decreases expression ISO NES (Homo sapiens) 6480464 Urethane results in decreased expression of NES mRNA CTD PMID:28818685 Nes Rat valproic acid increases expression ISO Nes (Mus musculus) 6480464 Valproic Acid results in increased expression of NES mRNA CTD PMID:25137620 Nes Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of NES mRNA CTD PMID:19651682 and PMID:23562654 Nes Rat valproic acid increases methylation ISO NES (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NES gene CTD PMID:29154799 Nes Rat valproic acid decreases expression ISO NES (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NES mRNA CTD PMID:23527032 Nes Rat valproic acid increases expression ISO NES (Homo sapiens) 6480464 Valproic Acid results in increased expression of NES mRNA CTD PMID:23179753 Nes Rat valproic acid affects expression ISO NES (Homo sapiens) 6480464 Valproic Acid affects the expression of NES mRNA CTD PMID:25979313 Nes Rat valproic acid decreases expression ISO Nes (Mus musculus) 6480464 Valproic Acid results in decreased expression of NES mRNA CTD PMID:26272751 Nes Rat vorinostat multiple interactions ISO NES (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NES mRNA CTD PMID:27188386 Nes Rat vorinostat decreases expression ISO NES (Homo sapiens) 6480464 vorinostat results in decreased expression of NES mRNA CTD PMID:26272509 and PMID:27188386
1,3-dinitrobenzene (EXP) 15-deoxy-Delta(12,14)-prostaglandin J2 (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,6-dimethyl-4-tridecylmorpholine (ISO) 2-butoxyethanol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,5,6-trichloro-2-pyridinol (ISO) 3,5,6-trichloropyridine-2-one (ISO) 4,4'-diaminodiphenylmethane (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-[3-(4-tert-butylphenyl)-2-methylpropyl]-2,6-dimethylmorpholine (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 7,12-dimethyltetraphene (ISO) 9-cis-retinoic acid (ISO) acrylamide (EXP,ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) aluminium atom (EXP) aluminium(0) (EXP) ammonium chloride (EXP) Anatoxin a (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzylpenicillin (EXP,ISO) beta-amyrin (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bromobenzene (EXP) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) cannabidiol (ISO) carbofuran (EXP) carbon nanotube (ISO) carbonyl sulfide (EXP) carmustine (EXP) CHIR 99021 (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (EXP,ISO) clozapine (ISO) cobalt dichloride (ISO) colforsin daropate hydrochloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) coumarin (ISO) Cuprizon (EXP) curcumin (EXP) cyclosporin A (ISO) cytarabine (ISO) decabromodiphenyl ether (ISO) desferrioxamine B (ISO) desipramine (EXP) dexamethasone (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) dimethyl sulfoxide (ISO) dioxygen (ISO) disodium selenite (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (EXP) eckol (ISO) endosulfan (EXP) ethanol (EXP,ISO) ethosuximide (EXP) fenamidone (ISO) fenpropidin (ISO) flusilazole (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) furan (EXP) gefitinib (EXP) geldanamycin (ISO) gentamycin (EXP) glycerol (EXP) glyphosate (ISO) hydrogen peroxide (ISO) imidacloprid (EXP) isoprenaline (ISO) ivermectin (ISO) ketamine (EXP) L-ascorbic acid (EXP) L-methionine (ISO) lead diacetate (ISO) lead(0) (ISO) lidocaine (EXP) lipopolysaccharide (ISO) lithium chloride (ISO) lupeol (ISO) LY294002 (ISO) melatonin (EXP,ISO) methylmercury chloride (EXP,ISO) monocrotophos (ISO) morphine (ISO) N-methyl-4-phenylpyridinium (ISO) N-methyl-N-nitrosourea (EXP,ISO) O-methyleugenol (ISO) ochratoxin A (EXP) oxybenzone (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) paraoxon (ISO) paraquat (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenytoin (ISO) progesterone (EXP,ISO) quercetin (EXP,ISO) resveratrol (EXP,ISO) rimonabant (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) saccharin (ISO) SB 431542 (ISO) sildenafil citrate (EXP) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) Soman (EXP) sotorasib (ISO) streptozocin (EXP,ISO) sulforaphane (ISO) sunitinib (ISO) Tanshinone I (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone enanthate (ISO) thapsigargin (ISO) thimerosal (ISO) thioacetamide (EXP) thymoquinone (ISO) titanium dioxide (ISO) trametinib (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (EXP,ISO) trovafloxacin (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (EXP,ISO) vorinostat (ISO)
1.
Altered gene expression in leukocyte transendothelial migration and cell communication pathways in periodontitis-affected gingival tissues.
Abe D, etal., J Periodontal Res. 2011 Jun;46(3):345-53. doi: 10.1111/j.1600-0765.2011.01349.x. Epub 2011 Mar 7.
2.
Altered pancreatic morphology in the offspring of pregnant rats given reduced dietary protein is time and gender specific.
Chamson-Reig A, etal., J Endocrinol. 2006 Oct;191(1):83-92.
3.
Nestin promotes the phosphorylation-dependent disassembly of vimentin intermediate filaments during mitosis.
Chou YH, etal., Mol Biol Cell 2003 Apr;14(4):1468-78.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
[EphB2-Fc promotes activation of endogenous neural stem cells after cerebral cortex infarction: experimental with hypertensive rats]
He YD, etal., Zhonghua Yi Xue Za Zhi. 2005 Sep 7;85(34):2395-9.
7.
Desipramine activated Bcl-2 expression and inhibited lipopolysaccharide-induced apoptosis in hippocampus-derived adult neural stem cells.
Huang YY, etal., J Pharmacol Sci. 2007 May;104(1):61-72.
8.
Nestin immunoreactivity in local neurons of the adult rat striatum after remote cortical injury.
Kuroda T, etal., J Chem Neuroanat 2002 Jul;24(2):137-46.
9.
CNS stem cells express a new class of intermediate filament protein.
Lendahl U, etal., Cell 1990 Feb 23;60(4):585-95.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
Chemokines released from astrocytes promote chemokine receptor 5-mediated neuronal cell differentiation.
Park MH, etal., Exp Cell Res. 2009 Oct 1;315(16):2715-26. Epub 2009 Jun 24.
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Comprehensive gene review and curation
RGD comprehensive gene curation
16.
Cdk5 regulates the organization of Nestin and its association with p35.
Sahlgren CM, etal., Mol Cell Biol 2003 Jul;23(14):5090-106.
17.
Nestin expression persists in astrocytes of organotypic slice cultures from rat cortex.
Schmidt-Kastner R and Humpel C, Int J Dev Neurosci 2002 Feb;20(1):29-38.
18.
Enhancement of nestin protein-immunoreactivity induced by ionizing radiation in the forebrain ependymal regions of rats.
Shi M, etal., Neurosci Res. 2002 Dec;44(4):475-81.
19.
[Neuroprotective effects of exogenous basic fibroblast growth factor on the hypoxic-ischemic brain damage of neonatal rats]
Sun JQ, etal., Zhonghua Er Ke Za Zhi. 2007 May;45(5):354-9.
20.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
21.
Nestin is essential for mitogen-stimulated proliferation of neural progenitor cells.
Xue XJ and Yuan XB, Mol Cell Neurosci. 2010 Sep;45(1):26-36. doi: 10.1016/j.mcn.2010.05.006. Epub 2010 May 25.
22.
Identification of nestin as a urinary biomarker for acute kidney injury.
Zhang W, etal., Am J Nephrol. 2014;39(2):110-21. doi: 10.1159/000358260. Epub 2014 Feb 6.
23.
[Effect of electroacupuncture on expression of nestin protein after focal ischemia/reperfusion in rats]
Zhao ZQ and Luo Y, Zhongguo Zhong Xi Yi Jie He Za Zhi. 2006 Jun;26 Suppl:20-4.
24.
Time course of expression of intermediate filament protein vimentin, nestin and desmin in rat renal glomerular injury.
Zou J, etal., Chin Med J (Engl). 2007 Jul 5;120(13):1203-5.
Nes Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 175,735,715 - 175,745,631 (+) NCBI GRCr8 mRatBN7.2 2 173,437,867 - 173,447,777 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 173,438,734 - 173,447,777 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 180,583,526 - 180,592,569 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 178,605,885 - 178,614,928 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 173,205,949 - 173,214,992 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 187,343,109 - 187,352,972 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 187,344,056 - 187,352,969 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 206,746,885 - 206,755,989 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 180,051,907 - 180,060,947 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 180,002,012 - 180,011,053 (+) NCBI Celera 2 167,386,159 - 167,395,202 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
NES Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 156,668,763 - 156,677,407 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 156,668,763 - 156,677,407 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 156,638,555 - 156,647,199 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 154,905,179 - 154,913,813 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 153,451,630 - 153,460,262 NCBI Celera 1 129,709,369 - 129,718,003 (-) NCBI Celera Cytogenetic Map 1 q23.1 NCBI HuRef 1 127,996,154 - 128,004,788 (-) NCBI HuRef CHM1_1 1 158,034,765 - 158,043,399 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 155,805,165 - 155,813,809 (-) NCBI T2T-CHM13v2.0
Nes Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 87,878,400 - 87,887,758 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 87,878,385 - 87,887,758 (+) Ensembl GRCm39 Ensembl GRCm38 3 87,971,093 - 87,980,451 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 87,971,078 - 87,980,451 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 87,775,015 - 87,784,373 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 88,057,020 - 88,066,378 (+) NCBI MGSCv36 mm8 Celera 3 88,008,485 - 88,017,845 (+) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 38.78 NCBI
Nes Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955545 2,748,078 - 2,756,301 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955545 2,748,132 - 2,756,595 (-) NCBI ChiLan1.0 ChiLan1.0
NES Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 93,167,229 - 93,175,869 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 92,901,730 - 92,910,368 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 132,012,273 - 132,020,907 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 135,835,456 - 135,844,094 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 135,835,456 - 135,844,094 (-) Ensembl panpan1.1 panPan2
NES Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 41,296,395 - 41,305,641 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 41,295,989 - 41,303,736 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 40,783,666 - 40,792,924 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 41,159,499 - 41,168,749 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 41,160,198 - 41,168,746 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 40,941,448 - 40,950,698 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 40,994,447 - 41,003,699 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 41,278,086 - 41,287,336 (+) NCBI UU_Cfam_GSD_1.0
Nes Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 26,807,567 - 26,817,174 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936580 5,837,936 - 5,847,020 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936580 5,837,949 - 5,847,499 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NES Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 93,412,247 - 93,421,893 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 93,412,660 - 93,421,899 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 101,984,527 - 101,993,772 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NES Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 7,185,208 - 7,193,964 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 7,185,390 - 7,193,983 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 6,480,916 - 6,489,509 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nes
.
Predicted Target Of
Count of predictions: 164 Count of miRNA genes: 99 Interacting mature miRNAs: 106 Transcripts: ENSRNOT00000025314, ENSRNOT00000025384 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 6907363 Bp357 Blood pressure QTL 357 4.1 0.002 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 129540907 174540907 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 12879845 Cm89 Cardiac mass QTL 89 0.008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 175950118 Rat 61473 Bp19 Blood pressure QTL 19 6.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 175950118 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 12879846 Cm90 Cardiac mass QTL 90 0.011 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 2 152413072 175950118 Rat 12879847 Am4 Aortic mass QTL 4 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 175950118 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2301415 Cm67 Cardiac mass QTL 67 0.003 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 175950118 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 11565180 Kidm56 Kidney mass QTL 56 0.003 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 175950118 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 11565181 Bw176 Body weight QTL 176 0.002 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 175950118 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 184114403 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 7488904 Bp363 Blood pressure QTL 363 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 172982062 175950118 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat
AA166324
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 173,446,921 - 173,447,055 (+) MAPPER mRatBN7.2 Rnor_6.0 2 184,908,098 - 184,908,231 NCBI Rnor6.0 Rnor_6.0 2 187,352,117 - 187,352,250 NCBI Rnor6.0 Rnor_5.0 2 204,299,171 - 204,299,304 UniSTS Rnor5.0 Rnor_5.0 2 206,755,134 - 206,755,267 UniSTS Rnor5.0 RGSC_v3.4 2 180,060,095 - 180,060,228 UniSTS RGSC3.4 Celera 2 167,394,347 - 167,394,480 UniSTS Cytogenetic Map 2 q34 UniSTS
RH131466
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 173,447,453 - 173,447,672 (+) MAPPER mRatBN7.2 Rnor_6.0 2 187,352,649 - 187,352,867 NCBI Rnor6.0 Rnor_5.0 2 206,755,666 - 206,755,884 UniSTS Rnor5.0 RGSC_v3.4 2 180,060,627 - 180,060,845 UniSTS RGSC3.4 Celera 2 167,394,879 - 167,395,097 UniSTS RH 3.4 Map 2 1130.7 UniSTS Cytogenetic Map 2 q34 UniSTS
UniSTS:497298
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 173,442,457 - 173,443,090 (+) MAPPER mRatBN7.2 Rnor_6.0 2 187,347,653 - 187,348,285 NCBI Rnor6.0 Rnor_6.0 2 184,903,634 - 184,904,266 NCBI Rnor6.0 Rnor_5.0 2 204,294,707 - 204,295,339 UniSTS Rnor5.0 Rnor_5.0 2 206,750,670 - 206,751,302 UniSTS Rnor5.0 RGSC_v3.4 2 180,055,631 - 180,056,263 UniSTS RGSC3.4 Celera 2 167,389,883 - 167,390,515 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
87
86
55
25
55
6
214
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025314 ⟹ ENSRNOP00000025314
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 173,438,734 - 173,447,777 (+) Ensembl Rnor_6.0 Ensembl 2 187,344,056 - 187,352,568 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000025384 ⟹ ENSRNOP00000025384
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 173,442,222 - 173,447,373 (+) Ensembl Rnor_6.0 Ensembl 2 187,347,602 - 187,352,969 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000100350 ⟹ ENSRNOP00000089157
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 173,438,734 - 173,447,373 (+) Ensembl
RefSeq Acc Id:
NM_001308239 ⟹ NP_001295168
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 175,736,588 - 175,745,631 (+) NCBI mRatBN7.2 2 173,438,734 - 173,447,777 (+) NCBI Rnor_6.0 2 187,343,929 - 187,352,972 (+) NCBI Celera 2 167,386,159 - 167,395,202 (+) NCBI
Sequence:
TGCTGGAGTTCTCCGCTTCCGCTGGGTCACTGTCGCCGCTACTTCTTTTCAACCCCTAAAAGCTCCACGGGCCACTCCCTTCTCTAGTGCTCCACGTCCGCTTGCCCTCGGGGGCCAGACCAGCGACA
hide sequence
RefSeq Acc Id:
NM_012987 ⟹ NP_037119
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 175,736,588 - 175,745,631 (+) NCBI mRatBN7.2 2 173,438,734 - 173,447,777 (+) NCBI Rnor_6.0 2 187,343,929 - 187,352,972 (+) NCBI Rnor_5.0 2 206,746,885 - 206,755,989 (+) NCBI RGSC_v3.4 2 180,051,907 - 180,060,947 (+) RGD Celera 2 167,386,159 - 167,395,202 (+) NCBI
Sequence:
TGCTGGAGTTCTCCGCTTCCGCTGGGTCACTGTCGCCGCTACTTCTTTTCAACCCCTAAAAGCTCCACGGGCCACTCCCTTCTCTAGTGCTCCACGTCCGCTTGCCCTCGGGGGCCAGACCAGCGACA
hide sequence
RefSeq Acc Id:
XM_017590648 ⟹ XP_017446137
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 175,735,715 - 175,745,631 (+) NCBI mRatBN7.2 2 173,437,867 - 173,447,777 (+) NCBI Rnor_6.0 2 187,343,109 - 187,352,972 (+) NCBI
Sequence:
AAACTTTCTTGAACGTATGACGTCCCTTGCCATTTTCCTTTTCCTGATGCGGGATGAGGAGGGG
hide sequence
RefSeq Acc Id:
NP_037119 ⟸ NM_012987
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I6ABC1 (UniProtKB/TrEMBL), A6J640 (UniProtKB/TrEMBL)
- Sequence:
MEGCVGEESFQMWELNRRLEAYLTRVKTLEEQNQLLSAELGGLRAQSGDTSWRARADDELASLRILVDQRWREKLEAEVQRDNLAEELESVAGRCQQVRLARERTVQEAACSRRALEAEKNARGWLST
hide sequence
RefSeq Acc Id:
NP_001295168 ⟸ NM_001308239
- Peptide Label:
isoform 1
- UniProtKB:
Q8CJ14 (UniProtKB/Swiss-Prot), P21263 (UniProtKB/Swiss-Prot), G3V8F8 (UniProtKB/TrEMBL), A6J639 (UniProtKB/TrEMBL)
- Sequence:
MEGCVGEESFQMWELNRRLEAYLTRVKTLEEQNQLLSAELGGLRAQSGDTSWRARADDELASLR
hide sequence
RefSeq Acc Id:
XP_017446137 ⟸ XM_017590648
- Peptide Label:
isoform X1
- UniProtKB:
Q8CJ14 (UniProtKB/Swiss-Prot), P21263 (UniProtKB/Swiss-Prot), G3V8F8 (UniProtKB/TrEMBL), A6J639 (UniProtKB/TrEMBL)
- Sequence:
MEGCVGEESFQMWELNRRLEAYLTRVKTLEEQNQLLSAELGGLRAQSGDTSWRARADDELASLR
hide sequence
Ensembl Acc Id:
ENSRNOP00000025384 ⟸ ENSRNOT00000025384
Ensembl Acc Id:
ENSRNOP00000025314 ⟸ ENSRNOT00000025314
Ensembl Acc Id:
ENSRNOP00000089157 ⟸ ENSRNOT00000100350
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Nes
nestin
LOC100910255
nestin-like
Data merged from RGD:6499605
737654 PROVISIONAL
2012-07-05
LOC100910255
nestin-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Nes
Nestin
Symbol and Name status set to approved
70586 APPROVED
