Symbol:
Mx1
Name:
MX dynamin like GTPase 1
RGD ID:
3127
Description:
Predicted to enable GTPase activity; identical protein binding activity; and microtubule binding activity. Involved in response to virus. Located in nucleus. Human ortholog(s) of this gene implicated in alopecia areata; avian influenza; liver disease; and prostate cancer. Orthologous to human MX1 (MX dynamin like GTPase 1); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
IFI78; interferon-induced GTP-binding protein Mx1; myxoma resistance protein 1; myxovirus (influenza virus) resistance; myxovirus (influenza virus) resistance 1; Myxovirus (influenza) resistance homolog of murine Mx (also interferon-inducible protein IFI78); Myxovirus (influenza) resistance, homolog of murine Mx (also interferon-inducible protein IFI78); myxovirus resistance protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 50,269,056 - 50,294,699 (-) NCBI GRCr8 mRatBN7.2 11 36,799,659 - 36,825,209 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 36,799,660 - 36,823,507 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 45,448,179 - 45,473,727 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 38,119,559 - 38,145,105 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 37,279,482 - 37,305,028 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 37,891,150 - 37,916,775 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 37,891,156 - 37,914,983 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 41,398,737 - 41,424,277 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 37,438,473 - 37,462,363 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 37,496,062 - 37,517,940 (-) NCBI Celera 11 36,686,487 - 36,712,040 (-) NCBI Celera Cytogenetic Map 11 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mx1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO MX1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of MX1 mRNA CTD PMID:22079256 Mx1 Rat (-)-epigallocatechin 3-gallate decreases expression ISO MX1 (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of MX1 mRNA CTD PMID:32512070 Mx1 Rat (S)-nicotine multiple interactions ISO MX1 (Homo sapiens) 6480464 [nickel chloride co-treated with Nicotine] results in increased expression of MX1 mRNA CTD PMID:37951547 Mx1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of MX1 mRNA CTD PMID:15834898 and PMID:17351261 Mx1 Rat 17beta-estradiol multiple interactions ISO MX1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of MX1 mRNA CTD PMID:30165855 Mx1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of MX1 mRNA CTD PMID:35192832 Mx1 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MX1 mRNA CTD PMID:32741896 Mx1 Rat 17beta-estradiol affects expression ISO Mx1 (Mus musculus) 6480464 Estradiol affects the expression of MX1 mRNA CTD PMID:15598610 Mx1 Rat 17beta-estradiol decreases expression ISO MX1 (Homo sapiens) 6480464 Estradiol results in decreased expression of MX1 mRNA CTD PMID:23373633 Mx1 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MX1 mRNA CTD PMID:32741896 Mx1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO MX1 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Mx1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO MX1 (Homo sapiens) 6480464 2 more ... CTD PMID:19095052 and PMID:23146750 Mx1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO MX1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Mx1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MX1 mRNA CTD PMID:15644576 Mx1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MX1 mRNA CTD PMID:33387578 Mx1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MX1 mRNA CTD PMID:34747641 Mx1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO MX1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MX1 mRNA CTD PMID:12377990 Mx1 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Mx1 Rat 2,6-dimethoxyphenol multiple interactions ISO MX1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Mx1 Rat 2-hydroxypropanoic acid increases expression ISO MX1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of MX1 mRNA CTD PMID:30851411 Mx1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 and PMID:32119087 Mx1 Rat 3-phenylprop-2-enal decreases expression ISO MX1 (Homo sapiens) 6480464 cinnamaldehyde results in decreased expression of MX1 mRNA CTD PMID:19524605 Mx1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Mx1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of MX1 mRNA CTD PMID:18648102 Mx1 Rat 4-hydroxynon-2-enal decreases expression ISO Mx1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of MX1 mRNA CTD PMID:19191707 Mx1 Rat 5,6-dichloro-1-beta-D-ribofuranosyl-1H-benzimidazole multiple interactions ISO Mx1 (Mus musculus) 6480464 Dichlororibofuranosylbenzimidazole inhibits the reaction [IFNB1 protein promotes the reaction [NELFA protein binds to MX1 promoter]] CTD PMID:23589332 Mx1 Rat 5,6-dichlorobenzimidazole riboside multiple interactions ISO Mx1 (Mus musculus) 6480464 Dichlororibofuranosylbenzimidazole inhibits the reaction [IFNB1 protein promotes the reaction [NELFA protein binds to MX1 promoter]] CTD PMID:23589332 Mx1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO MX1 (Homo sapiens) 6480464 [Decitabine co-treated with Vorinostat] affects the expression of MX1 mRNA CTD PMID:17330099 Mx1 Rat 5-aza-2'-deoxycytidine increases expression ISO MX1 (Homo sapiens) 6480464 Decitabine results in increased expression of MX1 mRNA CTD PMID:16367923 and PMID:21856257 Mx1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MX1 mRNA CTD PMID:24780913 Mx1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MX1 mRNA CTD PMID:30047161 Mx1 Rat 6alpha-methylprednisolone decreases expression ISO MX1 (Homo sapiens) 6480464 Methylprednisolone results in decreased expression of MX1 mRNA CTD PMID:19192274 Mx1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of MX1 mRNA CTD PMID:31881176 Mx1 Rat acetylsalicylic acid decreases expression ISO MX1 (Homo sapiens) 6480464 Aspirin results in decreased expression of MX1 mRNA CTD PMID:15928584 Mx1 Rat acrolein multiple interactions ISO MX1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of MX1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of MX1 mRNA CTD PMID:32699268 Mx1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of MX1 mRNA CTD PMID:28959563 Mx1 Rat Actein increases expression EXP 6480464 actein results in increased expression of MX1 protein CTD PMID:29969672 Mx1 Rat actinomycin D multiple interactions ISO MX1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of MX1 mRNA CTD PMID:38460933 Mx1 Rat aldehydo-D-glucose multiple interactions ISO Mx1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of MX1 mRNA CTD PMID:37567420 Mx1 Rat all-trans-retinoic acid increases expression ISO MX1 (Homo sapiens) 6480464 Tretinoin results in increased expression of MX1 mRNA CTD PMID:33167477 Mx1 Rat alpha-pinene multiple interactions ISO MX1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of MX1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of MX1 mRNA CTD PMID:32699268 Mx1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of MX1 mRNA CTD PMID:35163327 Mx1 Rat alvocidib multiple interactions ISO Mx1 (Mus musculus) 6480464 alvocidib inhibits the reaction [IFNB1 protein promotes the reaction [NELFA protein binds to MX1 promoter]] and alvocidib inhibits the reaction [IFNB1 protein promotes the reaction [SUPT5H protein binds to MX1 promoter]] CTD PMID:23589332 Mx1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of MX1 mRNA CTD PMID:30047161 Mx1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MX1 mRNA CTD PMID:16483693 Mx1 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of MX1 mRNA CTD PMID:30779732 Mx1 Rat arsane multiple interactions ISO MX1 (Homo sapiens) 6480464 [Arsenic results in increased abundance of monomethylarsonic acid] which affects the expression of MX1 mRNA CTD PMID:28793237 Mx1 Rat arsenic atom multiple interactions ISO MX1 (Homo sapiens) 6480464 [Arsenic results in increased abundance of monomethylarsonic acid] which affects the expression of MX1 mRNA CTD PMID:28793237 Mx1 Rat arsenous acid increases expression ISO MX1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MX1 protein CTD PMID:19364129 Mx1 Rat arsenous acid increases expression ISO Mx1 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of MX1 mRNA CTD PMID:35676786 Mx1 Rat azathioprine decreases expression ISO MX1 (Homo sapiens) 6480464 Azathioprine results in decreased expression of MX1 mRNA CTD PMID:19192274 Mx1 Rat benzene increases expression ISO MX1 (Homo sapiens) 6480464 Benzene results in increased expression of MX1 mRNA CTD PMID:33064461 Mx1 Rat benzene decreases expression ISO MX1 (Homo sapiens) 6480464 Benzene results in decreased expression of MX1 mRNA CTD PMID:19162166 Mx1 Rat benzo[a]pyrene increases expression ISO Mx1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MX1 mRNA CTD PMID:11356909 and PMID:23735875 Mx1 Rat benzo[a]pyrene decreases expression ISO Mx1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MX1 mRNA CTD PMID:20713471 Mx1 Rat benzo[a]pyrene decreases expression ISO MX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MX1 mRNA CTD PMID:30453624 Mx1 Rat benzo[a]pyrene increases expression ISO MX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MX1 mRNA CTD PMID:19152381 Mx1 Rat benzo[a]pyrene increases methylation ISO MX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MX1 exon CTD PMID:27901495 Mx1 Rat benzo[a]pyrene affects methylation ISO MX1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MX1 5' UTR and Benzo(a)pyrene affects the methylation of MX1 promoter CTD PMID:27901495 Mx1 Rat benzo[a]pyrene multiple interactions ISO MX1 (Homo sapiens) 6480464 chlorophyllin inhibits the reaction [Benzo(a)pyrene results in increased expression of MX1 mRNA] CTD PMID:19152381 Mx1 Rat bis(2-chloroethyl) sulfide increases expression ISO MX1 (Homo sapiens) 6480464 Mustard Gas results in increased expression of MX1 mRNA CTD PMID:25102026 Mx1 Rat bis(2-ethylhexyl) phthalate increases expression ISO MX1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of MX1 mRNA CTD PMID:31163220 Mx1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO MX1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of MX1 protein CTD PMID:31163220 Mx1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MX1 mRNA CTD PMID:25181051 Mx1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MX1 mRNA CTD PMID:32145629 and PMID:35192832 Mx1 Rat bisphenol A decreases expression ISO Mx1 (Mus musculus) 6480464 bisphenol A results in decreased expression of MX1 mRNA CTD PMID:35598803 Mx1 Rat bisphenol A increases expression ISO Mx1 (Mus musculus) 6480464 bisphenol A results in increased expression of MX1 mRNA CTD PMID:38701888 Mx1 Rat bisphenol A decreases methylation ISO MX1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of MX1 gene CTD PMID:31601247 Mx1 Rat bisphenol A decreases expression ISO MX1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MX1 protein CTD PMID:31675489 Mx1 Rat bisphenol A multiple interactions ISO MX1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of MX1 gene CTD PMID:31601247 Mx1 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of MX1 mRNA CTD PMID:32479839 Mx1 Rat cadmium atom multiple interactions ISO Mx1 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of MX1 mRNA CTD PMID:31904401 Mx1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of MX1 mRNA CTD PMID:25993096 Mx1 Rat cadmium dichloride multiple interactions ISO Mx1 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of MX1 mRNA CTD PMID:31904401 Mx1 Rat camptothecin increases expression ISO MX1 (Homo sapiens) 6480464 Camptothecin results in increased expression of MX1 mRNA CTD PMID:38460933 Mx1 Rat carbon nanotube increases expression ISO Mx1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Mx1 Rat carbon nanotube affects expression ISO Mx1 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of MX1 mRNA CTD PMID:23845593 Mx1 Rat CGP 52608 multiple interactions ISO MX1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MX1 gene] CTD PMID:28238834 Mx1 Rat chlorophyllin multiple interactions ISO MX1 (Homo sapiens) 6480464 chlorophyllin inhibits the reaction [Benzo(a)pyrene results in increased expression of MX1 mRNA] CTD PMID:19152381 Mx1 Rat chromium(6+) affects expression ISO MX1 (Homo sapiens) 6480464 chromium hexavalent ion affects the expression of MX1 mRNA CTD PMID:30690063 Mx1 Rat chromium(6+) multiple interactions ISO MX1 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of MX1 mRNA CTD PMID:38479592 Mx1 Rat cisplatin increases expression ISO Mx1 (Mus musculus) 6480464 Cisplatin results in increased expression of MX1 mRNA CTD PMID:21151649 Mx1 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of MX1 mRNA CTD PMID:30556269 Mx1 Rat copper atom multiple interactions ISO MX1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of MX1 mRNA CTD PMID:24690739 Mx1 Rat copper(0) multiple interactions ISO MX1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of MX1 mRNA CTD PMID:24690739 Mx1 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of MX1 mRNA CTD PMID:30556269 Mx1 Rat crocidolite asbestos increases expression ISO Mx1 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of MX1 mRNA CTD PMID:29279043 Mx1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of MX1 mRNA CTD PMID:27523638 Mx1 Rat cyclosporin A decreases expression ISO MX1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MX1 mRNA CTD PMID:33631201 Mx1 Rat cyclosporin A increases expression ISO MX1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of MX1 mRNA CTD PMID:20106945 more ... Mx1 Rat D-glucose multiple interactions ISO Mx1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of MX1 mRNA CTD PMID:37567420 Mx1 Rat decabromodiphenyl ether increases expression ISO MX1 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of MX1 protein CTD PMID:31675489 Mx1 Rat diarsenic trioxide increases expression ISO MX1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MX1 protein CTD PMID:19364129 Mx1 Rat diarsenic trioxide increases expression ISO Mx1 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of MX1 mRNA CTD PMID:35676786 Mx1 Rat dichloroacetic acid decreases expression ISO Mx1 (Mus musculus) 6480464 Dichloroacetic Acid results in decreased expression of MX1 mRNA CTD PMID:28962523 Mx1 Rat diclofenac decreases expression ISO MX1 (Homo sapiens) 6480464 Diclofenac results in decreased expression of MX1 mRNA CTD PMID:19192274 Mx1 Rat dieldrin multiple interactions ISO MX1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Dieldrin inhibits the reaction [Poly I-C results in increased expression of MX1 mRNA]] and Dieldrin inhibits the reaction [Poly I-C results in increased expression of MX1 mRNA] CTD PMID:34051100 Mx1 Rat dieldrin decreases expression EXP 6480464 Dieldrin results in decreased expression of MX1 mRNA CTD PMID:34051100 Mx1 Rat diethyl maleate decreases expression EXP 6480464 diethyl maleate results in decreased expression of MX1 mRNA CTD PMID:21161181 Mx1 Rat dimethylarsinic acid multiple interactions ISO Mx1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of MX1 mRNA CTD PMID:34876320 Mx1 Rat dimethylarsinous acid decreases expression ISO MX1 (Homo sapiens) 6480464 dimethylarsinous acid results in decreased expression of MX1 mRNA CTD PMID:23876855 Mx1 Rat dioxygen multiple interactions EXP 6480464 [dan-shen root extract co-treated with Andrographis paniculata extract] inhibits the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of MX1 mRNA] and [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of MX1 mRNA CTD PMID:33729688 Mx1 Rat disulfiram multiple interactions ISO MX1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of MX1 mRNA CTD PMID:24690739 Mx1 Rat diuron decreases expression ISO MX1 (Homo sapiens) 6480464 Diuron results in decreased expression of MX1 mRNA CTD PMID:35967413 Mx1 Rat doxorubicin decreases expression ISO MX1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MX1 mRNA CTD PMID:29803840 Mx1 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of MX1 mRNA CTD PMID:32289291 Mx1 Rat elemental selenium increases expression ISO MX1 (Homo sapiens) 6480464 Selenium results in increased expression of MX1 mRNA CTD PMID:19244175 Mx1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of MX1 mRNA CTD PMID:29391264 Mx1 Rat fentanyl increases expression EXP 6480464 Fentanyl results in increased expression of MX1 mRNA CTD PMID:36032789 Mx1 Rat folic acid affects expression ISO Mx1 (Mus musculus) 6480464 Folic Acid deficiency affects the expression of MX1 mRNA CTD PMID:32304770 Mx1 Rat formaldehyde decreases expression ISO MX1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of MX1 mRNA CTD PMID:28937961 Mx1 Rat fragrance increases expression ISO MX1 (Homo sapiens) 6480464 Perfume results in increased expression of MX1 mRNA CTD PMID:24768652 Mx1 Rat fructose multiple interactions ISO Mx1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of MX1 mRNA CTD PMID:37567420 Mx1 Rat fulvestrant multiple interactions ISO MX1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of MX1 gene CTD PMID:31601247 Mx1 Rat furfural multiple interactions ISO MX1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Mx1 Rat Genipin multiple interactions ISO Mx1 (Mus musculus) 6480464 genipin inhibits the reaction [Lipopolysaccharides results in increased expression of MX1 mRNA] CTD PMID:22687549 Mx1 Rat genistein decreases expression ISO MX1 (Homo sapiens) 6480464 Genistein results in decreased expression of MX1 protein CTD PMID:20884965 Mx1 Rat genistein multiple interactions ISO MX1 (Homo sapiens) 6480464 ESR2 promotes the reaction [Genistein results in decreased expression of MX1 protein] CTD PMID:20884965 Mx1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MX1 mRNA CTD PMID:22061828 Mx1 Rat glucose multiple interactions ISO Mx1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of MX1 mRNA CTD PMID:37567420 Mx1 Rat glyphosate multiple interactions ISO Mx1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of MX1 mRNA CTD PMID:37567420 Mx1 Rat GW 4064 decreases expression ISO Mx1 (Mus musculus) 6480464 GW 4064 results in decreased expression of MX1 mRNA CTD PMID:26655953 Mx1 Rat hydroquinone decreases expression ISO MX1 (Homo sapiens) 6480464 hydroquinone results in decreased expression of MX1 mRNA CTD PMID:31256213 Mx1 Rat iopamidol decreases expression ISO MX1 (Homo sapiens) 6480464 Iopamidol results in decreased expression of MX1 mRNA CTD PMID:29705293 Mx1 Rat isoflurane decreases methylation ISO Mx1 (Mus musculus) 6480464 Isoflurane results in decreased methylation of MX1 mRNA CTD PMID:35249202 Mx1 Rat lipopolysaccharide increases expression ISO Mx1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of MX1 mRNA CTD PMID:22687549 more ... Mx1 Rat lipopolysaccharide multiple interactions ISO Mx1 (Mus musculus) 6480464 genipin inhibits the reaction [Lipopolysaccharides results in increased expression of MX1 mRNA] and methyldithiocarbamate inhibits the reaction [Lipopolysaccharides results in increased expression of MX1 mRNA] CTD PMID:22687549 and PMID:24056979 Mx1 Rat lipopolysaccharide increases expression ISO MX1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of MX1 mRNA CTD PMID:15860229 and PMID:35811015 Mx1 Rat lipopolysaccharide multiple interactions ISO MX1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:28070326 and PMID:35811015 Mx1 Rat lipopolysaccharide affects expression ISO MX1 (Homo sapiens) 6480464 Lipopolysaccharides affects the expression of MX1 mRNA CTD PMID:28070326 Mx1 Rat lucanthone increases expression ISO MX1 (Homo sapiens) 6480464 Lucanthone results in increased expression of MX1 mRNA CTD PMID:21148553 Mx1 Rat metam multiple interactions ISO Mx1 (Mus musculus) 6480464 methyldithiocarbamate inhibits the reaction [Lipopolysaccharides results in increased expression of MX1 mRNA] CTD PMID:24056979 Mx1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of MX1 mRNA CTD PMID:30047161 Mx1 Rat methotrexate decreases expression ISO MX1 (Homo sapiens) 6480464 Methotrexate results in decreased expression of MX1 mRNA CTD PMID:19192274 Mx1 Rat methylarsonic acid multiple interactions ISO MX1 (Homo sapiens) 6480464 [Arsenic results in increased abundance of monomethylarsonic acid] which affects the expression of MX1 mRNA CTD PMID:28793237 Mx1 Rat methylarsonic acid multiple interactions ISO Mx1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of MX1 mRNA CTD PMID:34876320 Mx1 Rat mitomycin C increases response to substance ISO MX1 (Homo sapiens) 6480464 MX1 protein results in increased susceptibility to Mitomycin CTD PMID:9389754 Mx1 Rat N-acetyl-L-cysteine multiple interactions ISO MX1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Dieldrin inhibits the reaction [Poly I-C results in increased expression of MX1 mRNA]] CTD PMID:34051100 Mx1 Rat N-Acetyl-S-(1,2-dichlorovinyl)-cysteine increases expression ISO MX1 (Homo sapiens) 6480464 S-1 and 2-dichlorovinyl-N-acetylcysteine results in increased expression of MX1 mRNA CTD PMID:16844155 Mx1 Rat nickel atom multiple interactions ISO MX1 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of MX1 mRNA] CTD PMID:14575637 Mx1 Rat nickel atom increases expression ISO MX1 (Homo sapiens) 6480464 Nickel results in increased expression of MX1 mRNA CTD PMID:24768652 and PMID:25583101 Mx1 Rat nickel atom affects expression ISO MX1 (Homo sapiens) 6480464 Nickel affects the expression of MX1 mRNA CTD PMID:14575637 Mx1 Rat nickel dichloride multiple interactions ISO MX1 (Homo sapiens) 6480464 [nickel chloride co-treated with Nicotine] results in increased expression of MX1 mRNA CTD PMID:37951547 Mx1 Rat nickel sulfate increases expression ISO MX1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of MX1 mRNA CTD PMID:25673294 Mx1 Rat nicotine multiple interactions ISO MX1 (Homo sapiens) 6480464 [nickel chloride co-treated with Nicotine] results in increased expression of MX1 mRNA CTD PMID:37951547 Mx1 Rat Nutlin-3 multiple interactions ISO MX1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of MX1 mRNA CTD PMID:38460933 Mx1 Rat oxaliplatin multiple interactions EXP 6480464 [Oxaliplatin co-treated with Topotecan] results in increased expression of MX1 mRNA CTD PMID:25729387 Mx1 Rat oxaliplatin increases expression EXP 6480464 Oxaliplatin results in increased expression of MX1 mRNA CTD PMID:25729387 Mx1 Rat ozone multiple interactions ISO MX1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of MX1 mRNA more ... CTD PMID:32699268 Mx1 Rat paracetamol decreases expression ISO MX1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MX1 mRNA CTD PMID:21420995 Mx1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MX1 mRNA CTD PMID:32479839 and PMID:33387578 Mx1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of MX1 mRNA CTD PMID:32680482 Mx1 Rat paraquat increases expression ISO MX1 (Homo sapiens) 6480464 Paraquat results in increased expression of MX1 mRNA CTD PMID:34097952 Mx1 Rat pentachlorophenol increases expression ISO Mx1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of MX1 mRNA CTD PMID:23892564 Mx1 Rat pentanal increases expression ISO MX1 (Homo sapiens) 6480464 pentanal results in increased expression of MX1 mRNA CTD PMID:26079696 Mx1 Rat perfluorohexanesulfonic acid increases expression ISO Mx1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of MX1 mRNA CTD PMID:37995155 Mx1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of MX1 mRNA CTD PMID:35163327 Mx1 Rat perfluorooctanoic acid decreases expression ISO MX1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of MX1 mRNA CTD PMID:37738295 Mx1 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of MX1 mRNA CTD PMID:19162173 Mx1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Mx1 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of MX1 mRNA CTD PMID:31904401 Mx1 Rat piroxicam decreases expression ISO MX1 (Homo sapiens) 6480464 Piroxicam results in decreased expression of MX1 mRNA CTD PMID:19192274 Mx1 Rat poly(I:C) multiple interactions ISO MX1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Dieldrin inhibits the reaction [Poly I-C results in increased expression of MX1 mRNA]] and Dieldrin inhibits the reaction [Poly I-C results in increased expression of MX1 mRNA] CTD PMID:34051100 Mx1 Rat poly(I:C) increases expression ISO MX1 (Homo sapiens) 6480464 Poly I-C results in increased expression of MX1 mRNA CTD PMID:17669408 more ... Mx1 Rat potassium chromate increases expression ISO MX1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of MX1 mRNA CTD PMID:22714537 Mx1 Rat potassium chromate multiple interactions ISO MX1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of MX1 mRNA CTD PMID:22079256 Mx1 Rat potassium chromate decreases expression ISO MX1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of MX1 mRNA CTD PMID:22079256 Mx1 Rat prednisolone decreases expression ISO MX1 (Homo sapiens) 6480464 Prednisolone results in decreased expression of MX1 mRNA CTD PMID:19192274 Mx1 Rat protein kinase inhibitor decreases expression ISO MX1 (Homo sapiens) 6480464 Protein Kinase Inhibitors results in decreased expression of MX1 mRNA CTD PMID:28003376 Mx1 Rat rac-lactic acid increases expression ISO MX1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of MX1 mRNA CTD PMID:30851411 Mx1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO MX1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Mx1 Rat selenium atom increases expression ISO MX1 (Homo sapiens) 6480464 Selenium results in increased expression of MX1 mRNA CTD PMID:19244175 Mx1 Rat serpentine asbestos decreases expression ISO MX1 (Homo sapiens) 6480464 Asbestos and Serpentine results in decreased expression of MX1 mRNA CTD PMID:29523930 Mx1 Rat serpentine asbestos increases expression ISO MX1 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of MX1 mRNA CTD PMID:24160326 Mx1 Rat silicon dioxide increases expression ISO MX1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of MX1 mRNA and Silicon Dioxide results in increased expression of MX1 mRNA CTD PMID:22300531 more ... Mx1 Rat silicon dioxide increases expression ISO Mx1 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of MX1 mRNA CTD PMID:29341224 Mx1 Rat silver atom decreases expression ISO Mx1 (Mus musculus) 6480464 Silver results in decreased expression of MX1 mRNA CTD PMID:27131904 Mx1 Rat silver(0) decreases expression ISO Mx1 (Mus musculus) 6480464 Silver results in decreased expression of MX1 mRNA CTD PMID:27131904 Mx1 Rat sodium arsenate multiple interactions ISO Mx1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of MX1 mRNA CTD PMID:34876320 Mx1 Rat sodium arsenite decreases expression ISO MX1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MX1 mRNA CTD PMID:23876855 Mx1 Rat sodium arsenite multiple interactions ISO Mx1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of MX1 mRNA CTD PMID:34876320 Mx1 Rat sodium aurothiomalate decreases expression ISO MX1 (Homo sapiens) 6480464 Gold Sodium Thiomalate results in decreased expression of MX1 mRNA CTD PMID:19192274 Mx1 Rat sodium chloride multiple interactions ISO MX1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of MX1 protein more ... CTD PMID:38598786 Mx1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of MX1 mRNA CTD PMID:19281266 Mx1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of MX1 mRNA CTD PMID:30047161 Mx1 Rat sulindac sulfide decreases expression ISO MX1 (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of MX1 mRNA CTD PMID:16184548 Mx1 Rat tamoxifen increases expression ISO MX1 (Homo sapiens) 6480464 Tamoxifen results in increased expression of MX1 mRNA CTD PMID:19155303 Mx1 Rat temozolomide increases expression ISO MX1 (Homo sapiens) 6480464 Temozolomide results in increased expression of MX1 mRNA CTD PMID:31758290 Mx1 Rat tert-butyl hydroperoxide decreases expression ISO MX1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of MX1 mRNA CTD PMID:15336504 Mx1 Rat tert-butyl hydroperoxide increases expression ISO Mx1 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of MX1 mRNA CTD PMID:14729362 and PMID:15003993 Mx1 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MX1 mRNA CTD PMID:32741896 Mx1 Rat testosterone decreases expression ISO MX1 (Homo sapiens) 6480464 Testosterone results in decreased expression of MX1 mRNA CTD PMID:33359661 Mx1 Rat testosterone enanthate affects expression ISO MX1 (Homo sapiens) 6480464 testosterone enanthate affects the expression of MX1 mRNA CTD PMID:17440010 Mx1 Rat tetrachloroethene increases expression ISO MX1 (Homo sapiens) 6480464 Tetrachloroethylene results in increased expression of MX1 mRNA CTD PMID:16010555 Mx1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MX1 mRNA CTD PMID:31150632 Mx1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MX1 mRNA CTD PMID:34492290 Mx1 Rat titanium dioxide increases expression ISO Mx1 (Mus musculus) 6480464 titanium dioxide results in increased expression of MX1 mRNA CTD PMID:27760801 Mx1 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of MX1 mRNA CTD PMID:30012374 Mx1 Rat tofacitinib decreases expression ISO MX1 (Homo sapiens) 6480464 tofacitinib results in decreased expression of MX1 mRNA CTD PMID:25487280 Mx1 Rat topotecan multiple interactions EXP 6480464 [Oxaliplatin co-treated with Topotecan] results in increased expression of MX1 mRNA CTD PMID:25729387 Mx1 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of MX1 mRNA CTD PMID:25729387 Mx1 Rat tremolite asbestos increases expression ISO Mx1 (Mus musculus) 6480464 tremolite results in increased expression of MX1 mRNA CTD PMID:29279043 Mx1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of MX1 mRNA CTD PMID:33387578 Mx1 Rat trichostatin A multiple interactions ISO MX1 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of MX1 mRNA] CTD PMID:14575637 Mx1 Rat triclosan increases expression ISO MX1 (Homo sapiens) 6480464 Triclosan results in increased expression of MX1 mRNA CTD PMID:30510588 Mx1 Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of MX1 protein CTD PMID:32519852 Mx1 Rat tunicamycin increases expression ISO MX1 (Homo sapiens) 6480464 Tunicamycin results in increased expression of MX1 mRNA CTD PMID:38498338 Mx1 Rat valproic acid decreases expression ISO MX1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MX1 mRNA CTD PMID:29154799 Mx1 Rat valproic acid increases expression ISO MX1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MX1 mRNA CTD PMID:23527032 Mx1 Rat vitamin E increases expression ISO MX1 (Homo sapiens) 6480464 Vitamin E results in increased expression of MX1 mRNA CTD PMID:19244175 Mx1 Rat vorinostat multiple interactions ISO MX1 (Homo sapiens) 6480464 [Decitabine co-treated with Vorinostat] affects the expression of MX1 mRNA CTD PMID:17330099 Mx1 Rat zidovudine multiple interactions ISO MX1 (Homo sapiens) 6480464 [Zidovudine co-treated with IFNA1 protein] results in increased expression of MX1 mRNA CTD PMID:20370541
(-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-phenylprop-2-enal (ISO) 4,4'-diaminodiphenylmethane (ISO) 4-hydroxynon-2-enal (ISO) 5,6-dichloro-1-beta-D-ribofuranosyl-1H-benzimidazole (ISO) 5,6-dichlorobenzimidazole riboside (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 6alpha-methylprednisolone (ISO) acetamide (EXP) acetylsalicylic acid (ISO) acrolein (ISO) acrylamide (EXP) Actein (EXP) actinomycin D (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) alpha-Zearalanol (EXP) alvocidib (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) azathioprine (ISO) benzene (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) camptothecin (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorophyllin (ISO) chromium(6+) (ISO) cisplatin (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) D-glucose (ISO) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) dichloroacetic acid (ISO) diclofenac (ISO) dieldrin (EXP,ISO) diethyl maleate (EXP) dimethylarsinic acid (ISO) dimethylarsinous acid (ISO) dioxygen (EXP) disulfiram (ISO) diuron (ISO) doxorubicin (EXP,ISO) elemental selenium (ISO) endosulfan (EXP) fentanyl (EXP) folic acid (ISO) formaldehyde (ISO) fragrance (ISO) fructose (ISO) fulvestrant (ISO) furfural (ISO) Genipin (ISO) genistein (ISO) gentamycin (EXP) glucose (ISO) glyphosate (ISO) GW 4064 (ISO) hydroquinone (ISO) iopamidol (ISO) isoflurane (ISO) lipopolysaccharide (ISO) lucanthone (ISO) metam (ISO) methimazole (EXP) methotrexate (ISO) methylarsonic acid (ISO) mitomycin C (ISO) N-acetyl-L-cysteine (ISO) N-Acetyl-S-(1,2-dichlorovinyl)-cysteine (ISO) nickel atom (ISO) nickel dichloride (ISO) nickel sulfate (ISO) nicotine (ISO) Nutlin-3 (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) pentachlorophenol (ISO) pentanal (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phorbol 13-acetate 12-myristate (ISO) piroxicam (ISO) poly(I:C) (ISO) potassium chromate (ISO) prednisolone (ISO) protein kinase inhibitor (ISO) rac-lactic acid (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) selenium atom (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium aurothiomalate (ISO) sodium chloride (ISO) Soman (EXP) sulfadimethoxine (EXP) sulindac sulfide (ISO) tamoxifen (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP,ISO) testosterone enanthate (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (EXP,ISO) tofacitinib (ISO) topotecan (EXP) tremolite asbestos (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) Triptolide (EXP) tunicamycin (ISO) valproic acid (ISO) vitamin E (ISO) vorinostat (ISO) zidovudine (ISO)
1.
Human MxA is a potent interspecies barrier for the novel bat-derived influenza A-like virus H18N11.
Ciminski K, etal., Emerg Microbes Infect. 2019;8(1):556-563. doi: 10.1080/22221751.2019.1599301.
2.
In vivo evasion of MxA by avian influenza viruses requires human signature in the viral nucleoprotein.
Deeg CM, etal., J Exp Med. 2017 May 1;214(5):1239-1248. doi: 10.1084/jem.20161033. Epub 2017 Apr 10.
3.
Mx1, OAS1 and OAS2 polymorphisms are associated with the severity of liver disease in HIV/HCV-coinfected patients: A cross-sectional study.
García-Álvarez M, etal., Sci Rep. 2017 Jan 31;7:41516. doi: 10.1038/srep41516.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
The myxovirus resistance A (MxA) gene -88G>T single nucleotide polymorphism is associated with prostate cancer.
Glymph S, etal., Infect Genet Evol. 2013 Jun;16:186-90. doi: 10.1016/j.meegid.2013.02.010. Epub 2013 Feb 22.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Aetiology of febrile pharyngitis in children: Potential of myxovirus resistance protein A (MxA) as a biomarker of viral infection.
Ivaska L, etal., J Infect. 2017 Apr;74(4):385-392. doi: 10.1016/j.jinf.2017.01.002. Epub 2017 Jan 7.
8.
Cell-Penetrating Mx1 Enhances Anti-Viral Resistance against Mucosal Influenza Viral Infection.
Jung HE, etal., Viruses. 2019 Jan 28;11(2). pii: v11020109. doi: 10.3390/v11020109.
9.
Resistance to influenza virus infection of Mx transgenic mice expressing Mx protein under the control of two constitutive promoters.
Kolb E, etal., J Virol. 1992 Mar;66(3):1709-16. doi: 10.1128/JVI.66.3.1709-1716.1992.
10.
Influenza restriction factor MxA functions as inflammasome sensor in the respiratory epithelium.
Lee S, etal., Sci Immunol. 2019 Oct 25;4(40). pii: 4/40/eaau4643. doi: 10.1126/sciimmunol.aau4643.
11.
Activity of rat Mx proteins against a rhabdovirus.
Meier E, etal., J Virol 1990 Dec;64(12):6263-9.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Hepatic IFNL4 expression is associated with non-response to interferon-based therapy through the regulation of basal interferon-stimulated gene expression in chronic hepatitis C patients.
Murakawa M, etal., J Med Virol. 2017 Jul;89(7):1241-1247. doi: 10.1002/jmv.24763. Epub 2017 Feb 27.
14.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.
GOA pipeline
RGD automated data pipeline
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Plasmacytoid dendritic cells and type I interferon in the immunological response against warts.
Saadeh D, etal., Clin Exp Dermatol. 2017 Dec;42(8):857-862. doi: 10.1111/ced.13187. Epub 2017 Jul 24.
18.
Gene polymorphisms of IL-10 and MxA in responders and non-responders to interferon therapy in HCV Egyptian patients genotype 4.
Shaker OG, etal., Cell Biochem Biophys. 2015 Mar;71(2):617-25. doi: 10.1007/s12013-014-0241-9.
19.
Structure and polymorphism of the human gene for the interferon-induced p78 protein (MX1): evidence of association with alopecia areata in the Down syndrome region.
Tazi-Ahnini R, etal., Hum Genet. 2000 Jun;106(6):639-45. doi: 10.1007/s004390000318.
20.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
21.
Blood MxA protein as a marker for respiratory virus infections in young children.
Toivonen L, etal., J Clin Virol. 2015 Jan;62:8-13. doi: 10.1016/j.jcv.2014.11.018. Epub 2014 Nov 18.
22.
Influence of IL28B and MxA gene polymorphisms on HCV clearance in Han Chinese population.
Zang F, etal., Epidemiol Infect. 2018 Feb;146(3):379-385. doi: 10.1017/S0950268817002928. Epub 2017 Dec 22.
23.
Association of functional polymorphisms in the MxA gene with susceptibility to enterovirus 71 infection.
Zhang X, etal., Hum Genet. 2014 Feb;133(2):187-97. doi: 10.1007/s00439-013-1367-3. Epub 2013 Oct 2.
Mx1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 50,269,056 - 50,294,699 (-) NCBI GRCr8 mRatBN7.2 11 36,799,659 - 36,825,209 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 36,799,660 - 36,823,507 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 45,448,179 - 45,473,727 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 38,119,559 - 38,145,105 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 37,279,482 - 37,305,028 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 37,891,150 - 37,916,775 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 37,891,156 - 37,914,983 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 41,398,737 - 41,424,277 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 37,438,473 - 37,462,363 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 37,496,062 - 37,517,940 (-) NCBI Celera 11 36,686,487 - 36,712,040 (-) NCBI Celera Cytogenetic Map 11 q12 NCBI
MX1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 21 41,420,558 - 41,459,214 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 21 41,420,020 - 41,470,071 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 21 42,792,485 - 42,831,141 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 21 41,720,024 - 41,753,008 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 21 41,720,023 - 41,753,008 NCBI Celera 21 27,990,716 - 28,029,320 (+) NCBI Celera Cytogenetic Map 21 q22.3 NCBI HuRef 21 28,261,373 - 28,300,013 (+) NCBI HuRef CHM1_1 21 42,353,308 - 42,391,928 (+) NCBI CHM1_1 T2T-CHM13v2.0 21 39,807,998 - 39,847,898 (+) NCBI T2T-CHM13v2.0
Mx1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 97,248,235 - 97,264,106 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 97,248,235 - 97,264,107 (-) Ensembl GRCm39 Ensembl GRCm38 16 97,447,035 - 97,462,906 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 97,447,035 - 97,462,907 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 97,668,642 - 97,684,513 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 97,551,947 - 97,567,815 (-) NCBI MGSCv36 mm8 Celera 16 98,507,376 - 98,523,260 (-) NCBI Celera Cytogenetic Map 16 C4 NCBI cM Map 16 57.46 NCBI
.
Predicted Target Of
Count of predictions: 393 Count of miRNA genes: 189 Interacting mature miRNAs: 213 Transcripts: ENSRNOT00000039876 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 70180 BpQTLcluster10 Blood pressure QTL cluster 10 3.19 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 11 34918041 79918041 Rat 8694376 Bw156 Body weight QTL 156 2.25 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 724517 Uae18 Urinary albumin excretion QTL 18 3.7 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 16472047 44285911 Rat 10058952 Gmadr6 Adrenal mass QTL 6 2.29 0.0072 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 22959403 67959403 Rat 1300130 Rf20 Renal function QTL 20 4.44 kidney glomerulus integrity trait (VT:0010546) kidney glomerulus diameter (CMO:0001166) 11 29528418 60324829 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 2298551 Neuinf10 Neuroinflammation QTL 10 3.7 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 11 31239134 78851519 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 9589032 Epfw10 Epididymal fat weight QTL 10 9.29 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 11 23280456 68280456 Rat 9590313 Scort20 Serum corticosterone level QTL 20 6.51 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 11 23280456 68280456 Rat 8694424 Bw162 Body weight QTL 162 3.8 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat 1641927 Alcrsp10 Alcohol response QTL 10 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 11 8436674 53436674 Rat
AA997168
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 11 261.71 UniSTS Cytogenetic Map 11 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
47
113
91
90
59
25
59
6
216
95
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002695 ⟹ ENSRNOP00000002695
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 36,803,999 - 36,814,429 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000039876 ⟹ ENSRNOP00000043001
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 36,799,660 - 36,823,507 (-) Ensembl Rnor_6.0 Ensembl 11 37,891,156 - 37,914,983 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094076 ⟹ ENSRNOP00000086162
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 36,799,660 - 36,823,507 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115496 ⟹ ENSRNOP00000091403
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 36,799,660 - 36,814,429 (-) Ensembl
RefSeq Acc Id:
NM_001271058 ⟹ NP_001257987
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 50,269,056 - 50,294,606 (-) NCBI mRatBN7.2 11 36,799,659 - 36,825,209 (-) NCBI Rnor_6.0 11 37,891,150 - 37,916,690 (-) NCBI Rnor_5.0 11 41,398,737 - 41,424,277 (-) NCBI Celera 11 36,686,487 - 36,712,040 (-) NCBI
Sequence:
TGCTCAGCAGCCTAAACTTCGGAGGATTGGTAAGCCCTCTTCCCCCGCTGGTCAGGTGCCTGACCCCAGTGGCAAGGCTTCCAGATTCTTCTGAATCAAACCCTTTATGTCCAACCGAATCCACCTGG
hide sequence
RefSeq Acc Id:
NM_001271059 ⟹ NP_001257988
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 50,269,056 - 50,294,606 (-) NCBI mRatBN7.2 11 36,799,659 - 36,825,209 (-) NCBI Rnor_6.0 11 37,891,150 - 37,916,690 (-) NCBI Rnor_5.0 11 41,398,737 - 41,424,277 (-) NCBI Celera 11 36,686,487 - 36,712,040 (-) NCBI
Sequence:
TGCTCAGCAGCCTAAACTTCGGAGGATTGGGGCGGAGCCAGCACTGTTTAAAGAGCTCTGAGCT
hide sequence
RefSeq Acc Id:
NM_001271060 ⟹ NP_001257989
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 50,269,056 - 50,292,904 (-) NCBI mRatBN7.2 11 36,799,659 - 36,823,507 (-) NCBI Rnor_6.0 11 37,891,150 - 37,914,983 (-) NCBI Rnor_5.0 11 41,398,737 - 41,424,277 (-) NCBI Celera 11 36,686,487 - 36,710,338 (-) NCBI
Sequence:
ACACTCAGTCACCAACCCAGGAGCTGTGAGTATTGCACTGGATTCTGTGGGAGGATAGAGGATACCTTGTAAGGCTCCTTTGCAGACATTGTGCCTGACCCCAGTGGCAAGGCTTCCAGATTCTTCTG
hide sequence
RefSeq Acc Id:
NM_001271061 ⟹ NP_001257990
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 50,269,056 - 50,292,904 (-) NCBI mRatBN7.2 11 36,799,659 - 36,823,507 (-) NCBI Rnor_6.0 11 37,891,150 - 37,914,983 (-) NCBI Rnor_5.0 11 41,398,737 - 41,424,277 (-) NCBI Celera 11 36,686,487 - 36,710,338 (-) NCBI
Sequence:
ACACTCAGTCACCAACCCAGGAGCTTGCCTGACCCCAGTGGCAAGGCTTCCAGATTCTTCTGAA
hide sequence
RefSeq Acc Id:
NM_001271062 ⟹ NP_001257991
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 50,269,056 - 50,292,904 (-) NCBI mRatBN7.2 11 36,799,659 - 36,823,507 (-) NCBI Rnor_6.0 11 37,891,150 - 37,914,983 (-) NCBI Rnor_5.0 11 41,398,737 - 41,424,277 (-) NCBI Celera 11 36,686,487 - 36,710,338 (-) NCBI
Sequence:
ACACTCAGTCACCAACCCAGGAGCTGTGAGTATTGCACTGGATTCTGTGGGAGGATAGAGGATA
hide sequence
RefSeq Acc Id:
NM_173096 ⟹ NP_775119
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 50,269,056 - 50,292,904 (-) NCBI mRatBN7.2 11 36,799,659 - 36,823,507 (-) NCBI Rnor_6.0 11 37,891,150 - 37,914,983 (-) NCBI Rnor_5.0 11 41,398,737 - 41,424,277 (-) NCBI RGSC_v3.4 11 37,438,473 - 37,462,363 (-) RGD Celera 11 36,686,487 - 36,710,338 (-) NCBI
Sequence:
ACACTCAGTCACCAACCCAGGAGCTGTGAGTATTGCACTGGATTCTGTGGGAGGATAGAGGATA
hide sequence
RefSeq Acc Id:
XM_006248146 ⟹ XP_006248208
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 50,269,056 - 50,294,673 (-) NCBI mRatBN7.2 11 36,799,659 - 36,825,171 (-) NCBI Rnor_6.0 11 37,891,150 - 37,916,775 (-) NCBI Rnor_5.0 11 41,398,737 - 41,424,277 (-) NCBI
Sequence:
ATCTTTTTATAAAACACATCGCCAAGACTCTGATTTCGAAACTCCGTTGTTTGCATCCCACCCTGCTTATCACATGGAGATCTAATGCTCAGCAGCCTAAACTTCGGAGGATTGGTAAGCCCTCTTCC
hide sequence
RefSeq Acc Id:
XM_017597877 ⟹ XP_017453366
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 50,269,056 - 50,294,699 (-) NCBI mRatBN7.2 11 36,799,659 - 36,825,170 (-) NCBI Rnor_6.0 11 37,891,150 - 37,916,775 (-) NCBI
Sequence:
ATCTTTTTATAAAACACATCGCCAAGACTCTGATTTCGAAACTCCGTTGTTTGCATCCCACCCT
hide sequence
RefSeq Acc Id:
XM_017597878 ⟹ XP_017453367
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 50,269,056 - 50,293,442 (-) NCBI mRatBN7.2 11 36,799,659 - 36,824,041 (-) NCBI Rnor_6.0 11 37,891,150 - 37,915,203 (-) NCBI
Sequence:
GTTGAAACTACAGTATCAATTTCCAGTGCTCAGGACCAAGCCATGGTCCCCTGAGGGGGCGGAG
hide sequence
RefSeq Acc Id:
XM_039087955 ⟹ XP_038943883
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 50,269,056 - 50,293,455 (-) NCBI mRatBN7.2 11 36,799,659 - 36,824,040 (-) NCBI
RefSeq Acc Id:
XM_039087956 ⟹ XP_038943884
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 50,269,056 - 50,293,442 (-) NCBI mRatBN7.2 11 36,799,659 - 36,824,041 (-) NCBI
RefSeq Acc Id:
XM_063270276 ⟹ XP_063126346
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 50,269,056 - 50,294,646 (-) NCBI
RefSeq Acc Id:
NP_775119 ⟸ NM_173096
- UniProtKB:
P18588 (UniProtKB/Swiss-Prot), Q499S4 (UniProtKB/TrEMBL), F7EXA4 (UniProtKB/TrEMBL)
- Sequence:
MKEQTSACRHQTPQKHPDTSEESQAMESVDNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKQLKQGEKWSGKVIYKDTEIEISHPS
hide sequence
RefSeq Acc Id:
NP_001257988 ⟸ NM_001271059
- UniProtKB:
P18588 (UniProtKB/Swiss-Prot), Q499S4 (UniProtKB/TrEMBL), F7EXA4 (UniProtKB/TrEMBL)
- Sequence:
MKEQTSACRHQTPQKHPDTSEESQAMESVDNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAI
hide sequence
RefSeq Acc Id:
NP_001257987 ⟸ NM_001271058
- UniProtKB:
P18588 (UniProtKB/Swiss-Prot), Q499S4 (UniProtKB/TrEMBL), F7EXA4 (UniProtKB/TrEMBL)
- Sequence:
MKEQTSACRHQTPQKHPDTSEESQAMESVDNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKQLKQGEKWSGKVIYKDTEIEISHPS
hide sequence
RefSeq Acc Id:
NP_001257990 ⟸ NM_001271061
- UniProtKB:
P18588 (UniProtKB/Swiss-Prot), Q499S4 (UniProtKB/TrEMBL), F7EXA4 (UniProtKB/TrEMBL)
- Sequence:
MKEQTSACRHQTPQKHPDTSEESQAMESVDNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAI
hide sequence
RefSeq Acc Id:
NP_001257989 ⟸ NM_001271060
- UniProtKB:
P18588 (UniProtKB/Swiss-Prot), Q499S4 (UniProtKB/TrEMBL), F7EXA4 (UniProtKB/TrEMBL)
- Sequence:
MKEQTSACRHQTPQKHPDTSEESQAMESVDNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKQLKQGEKWSGKVIYKDTEIEISHPS
hide sequence
RefSeq Acc Id:
NP_001257991 ⟸ NM_001271062
- UniProtKB:
P18588 (UniProtKB/Swiss-Prot), Q499S4 (UniProtKB/TrEMBL), F7EXA4 (UniProtKB/TrEMBL)
- Sequence:
MKEQTSACRHQTPQKHPDTSEESQAMESVDNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAI
hide sequence
RefSeq Acc Id:
XP_006248208 ⟸ XM_006248146
- Peptide Label:
isoform X1
- UniProtKB:
P18588 (UniProtKB/Swiss-Prot), Q499S4 (UniProtKB/TrEMBL), F7EXA4 (UniProtKB/TrEMBL)
- Sequence:
MKEQTSACRHQTPQKHPDTSEESQAMESVDNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKQLKQGEKWSGKVIYKDTEIEISHPS
hide sequence
RefSeq Acc Id:
XP_017453366 ⟸ XM_017597877
- Peptide Label:
isoform X1
- UniProtKB:
P18588 (UniProtKB/Swiss-Prot), Q499S4 (UniProtKB/TrEMBL), F7EXA4 (UniProtKB/TrEMBL)
- Sequence:
MKEQTSACRHQTPQKHPDTSEESQAMESVDNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAI
hide sequence
RefSeq Acc Id:
XP_017453367 ⟸ XM_017597878
- Peptide Label:
isoform X1
- UniProtKB:
P18588 (UniProtKB/Swiss-Prot), Q499S4 (UniProtKB/TrEMBL), F7EXA4 (UniProtKB/TrEMBL)
- Sequence:
MKEQTSACRHQTPQKHPDTSEESQAMESVDNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKQLKQGEKWSGKVIYKDTEIEISHPS
hide sequence
Ensembl Acc Id:
ENSRNOP00000043001 ⟸ ENSRNOT00000039876
RefSeq Acc Id:
XP_038943884 ⟸ XM_039087956
- Peptide Label:
isoform X1
- UniProtKB:
P18588 (UniProtKB/Swiss-Prot), Q499S4 (UniProtKB/TrEMBL), F7EXA4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038943883 ⟸ XM_039087955
- Peptide Label:
isoform X1
- UniProtKB:
P18588 (UniProtKB/Swiss-Prot), Q499S4 (UniProtKB/TrEMBL), F7EXA4 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000086162 ⟸ ENSRNOT00000094076
Ensembl Acc Id:
ENSRNOP00000002695 ⟸ ENSRNOT00000002695
Ensembl Acc Id:
ENSRNOP00000091403 ⟸ ENSRNOT00000115496
RefSeq Acc Id:
XP_063126346 ⟸ XM_063270276
- Peptide Label:
isoform X1
- UniProtKB:
P18588 (UniProtKB/Swiss-Prot), F7EXA4 (UniProtKB/TrEMBL), Q499S4 (UniProtKB/TrEMBL)
RGD ID: 13698092 Promoter ID: EPDNEW_R8616 Type: single initiation site Name: Mx1_1 Description: myxovirus resistance 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 11 37,914,983 - 37,915,043 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-18
Mx1
MX dynamin like GTPase 1
Mx1
myxovirus (influenza virus) resistance 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Mx1
myxovirus (influenza virus) resistance 1
myxovirus (influenza virus) resistance
Name updated
1299863 APPROVED
2003-04-09
Mx1
myxovirus (influenza virus) resistance
Myxovirus (influenza) resistance, homolog of murine Mx (also interferon-inducible protein IFI78)
Name updated
629478 APPROVED
2002-06-10
Mx1
Myxovirus (influenza) resistance, homolog of murine Mx (also interferon-inducible protein IFI78)
Symbol and Name status set to approved
70586 APPROVED
