Symbol:
Id1
Name:
inhibitor of DNA binding 1
RGD ID:
2858
Description:
Enables identical protein binding activity and proteasome binding activity. Involved in several processes, including cell-abiotic substrate adhesion; negative regulation of cell differentiation; and regulation of gene expression. Located in centrosome. Used to study pulmonary hypertension. Biomarker of cholestasis. Orthologous to human ID1 (inhibitor of DNA binding 1); PARTICIPATES IN interleukin-3 signaling pathway; transforming growth factor-beta superfamily mediated signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
DNA-binding protein inhibitor ID-1; ID125A; Idb1; inhibitor of differentiation 1; Inhibitor of DNA binding 1 helix-loop-helix protein (splice varaiation); inhibitor of DNA binding 1, dominant negative helix-loop-helix protein; Inhibitor of DNA binding 1, helix-loop-helix protein (splice variation); inhibitor of DNA binding 1, HLH protein; MGC156482
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ID1 (inhibitor of DNA binding 1)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Id1 (inhibitor of DNA binding 1, HLH protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Id1 (inhibitor of DNA binding 1, HLH protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ID1 (inhibitor of DNA binding 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ID1 (inhibitor of DNA binding 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Id1 (inhibitor of DNA binding 1, HLH protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ID1 (inhibitor of DNA binding 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103247994 (DNA-binding protein inhibitor ID-1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Id1 (inhibitor of DNA binding 1, HLH protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ID1 (inhibitor of DNA binding 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Id1 (inhibitor of DNA binding 1, HLH protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
id1 (inhibitor of DNA binding 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
emc
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 161,671,525 - 161,672,691 (+) NCBI GRCr8 mRatBN7.2 3 141,210,666 - 141,212,420 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 141,211,267 - 141,212,419 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 145,116,210 - 145,117,337 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 153,700,048 - 153,701,175 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 151,439,728 - 151,440,855 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 148,214,623 - 148,216,715 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 148,215,540 - 148,216,718 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 154,619,728 - 154,621,190 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 143,086,162 - 143,087,289 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 142,991,791 - 142,992,906 (+) NCBI Celera 3 139,960,608 - 139,961,735 (+) NCBI Celera Cytogenetic Map 3 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Id1 Rat (1->4)-beta-D-glucan multiple interactions ISO Id1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ID1 mRNA CTD PMID:36331819 Id1 Rat (R)-pantothenic acid increases expression ISO ID1 (Homo sapiens) 6480464 Pantothenic Acid results in increased expression of ID1 mRNA CTD PMID:19397697 Id1 Rat (S)-nicotine decreases expression ISO Id1 (Mus musculus) 6480464 Nicotine results in decreased expression of ID1 mRNA CTD PMID:17997037 Id1 Rat 1,4-dioxane increases expression ISO Id1 (Mus musculus) 6480464 1 and 4-dioxane results in increased expression of ID1 mRNA CTD PMID:33693819 Id1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of ID1 mRNA CTD PMID:20551477 Id1 Rat 17alpha-ethynylestradiol affects expression ISO Id1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ID1 mRNA CTD PMID:17555576 Id1 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of ID1 mRNA CTD PMID:12655037 more ... Id1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ID1 mRNA CTD PMID:16174780 Id1 Rat 17alpha-ethynylestradiol increases expression ISO Id1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ID1 mRNA CTD PMID:16174780 and PMID:17942748 Id1 Rat 17alpha-ethynylestradiol multiple interactions ISO Id1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ID1 mRNA CTD PMID:17942748 Id1 Rat 17beta-estradiol multiple interactions ISO ID1 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of ID1 mRNA and [Estradiol co-treated with TGFB1 protein] results in decreased expression of ID1 mRNA CTD PMID:19619570 and PMID:30165855 Id1 Rat 17beta-estradiol decreases expression ISO Id1 (Mus musculus) 6480464 Estradiol results in decreased expression of ID1 mRNA CTD PMID:39298647 Id1 Rat 17beta-estradiol multiple interactions ISO Id1 (Mus musculus) 6480464 fulvestrant inhibits the reaction [Estradiol results in increased expression of ID1 mRNA] CTD PMID:20031206 Id1 Rat 17beta-estradiol increases expression ISO Id1 (Mus musculus) 6480464 Estradiol results in increased expression of ID1 mRNA CTD PMID:20031206 Id1 Rat 17beta-estradiol decreases expression ISO ID1 (Homo sapiens) 6480464 Estradiol results in decreased expression of ID1 mRNA CTD PMID:23019147 Id1 Rat 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with Testosterone] results in increased expression of ID1 mRNA and [Estradiol co-treated with Testosterone] results in increased expression of ID1 protein CTD PMID:11375906 Id1 Rat 17beta-estradiol affects expression ISO Id1 (Mus musculus) 6480464 Estradiol affects the expression of ID1 mRNA CTD PMID:15598610 Id1 Rat 17beta-estradiol increases expression ISO ID1 (Homo sapiens) 6480464 Estradiol results in increased expression of ID1 mRNA CTD PMID:19619570 Id1 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO ID1 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of ID1 mRNA CTD PMID:16541417 Id1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Id1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ID1 mRNA CTD PMID:21570461 more ... Id1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ID1 mRNA CTD PMID:33387578 Id1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Id1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ID1 mRNA CTD PMID:18691609 more ... Id1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Id1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ID1 mRNA CTD PMID:15591033 more ... Id1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ID1 mRNA CTD PMID:21215274 and PMID:34747641 Id1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO ID1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ID1 mRNA CTD PMID:17257637 more ... Id1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Id1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ID1 mRNA and Tetrachlorodibenzodioxin inhibits the reaction [EGF protein results in increased expression of ID1 mRNA] CTD PMID:15667827 and PMID:17942748 Id1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO ID1 (Homo sapiens) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of ID1 mRNA] and [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of ID1 mRNA CTD PMID:19619570 and PMID:29704546 Id1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO ID1 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Id1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Id1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Id1 Rat 2-acetamidofluorene increases expression ISO ID1 (Homo sapiens) 6480464 2-Acetylaminofluorene results in increased expression of ID1 mRNA CTD PMID:15120964 Id1 Rat 2-amino-2-deoxy-D-glucopyranose increases expression ISO Id1 (Mus musculus) 6480464 Glucosamine results in increased expression of ID1 mRNA CTD PMID:17178593 Id1 Rat 2-hydroxypropanoic acid decreases expression ISO ID1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ID1 mRNA CTD PMID:30851411 Id1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Id1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO Id1 (Mus musculus) 6480464 3 more ... CTD PMID:23994337 Id1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ID1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ID1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ID1 mRNA CTD PMID:28628672 Id1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Id1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of ID1 mRNA CTD PMID:18648102 Id1 Rat 4,4'-sulfonyldiphenol increases expression ISO ID1 (Homo sapiens) 6480464 bisphenol S results in increased expression of ID1 mRNA CTD PMID:25912373 Id1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Id1 (Mus musculus) 6480464 bisphenol S results in decreased expression of ID1 mRNA CTD PMID:39298647 Id1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO ID1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ID1 mRNA CTD PMID:28628672 Id1 Rat 4-hydroxynon-2-enal decreases expression ISO Id1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of ID1 mRNA CTD PMID:19191707 Id1 Rat 4-hydroxynon-2-enal decreases expression ISO ID1 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of ID1 mRNA CTD PMID:12419474 Id1 Rat 4-hydroxyphenyl retinamide increases expression ISO Id1 (Mus musculus) 6480464 Fenretinide results in increased expression of ID1 mRNA CTD PMID:28973697 Id1 Rat 4-phenylbutyric acid decreases expression ISO ID1 (Homo sapiens) 6480464 4-phenylbutyric acid results in decreased expression of ID1 mRNA CTD PMID:14583596 Id1 Rat 5-aza-2'-deoxycytidine increases expression ISO ID1 (Homo sapiens) 6480464 Decitabine results in increased expression of ID1 mRNA CTD PMID:19194470 Id1 Rat 5-azacytidine increases expression ISO ID1 (Homo sapiens) 6480464 Azacitidine results in increased expression of ID1 mRNA CTD PMID:19194470 Id1 Rat 5-fluorouracil increases expression ISO ID1 (Homo sapiens) 6480464 Fluorouracil results in increased expression of ID1 mRNA CTD PMID:16557594 Id1 Rat 5-fluorouracil multiple interactions ISO ID1 (Homo sapiens) 6480464 TP53 protein promotes the reaction [Fluorouracil results in increased expression of ID1 mRNA] CTD PMID:16557594 Id1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ID1 mRNA CTD PMID:25825206 and PMID:30047161 Id1 Rat 8-Br-cAMP decreases expression ISO ID1 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of ID1 mRNA CTD PMID:22079614 Id1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ID1 mRNA CTD PMID:31881176 Id1 Rat Actein decreases expression EXP 6480464 actein results in decreased expression of ID1 protein CTD PMID:29969672 Id1 Rat actinomycin D multiple interactions ISO ID1 (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [Tretinoin results in increased expression of ID1 mRNA] CTD PMID:16494909 Id1 Rat aflatoxin B1 affects expression ISO ID1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of ID1 protein CTD PMID:20106945 Id1 Rat aflatoxin B1 increases expression ISO ID1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of ID1 mRNA CTD PMID:15120964 more ... Id1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ID1 mRNA CTD PMID:23630614 more ... Id1 Rat aldehydo-D-glucosamine increases expression ISO Id1 (Mus musculus) 6480464 Glucosamine results in increased expression of ID1 mRNA CTD PMID:17178593 Id1 Rat aldehydo-D-glucose increases expression ISO Id1 (Mus musculus) 6480464 Glucose results in increased expression of ID1 mRNA CTD PMID:17178593 Id1 Rat aldrin decreases expression ISO Id1 (Mus musculus) 6480464 Aldrin results in decreased expression of ID1 mRNA CTD PMID:18579281 Id1 Rat all-trans-retinoic acid multiple interactions ISO ID1 (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [Tretinoin results in increased expression of ID1 mRNA] CTD PMID:16494909 Id1 Rat all-trans-retinoic acid increases expression ISO ID1 (Homo sapiens) 6480464 Tretinoin results in increased expression of ID1 mRNA and Tretinoin results in increased expression of ID1 protein CTD PMID:16054129 more ... Id1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ID1 mRNA CTD PMID:35163327 Id1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of ID1 mRNA CTD PMID:30047161 Id1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ID1 mRNA CTD PMID:16483693 Id1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of ID1 mRNA CTD PMID:30779732 Id1 Rat angiotensin II increases expression ISO Id1 (Mus musculus) 11526363 angiotensin II increases expression of mRNA in mouse heart RGD Id1 Rat antimonite multiple interactions ISO ID1 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in decreased expression of ID1 mRNA CTD PMID:32076005 Id1 Rat Archazolid B decreases expression ISO ID1 (Homo sapiens) 6480464 archazolid B results in decreased expression of ID1 mRNA CTD PMID:25218289 Id1 Rat aristolochic acid A decreases expression ISO ID1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ID1 mRNA CTD PMID:33212167 Id1 Rat arsane affects expression EXP 6480464 Arsenic affects the expression of ID1 mRNA CTD PMID:18315880 Id1 Rat arsane multiple interactions ISO ID1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ID1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ID1 mRNA CTD PMID:39836092 Id1 Rat arsane increases expression EXP 6480464 Arsenic results in increased expression of ID1 mRNA CTD PMID:18315880 Id1 Rat arsenic atom affects expression EXP 6480464 Arsenic affects the expression of ID1 mRNA CTD PMID:18315880 Id1 Rat arsenic atom multiple interactions ISO ID1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ID1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ID1 mRNA CTD PMID:39836092 Id1 Rat arsenic atom increases expression EXP 6480464 Arsenic results in increased expression of ID1 mRNA CTD PMID:18315880 Id1 Rat arsenite(3-) multiple interactions ISO ID1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of arsenite] which results in decreased expression of ID1 mRNA CTD PMID:32076005 Id1 Rat arsenous acid increases expression ISO ID1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ID1 mRNA CTD PMID:15761015 Id1 Rat arsenous acid multiple interactions ISO ID1 (Homo sapiens) 6480464 ID1 protein inhibits the reaction [Arsenic Trioxide results in decreased expression of BCL2 protein] more ... CTD PMID:31079498 Id1 Rat arsenous acid decreases expression ISO ID1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ID1 mRNA CTD PMID:31079498 Id1 Rat arsenous acid decreases response to substance ISO ID1 (Homo sapiens) 6480464 ID1 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Id1 Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of ID1 mRNA CTD PMID:36841081 Id1 Rat avobenzone decreases expression ISO ID1 (Homo sapiens) 6480464 avobenzone results in decreased expression of ID1 mRNA CTD PMID:31016361 Id1 Rat azoxystrobin decreases expression ISO ID1 (Homo sapiens) 6480464 azoxystrobin results in decreased expression of ID1 mRNA CTD PMID:33512557 Id1 Rat benzalkonium chloride increases expression ISO ID1 (Homo sapiens) 6480464 Benzalkonium Compounds results in increased expression of ID1 mRNA CTD PMID:37149095 Id1 Rat benzo[a]pyrene decreases expression ISO ID1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ID1 mRNA CTD PMID:20106945 Id1 Rat benzo[a]pyrene decreases expression ISO Id1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ID1 mRNA CTD PMID:27195522 Id1 Rat benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with 1 more ... CTD PMID:18711122 Id1 Rat benzo[a]pyrene increases expression ISO ID1 (Homo sapiens) 6480464 Benzo(a)pyrene metabolite results in increased expression of ID1 mRNA and Benzo(a)pyrene results in increased expression of ID1 mRNA CTD PMID:16269432 more ... Id1 Rat benzo[a]pyrene increases expression ISO Id1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ID1 mRNA CTD PMID:21569818 more ... Id1 Rat benzo[a]pyrene multiple interactions ISO Id1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ID1 mRNA and AHR protein affects the reaction [Benzo(a)pyrene affects the expression of ID1 mRNA] CTD PMID:22228805 and PMID:27858113 Id1 Rat benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benzo(b)fluoranthene] affects the expression of ID1 mRNA CTD PMID:18711122 Id1 Rat benzo[b]fluoranthene multiple interactions ISO Id1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ID1 mRNA CTD PMID:27858113 Id1 Rat benzo[b]fluoranthene increases expression ISO Id1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of ID1 mRNA CTD PMID:26377693 Id1 Rat beta-D-glucosamine increases expression ISO Id1 (Mus musculus) 6480464 Glucosamine results in increased expression of ID1 mRNA CTD PMID:17178593 Id1 Rat beta-naphthoflavone decreases expression ISO Id1 (Mus musculus) 6480464 beta-Naphthoflavone results in decreased expression of ID1 mRNA CTD PMID:23994337 Id1 Rat bexarotene increases expression ISO ID1 (Homo sapiens) 6480464 bexarotene results in increased expression of ID1 mRNA and bexarotene results in increased expression of ID1 protein CTD PMID:17178900 Id1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Id1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ID1 mRNA CTD PMID:19850644 and PMID:33754040 Id1 Rat bis(2-ethylhexyl) phthalate increases expression ISO ID1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of ID1 protein CTD PMID:31163220 Id1 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of ID1 mRNA CTD PMID:26472102 Id1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Id1 (Mus musculus) 6480464 PPARA protein inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of ID1 mRNA] CTD PMID:19850644 Id1 Rat bisphenol A decreases expression ISO ID1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ID1 mRNA CTD PMID:26363213 and PMID:36232920 Id1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ID1 mRNA CTD PMID:34947998 Id1 Rat bisphenol A increases expression ISO ID1 (Homo sapiens) 6480464 bisphenol A results in increased expression of ID1 mRNA CTD PMID:25912373 Id1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ID1 mRNA CTD PMID:25181051 Id1 Rat bisphenol AF increases expression ISO ID1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ID1 mRNA CTD PMID:25912373 Id1 Rat bisphenol F multiple interactions ISO ID1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ID1 mRNA CTD PMID:28628672 Id1 Rat bisphenol F increases expression ISO Id1 (Mus musculus) 6480464 bisphenol F results in increased expression of ID1 mRNA CTD PMID:38685157 Id1 Rat bucladesine increases expression ISO ID1 (Homo sapiens) 6480464 Bucladesine results in increased expression of ID1 protein CTD PMID:20522807 Id1 Rat bucladesine multiple interactions ISO ID1 (Homo sapiens) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Bucladesine results in increased expression of ID1 mRNA] CTD PMID:20522807 Id1 Rat butan-1-ol multiple interactions ISO ID1 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of ID1 mRNA CTD PMID:29432896 Id1 Rat Butylbenzyl phthalate decreases expression EXP 6480464 butylbenzyl phthalate results in decreased expression of ID1 mRNA CTD PMID:26472102 Id1 Rat butyric acid increases expression ISO ID1 (Homo sapiens) 6480464 Butyric Acid results in increased expression of ID1 mRNA CTD PMID:34581912 Id1 Rat cadmium dichloride multiple interactions ISO ID1 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of ID1 mRNA CTD PMID:12634122 Id1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of ID1 mRNA CTD PMID:31077537 Id1 Rat cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride co-treated with diallyl disulfide] results in increased expression of ID1 mRNA CTD PMID:31077537 Id1 Rat cadmium dichloride decreases expression ISO ID1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ID1 mRNA CTD PMID:26314618 Id1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ID1 mRNA CTD PMID:18636176 Id1 Rat cadmium sulfate decreases expression ISO ID1 (Homo sapiens) 6480464 cadmium sulfate results in decreased expression of ID1 mRNA CTD PMID:21783983 Id1 Rat candesartan decreases expression EXP 6480464 candesartan results in decreased expression of ID1 mRNA CTD PMID:14871019 Id1 Rat cannabidiol decreases expression ISO Id1 (Mus musculus) 6480464 Cannabidiol results in decreased expression of ID1 mRNA and Cannabidiol results in decreased expression of ID1 protein CTD PMID:21542829 and PMID:24910342 Id1 Rat cannabidiol decreases expression ISO ID1 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of ID1 protein CTD PMID:24910342 Id1 Rat cannabidiol affects response to substance ISO ID1 (Homo sapiens) 6480464 ID1 protein affects the susceptibility to Cannabidiol CTD PMID:24910342 Id1 Rat cannabidiolic acid decreases expression ISO ID1 (Homo sapiens) 6480464 cannabidiolic acid results in decreased expression of ID1 mRNA CTD PMID:25242400 Id1 Rat carbamazepine affects expression ISO ID1 (Homo sapiens) 6480464 Carbamazepine affects the expression of ID1 mRNA CTD PMID:25979313 Id1 Rat carbon nanotube increases expression ISO Id1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Id1 Rat carbon nanotube decreases expression ISO Id1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Id1 Rat carbon nanotube decreases expression ISO ID1 (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased expression of ID1 mRNA CTD PMID:24389112 Id1 Rat celastrol increases expression ISO ID1 (Homo sapiens) 6480464 celastrol results in increased expression of ID1 mRNA CTD PMID:39181414 Id1 Rat chloropicrin decreases expression ISO ID1 (Homo sapiens) 6480464 chloropicrin results in decreased expression of ID1 mRNA CTD PMID:26352163 Id1 Rat chlorpyrifos increases expression ISO Id1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ID1 mRNA CTD PMID:37019170 Id1 Rat choline multiple interactions ISO Id1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ID1 mRNA CTD PMID:20938992 Id1 Rat chromium(6+) decreases expression ISO ID1 (Homo sapiens) 6480464 chromium hexavalent ion results in decreased expression of ID1 mRNA CTD PMID:30690063 Id1 Rat chrysene multiple interactions ISO Id1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ID1 mRNA CTD PMID:27858113 Id1 Rat ciguatoxin CTX1B affects expression ISO Id1 (Mus musculus) 6480464 Ciguatoxins affects the expression of ID1 mRNA CTD PMID:18353800 Id1 Rat cisplatin multiple interactions ISO ID1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of ID1 mRNA CTD PMID:27392435 Id1 Rat cisplatin increases expression ISO ID1 (Homo sapiens) 6480464 Cisplatin results in increased expression of ID1 mRNA CTD PMID:27392435 and PMID:33545341 Id1 Rat clobetasol increases expression ISO Id1 (Mus musculus) 6480464 Clobetasol results in increased expression of ID1 mRNA CTD PMID:27462272 Id1 Rat clofibrate multiple interactions ISO Id1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ID1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ID1 mRNA] CTD PMID:17585979 Id1 Rat clofibrate increases expression ISO Id1 (Mus musculus) 6480464 Clofibrate results in increased expression of ID1 mRNA CTD PMID:23811191 Id1 Rat clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of ID1 mRNA CTD PMID:12851107 Id1 Rat clofibrate decreases expression ISO Id1 (Mus musculus) 6480464 Clofibrate results in decreased expression of ID1 mRNA CTD PMID:17585979 Id1 Rat cobalt dichloride decreases expression ISO ID1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ID1 mRNA CTD PMID:19320972 Id1 Rat copper(II) chloride decreases expression ISO ID1 (Homo sapiens) 6480464 cupric chloride results in decreased expression of ID1 mRNA CTD PMID:38568856 Id1 Rat copper(II) sulfate decreases expression ISO ID1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ID1 mRNA CTD PMID:19549813 Id1 Rat crocidolite asbestos decreases expression ISO Id1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of ID1 protein CTD PMID:17975199 Id1 Rat crocidolite asbestos increases expression ISO Id1 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of ID1 mRNA CTD PMID:19446018 Id1 Rat crocidolite asbestos decreases expression ISO ID1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of ID1 mRNA CTD PMID:25757056 Id1 Rat crotonaldehyde decreases expression ISO ID1 (Homo sapiens) 6480464 2-butenal results in decreased expression of ID1 mRNA CTD PMID:20471460 Id1 Rat curcumin decreases expression ISO ID1 (Homo sapiens) 6480464 Curcumin results in decreased expression of ID1 mRNA CTD PMID:21594647 Id1 Rat cyclosporin A decreases expression ISO ID1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ID1 mRNA CTD PMID:20106945 more ... Id1 Rat D-glucose increases expression ISO Id1 (Mus musculus) 6480464 Glucose results in increased expression of ID1 mRNA CTD PMID:17178593 Id1 Rat DDE increases expression ISO ID1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of ID1 mRNA CTD PMID:38568856 Id1 Rat deguelin decreases expression ISO ID1 (Homo sapiens) 6480464 deguelin results in decreased expression of ID1 mRNA CTD PMID:33512557 Id1 Rat deoxynivalenol decreases expression ISO ID1 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of ID1 mRNA CTD PMID:31863870 Id1 Rat dexamethasone decreases expression ISO ID1 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of ID1 mRNA CTD PMID:25047013 Id1 Rat dexamethasone multiple interactions ISO ID1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ID1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ID1 mRNA CTD PMID:28628672 Id1 Rat diallyl disulfide multiple interactions EXP 6480464 [Cadmium Chloride co-treated with diallyl disulfide] results in increased expression of ID1 mRNA CTD PMID:31077537 Id1 Rat diallyl disulfide increases expression EXP 6480464 diallyl disulfide results in increased expression of ID1 mRNA CTD PMID:31077537 Id1 Rat diarsenic trioxide increases expression ISO ID1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ID1 mRNA CTD PMID:15761015 Id1 Rat diarsenic trioxide decreases expression ISO ID1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ID1 mRNA CTD PMID:31079498 Id1 Rat diarsenic trioxide multiple interactions ISO ID1 (Homo sapiens) 6480464 ID1 protein inhibits the reaction [Arsenic Trioxide results in decreased expression of BCL2 protein] more ... CTD PMID:31079498 Id1 Rat diarsenic trioxide decreases response to substance ISO ID1 (Homo sapiens) 6480464 ID1 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Id1 Rat dibenz[a,h]anthracene multiple interactions EXP 6480464 [1 more ... CTD PMID:18711122 Id1 Rat dibenz[a,h]anthracene increases expression ISO Id1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Id1 Rat dibenzo[a,l]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with dibenzo(a and l)pyrene] affects the expression of ID1 mRNA CTD PMID:18711122 Id1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of ID1 mRNA CTD PMID:26472102 Id1 Rat dichromium trioxide multiple interactions ISO ID1 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of ID1 mRNA CTD PMID:12634122 Id1 Rat dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of ID1 mRNA CTD PMID:26476374 Id1 Rat dioxygen decreases expression ISO ID1 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of ID1 mRNA CTD PMID:26516004 Id1 Rat dioxygen multiple interactions EXP 6480464 Quercetin inhibits the reaction [Oxygen deficiency results in increased expression of ID1 mRNA] CTD PMID:26476374 Id1 Rat dipentyl phthalate decreases expression EXP 6480464 di-n-pentyl phthalate results in decreased expression of ID1 mRNA CTD PMID:26472102 Id1 Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate multiple interactions ISO ID1 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in decreased expression of ID1 mRNA CTD PMID:32076005 Id1 Rat diquat increases expression ISO Id1 (Mus musculus) 6480464 Diquat results in increased expression of ID1 mRNA CTD PMID:36851058 Id1 Rat dorsomorphin multiple interactions ISO ID1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Id1 Rat doxorubicin increases expression ISO ID1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of ID1 mRNA CTD PMID:29803840 and PMID:30031762 Id1 Rat elemental selenium increases expression ISO ID1 (Homo sapiens) 6480464 Selenium results in increased expression of ID1 mRNA CTD PMID:19244175 Id1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of ID1 mRNA CTD PMID:29391264 Id1 Rat epoxiconazole decreases expression ISO Id1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of ID1 mRNA CTD PMID:35436446 Id1 Rat ethane increases expression ISO ID1 (Homo sapiens) 6480464 Ethane results in increased expression of ID1 mRNA CTD PMID:33064461 Id1 Rat ethanol multiple interactions ISO ID1 (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of ID1 mRNA CTD PMID:29432896 Id1 Rat fenpyroximate decreases expression ISO ID1 (Homo sapiens) 6480464 fenpyroximate results in decreased expression of ID1 mRNA CTD PMID:33512557 Id1 Rat ferric oxide increases expression ISO Id1 (Mus musculus) 6480464 ferric oxide analog results in increased expression of ID1 mRNA CTD PMID:24525745 Id1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of ID1 mRNA CTD PMID:18035473 Id1 Rat fluoranthene multiple interactions EXP 6480464 [1 more ... CTD PMID:18711122 Id1 Rat fluoranthene decreases expression ISO Id1 (Mus musculus) 6480464 fluoranthene results in decreased expression of ID1 mRNA CTD PMID:28329830 Id1 Rat folic acid affects expression ISO ID1 (Homo sapiens) 6480464 Folic Acid affects the expression of ID1 mRNA CTD PMID:17320366 Id1 Rat folic acid decreases expression ISO ID1 (Homo sapiens) 6480464 Folic Acid results in decreased expression of ID1 mRNA CTD PMID:21867686 Id1 Rat folic acid multiple interactions ISO Id1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ID1 mRNA CTD PMID:20938992 Id1 Rat formaldehyde decreases expression ISO ID1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of ID1 mRNA CTD PMID:20655997 Id1 Rat formaldehyde increases expression ISO ID1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of ID1 mRNA CTD PMID:27664576 Id1 Rat fulvestrant multiple interactions ISO Id1 (Mus musculus) 6480464 fulvestrant inhibits the reaction [Estradiol results in increased expression of ID1 mRNA] CTD PMID:20031206 Id1 Rat furan increases expression ISO Id1 (Mus musculus) 6480464 furan results in increased expression of ID1 mRNA CTD PMID:24183702 Id1 Rat furosemide decreases expression EXP 6480464 Furosemide results in decreased expression of ID1 mRNA CTD PMID:16526316 Id1 Rat gamma-hexachlorocyclohexane decreases expression ISO ID1 (Homo sapiens) 6480464 Hexachlorocyclohexane results in decreased expression of ID1 mRNA CTD PMID:24356939 Id1 Rat genistein decreases expression ISO ID1 (Homo sapiens) 6480464 Genistein results in decreased expression of ID1 mRNA and Genistein results in decreased expression of ID1 protein CTD PMID:21554132 and PMID:23019147 Id1 Rat genistein increases expression ISO ID1 (Homo sapiens) 6480464 Genistein results in increased expression of ID1 mRNA CTD PMID:22228119 Id1 Rat genistein decreases expression EXP 6480464 Genistein results in decreased expression of ID1 mRNA CTD PMID:21782745 Id1 Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of ID1 mRNA CTD PMID:21782745 Id1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ID1 mRNA CTD PMID:33387578 Id1 Rat geraniol increases expression ISO ID1 (Homo sapiens) 6480464 geraniol results in increased expression of ID1 mRNA CTD PMID:27683099 Id1 Rat glucose increases expression ISO Id1 (Mus musculus) 6480464 Glucose results in increased expression of ID1 mRNA CTD PMID:17178593 Id1 Rat gossypol decreases expression ISO ID1 (Homo sapiens) 6480464 Gossypol results in decreased expression of ID1 mRNA CTD PMID:19825521 Id1 Rat gossypol multiple interactions ISO ID1 (Homo sapiens) 6480464 zoledronic acid promotes the reaction [Gossypol results in decreased expression of ID1 mRNA] CTD PMID:19825521 Id1 Rat hydrogen peroxide affects expression ISO ID1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of ID1 mRNA CTD PMID:20044591 Id1 Rat hydrogen peroxide decreases expression ISO ID1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of ID1 mRNA CTD PMID:12419474 Id1 Rat hydroquinone increases expression ISO ID1 (Homo sapiens) 6480464 hydroquinone results in increased expression of ID1 mRNA CTD PMID:31256213 Id1 Rat icariin increases expression ISO Id1 (Mus musculus) 6480464 icariin results in increased expression of ID1 mRNA CTD PMID:18295595 Id1 Rat iloprost multiple interactions ISO ID1 (Homo sapiens) 6480464 Iloprost inhibits the reaction [BMPR2 gene mutant form results in decreased expression of ID1 protein] more ... CTD PMID:20522807 Id1 Rat iloprost increases expression ISO ID1 (Homo sapiens) 6480464 Iloprost results in increased expression of ID1 mRNA and Iloprost results in increased expression of ID1 protein CTD PMID:20522807 Id1 Rat indometacin multiple interactions ISO ID1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ID1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ID1 mRNA CTD PMID:28628672 Id1 Rat inulin multiple interactions ISO Id1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ID1 mRNA CTD PMID:36331819 Id1 Rat iron dichloride decreases expression ISO ID1 (Homo sapiens) 6480464 ferrous chloride results in decreased expression of ID1 mRNA CTD PMID:35984750 Id1 Rat isoprenaline decreases expression ISO Id1 (Mus musculus) 6480464 Isoproterenol results in decreased expression of ID1 mRNA CTD PMID:21335049 Id1 Rat isoprenaline increases expression EXP 11526363 isoprenaline increases expression of mRNA in neonatal rat cardiomyocytes RGD Id1 Rat L-methionine multiple interactions ISO Id1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ID1 mRNA CTD PMID:20938992 Id1 Rat lead diacetate multiple interactions ISO ID1 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of ID1 mRNA CTD PMID:12634122 Id1 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of ID1 mRNA CTD PMID:24136188 Id1 Rat leflunomide increases expression ISO ID1 (Homo sapiens) 6480464 leflunomide results in increased expression of ID1 mRNA CTD PMID:28988120 Id1 Rat lipopolysaccharide increases expression ISO ID1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of ID1 mRNA CTD PMID:26667767 Id1 Rat lipopolysaccharide decreases expression ISO ID1 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of ID1 mRNA CTD PMID:35811015 Id1 Rat lipopolysaccharide multiple interactions ISO ID1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:26667767 and PMID:35811015 Id1 Rat manganese atom multiple interactions ISO ID1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ID1 mRNA CTD PMID:39836092 Id1 Rat manganese(0) multiple interactions ISO ID1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ID1 mRNA CTD PMID:39836092 Id1 Rat manganese(II) chloride increases expression ISO Id1 (Mus musculus) 6480464 manganese chloride results in increased expression of ID1 mRNA CTD PMID:17467022 Id1 Rat manganese(II) chloride multiple interactions ISO ID1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ID1 mRNA CTD PMID:39836092 Id1 Rat menadione affects expression ISO ID1 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of ID1 mRNA CTD PMID:20044591 Id1 Rat mercury dibromide increases expression ISO ID1 (Homo sapiens) 6480464 mercuric bromide results in increased expression of ID1 mRNA CTD PMID:26272509 Id1 Rat mercury dibromide multiple interactions ISO ID1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ID1 mRNA CTD PMID:27188386 Id1 Rat methamphetamine decreases expression ISO ID1 (Homo sapiens) 6480464 Methamphetamine results in decreased expression of ID1 mRNA CTD PMID:25290377 Id1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of ID1 mRNA CTD PMID:30047161 Id1 Rat methotrexate affects expression ISO Id1 (Mus musculus) 6480464 Methotrexate affects the expression of ID1 mRNA CTD PMID:18502557 Id1 Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of ID1 mRNA CTD PMID:21782745 Id1 Rat methoxychlor decreases expression EXP 6480464 Methoxychlor results in decreased expression of ID1 mRNA CTD PMID:21782745 Id1 Rat methylmercury chloride increases expression ISO ID1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of ID1 mRNA CTD PMID:26272509 and PMID:34089799 Id1 Rat methylmercury chloride multiple interactions ISO ID1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ID1 mRNA CTD PMID:27188386 Id1 Rat methylseleninic acid decreases expression ISO ID1 (Homo sapiens) 6480464 methylselenic acid results in decreased expression of ID1 mRNA CTD PMID:12517777 Id1 Rat mono(2-ethylhexyl) phthalate decreases expression ISO ID1 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of ID1 mRNA CTD PMID:22321834 Id1 Rat monocrotaline decreases expression EXP 6480464 Monocrotaline results in decreased expression of ID1 mRNA CTD PMID:20522807 Id1 Rat monocrotaline multiple interactions EXP 6480464 treprostinil inhibits the reaction [Monocrotaline results in decreased expression of ID1 mRNA] CTD PMID:20522807 Id1 Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of ID1 mRNA CTD PMID:21515302 Id1 Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO ID1 (Homo sapiens) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Bucladesine results in increased expression of ID1 mRNA] and N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Iloprost results in increased expression of ID1 mRNA] CTD PMID:20522807 Id1 Rat N-ethyl-N-nitrosourea increases expression EXP 6480464 Ethylnitrosourea results in increased expression of ID1 mRNA CTD PMID:15954086 Id1 Rat N-methyl-4-phenylpyridinium decreases expression ISO ID1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of ID1 mRNA CTD PMID:24810058 Id1 Rat N-methyl-4-phenylpyridinium decreases methylation EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased methylation of ID1 gene CTD PMID:28801915 Id1 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of ID1 mRNA CTD PMID:28801915 Id1 Rat N-methyl-N'-nitro-N-nitrosoguanidine decreases expression ISO ID1 (Homo sapiens) 6480464 Methylnitronitrosoguanidine results in decreased expression of ID1 mRNA CTD PMID:12634122 Id1 Rat N-nitrosodiethylamine increases expression ISO Id1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of ID1 mRNA CTD PMID:24535843 Id1 Rat N-nitrosodimethylamine increases expression ISO ID1 (Homo sapiens) 6480464 Dimethylnitrosamine results in increased expression of ID1 mRNA CTD PMID:15120964 Id1 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of ID1 mRNA CTD PMID:19716841 Id1 Rat nickel atom increases expression ISO ID1 (Homo sapiens) 6480464 Nickel results in increased expression of ID1 mRNA CTD PMID:23195993 Id1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of ID1 mRNA CTD PMID:22110744 Id1 Rat nickel sulfate increases expression ISO ID1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of ID1 mRNA CTD PMID:18651567 Id1 Rat niclosamide increases expression ISO ID1 (Homo sapiens) 6480464 Niclosamide results in increased expression of ID1 mRNA CTD PMID:36318118 Id1 Rat nicotine decreases expression ISO Id1 (Mus musculus) 6480464 Nicotine results in decreased expression of ID1 mRNA CTD PMID:17997037 Id1 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of ID1 mRNA CTD PMID:12700408 and PMID:17483316 Id1 Rat octreotide multiple interactions ISO ID1 (Homo sapiens) 6480464 Octreotide promotes the reaction [BMP2 protein results in increased expression of ID1 mRNA] more ... CTD PMID:23137853 Id1 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of ID1 mRNA CTD PMID:23665939 Id1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of ID1 mRNA CTD PMID:25729387 Id1 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of ID1 mRNA CTD PMID:16330353 Id1 Rat ozone multiple interactions ISO Id1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of ID1 mRNA CTD PMID:34911549 Id1 Rat ozone increases expression ISO ID1 (Homo sapiens) 6480464 Ozone results in increased expression of ID1 mRNA CTD PMID:23033980 Id1 Rat p-chloromercuribenzoic acid increases expression ISO ID1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of ID1 mRNA CTD PMID:26272509 Id1 Rat p-chloromercuribenzoic acid multiple interactions ISO ID1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ID1 mRNA CTD PMID:27188386 Id1 Rat panaxydol decreases expression ISO ID1 (Homo sapiens) 6480464 panaxydol results in decreased expression of ID1 mRNA CTD PMID:19450571 Id1 Rat paracetamol multiple interactions ISO Id1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ID1 mRNA more ... CTD PMID:17585979 and PMID:29246445 Id1 Rat paracetamol increases expression ISO Id1 (Mus musculus) 6480464 Acetaminophen results in increased expression of ID1 mRNA CTD PMID:29246445 Id1 Rat paracetamol decreases expression ISO ID1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ID1 mRNA CTD PMID:21420995 Id1 Rat paracetamol increases expression ISO ID1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ID1 mRNA CTD PMID:15120964 Id1 Rat paracetamol affects expression ISO Id1 (Mus musculus) 6480464 Acetaminophen affects the expression of ID1 mRNA CTD PMID:17562736 Id1 Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of ID1 mRNA CTD PMID:16854511 Id1 Rat pasireotide multiple interactions ISO ID1 (Homo sapiens) 6480464 pasireotide promotes the reaction [BMP2 protein results in increased expression of ID1 mRNA] more ... CTD PMID:23137853 Id1 Rat perfluorohexanesulfonic acid increases expression ISO Id1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of ID1 mRNA CTD PMID:38458531 Id1 Rat perfluorononanoic acid decreases expression ISO ID1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of ID1 mRNA CTD PMID:38568856 Id1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Id1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ID1 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ID1 mRNA CTD PMID:36331819 Id1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of ID1 mRNA CTD PMID:19162173 and PMID:35163327 Id1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ID1 mRNA CTD PMID:35163327 Id1 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of ID1 mRNA CTD PMID:18158353 Id1 Rat phenylephrine increases expression EXP 11526363 phenylephrine increases expression of mRNA in neonatal rat cardiomyocytes RGD Id1 Rat phenylmercury acetate increases expression ISO ID1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of ID1 mRNA CTD PMID:26272509 Id1 Rat phenylmercury acetate multiple interactions ISO ID1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ID1 mRNA CTD PMID:27188386 Id1 Rat phlorizin decreases expression ISO Id1 (Mus musculus) 6480464 Phlorhizin results in decreased expression of ID1 mRNA CTD PMID:16123366 Id1 Rat picoxystrobin decreases expression ISO ID1 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of ID1 mRNA CTD PMID:33512557 Id1 Rat pirinixic acid multiple interactions ISO ID1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of ID1 mRNA CTD PMID:19710929 Id1 Rat pirinixic acid increases expression ISO Id1 (Mus musculus) 6480464 pirinixic acid results in increased expression of ID1 mRNA CTD PMID:18301758 more ... Id1 Rat pomalidomide increases expression ISO ID1 (Homo sapiens) 6480464 pomalidomide results in increased expression of ID1 mRNA CTD PMID:15292067 Id1 Rat potassium chromate decreases expression ISO ID1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ID1 mRNA CTD PMID:22714537 Id1 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of ID1 mRNA CTD PMID:19162173 Id1 Rat progesterone increases expression ISO ID1 (Homo sapiens) 6480464 Progesterone results in increased expression of ID1 mRNA CTD PMID:18037150 Id1 Rat progesterone decreases expression ISO Id1 (Mus musculus) 6480464 Progesterone results in decreased expression of ID1 mRNA CTD PMID:22238285 Id1 Rat progesterone decreases expression ISO ID1 (Homo sapiens) 6480464 Progesterone results in decreased expression of ID1 protein CTD PMID:18045962 Id1 Rat propiconazole decreases expression ISO Id1 (Mus musculus) 6480464 propiconazole results in decreased expression of ID1 mRNA CTD PMID:21278054 Id1 Rat prostaglandin F2alpha decreases expression EXP 6480464 Dinoprost results in decreased expression of ID1 mRNA CTD PMID:11517196 Id1 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Oxygen deficiency results in increased expression of ID1 mRNA] CTD PMID:26476374 Id1 Rat rac-lactic acid decreases expression ISO ID1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ID1 mRNA CTD PMID:30851411 Id1 Rat raloxifene affects expression ISO ID1 (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of ID1 mRNA CTD PMID:14699072 Id1 Rat resorcinol decreases expression ISO ID1 (Homo sapiens) 6480464 resorcinol analog results in decreased expression of ID1 protein CTD PMID:24910342 Id1 Rat resorcinol decreases expression ISO Id1 (Mus musculus) 6480464 resorcinol analog results in decreased expression of ID1 protein CTD PMID:24910342 Id1 Rat resveratrol decreases expression ISO ID1 (Homo sapiens) 6480464 resveratrol results in decreased expression of ID1 mRNA and resveratrol results in decreased expression of ID1 protein CTD PMID:21554132 Id1 Rat resveratrol multiple interactions ISO ID1 (Homo sapiens) 6480464 resveratrol inhibits the reaction [Lipopolysaccharides results in increased expression of ID1 mRNA] CTD PMID:26667767 Id1 Rat rotenone decreases expression ISO ID1 (Homo sapiens) 6480464 Rotenone results in decreased expression of ID1 mRNA CTD PMID:33512557 Id1 Rat Rutecarpine decreases expression ISO ID1 (Homo sapiens) 6480464 rutecarpine results in decreased expression of ID1 mRNA CTD PMID:34955744 Id1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO ID1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of ID1 mRNA CTD PMID:35811015 Id1 Rat SB 431542 multiple interactions ISO ID1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Id1 Rat Securinine increases expression ISO ID1 (Homo sapiens) 6480464 securinine results in increased expression of ID1 mRNA CTD PMID:32662633 Id1 Rat selenium atom increases expression ISO ID1 (Homo sapiens) 6480464 Selenium results in increased expression of ID1 mRNA CTD PMID:19244175 Id1 Rat silicon dioxide decreases expression ISO ID1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of ID1 mRNA and Silicon Dioxide results in decreased expression of ID1 mRNA CTD PMID:25351596 and PMID:25895662 Id1 Rat silicon dioxide increases expression ISO ID1 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of ID1 mRNA CTD PMID:28425640 Id1 Rat silicon dioxide decreases expression ISO Id1 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of ID1 mRNA CTD PMID:29203145 Id1 Rat silver atom decreases expression ISO ID1 (Homo sapiens) 6480464 Silver results in decreased expression of ID1 mRNA CTD PMID:26014281 Id1 Rat silver(0) decreases expression ISO ID1 (Homo sapiens) 6480464 Silver results in decreased expression of ID1 mRNA CTD PMID:26014281 Id1 Rat simvastatin increases expression ISO Id1 (Mus musculus) 6480464 Simvastatin results in increased expression of ID1 mRNA CTD PMID:19262002 Id1 Rat sirolimus increases expression ISO ID1 (Homo sapiens) 6480464 Sirolimus results in increased expression of ID1 mRNA CTD PMID:23824090 and PMID:24356939 Id1 Rat sodium arsenate decreases expression ISO ID1 (Homo sapiens) 6480464 sodium arsenate results in decreased expression of ID1 mRNA CTD PMID:12727804 Id1 Rat sodium arsenite multiple interactions ISO ID1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ID1 mRNA more ... CTD PMID:12634122 more ... Id1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of ID1 mRNA CTD PMID:11241755 Id1 Rat sodium arsenite decreases expression ISO Id1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of ID1 mRNA CTD PMID:16014739 Id1 Rat sodium arsenite increases expression ISO ID1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ID1 mRNA CTD PMID:16966095 and PMID:34032870 Id1 Rat sodium arsenite decreases expression ISO ID1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ID1 mRNA CTD PMID:12727804 and PMID:38568856 Id1 Rat sodium dichromate decreases expression ISO ID1 (Homo sapiens) 6480464 sodium bichromate results in decreased expression of ID1 mRNA CTD PMID:12760830 Id1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of ID1 mRNA CTD PMID:25993096 Id1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of ID1 mRNA CTD PMID:19281266 Id1 Rat succimer multiple interactions ISO ID1 (Homo sapiens) 6480464 [Magnetite Nanoparticles co-treated with Succimer] results in decreased expression of ID1 mRNA CTD PMID:25522732 Id1 Rat succimer multiple interactions ISO Id1 (Mus musculus) 6480464 [Magnetite Nanoparticles co-treated with Succimer] affects the expression of ID1 mRNA CTD PMID:25522732 Id1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of ID1 mRNA CTD PMID:30047161 Id1 Rat sulindac sulfide decreases expression ISO ID1 (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of ID1 mRNA and sulindac sulfide results in decreased expression of ID1 protein CTD PMID:16184548 and PMID:21554132 Id1 Rat sunitinib increases expression ISO ID1 (Homo sapiens) 6480464 Sunitinib results in increased expression of ID1 mRNA CTD PMID:31533062 Id1 Rat tacrolimus (anhydrous) increases expression ISO Id1 (Mus musculus) 329848996 tacrolimus increases expression of Id1 mRNA and protein in mouse microvessel PAEC RGD Id1 Rat tacrolimus hydrate increases expression ISO Id1 (Mus musculus) 6480464 Tacrolimus results in increased expression of ID1 mRNA CTD PMID:25270620 and PMID:29362864 Id1 Rat tamoxifen increases expression ISO Id1 (Mus musculus) 6480464 Tamoxifen results in increased expression of ID1 mRNA CTD PMID:25123088 Id1 Rat tamoxifen affects expression ISO Id1 (Mus musculus) 6480464 Tamoxifen affects the expression of ID1 mRNA CTD PMID:17555576 and PMID:20937368 Id1 Rat tamoxifen affects expression ISO ID1 (Homo sapiens) 6480464 Tamoxifen affects the expression of ID1 mRNA CTD PMID:14699072 Id1 Rat tert-butyl hydroperoxide decreases expression ISO ID1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of ID1 mRNA CTD PMID:12419474 Id1 Rat tert-butyl hydroperoxide increases expression ISO Id1 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of ID1 mRNA CTD PMID:15003993 Id1 Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of ID1 mRNA CTD PMID:21515302 Id1 Rat testosterone multiple interactions EXP 6480464 [Estradiol co-treated with Testosterone] results in increased expression of ID1 mRNA and [Estradiol co-treated with Testosterone] results in increased expression of ID1 protein CTD PMID:11375906 Id1 Rat tetrachloromethane affects expression ISO Id1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of ID1 mRNA CTD PMID:17484886 Id1 Rat tetrachloromethane increases expression ISO Id1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of ID1 mRNA CTD PMID:27339419 and PMID:31919559 Id1 Rat tetraphene multiple interactions ISO Id1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ID1 mRNA CTD PMID:27858113 Id1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ID1 mRNA CTD PMID:23411599 and PMID:34492290 Id1 Rat thiram decreases expression ISO ID1 (Homo sapiens) 6480464 Thiram results in decreased expression of ID1 mRNA CTD PMID:38568856 Id1 Rat titanium dioxide multiple interactions ISO ID1 (Homo sapiens) 6480464 ID1 protein promotes the reaction [titanium dioxide results in increased phosphorylation of MAPK1 protein] and ID1 protein promotes the reaction [titanium dioxide results in increased phosphorylation of MAPK3 protein] CTD PMID:19486931 Id1 Rat titanium dioxide decreases methylation ISO Id1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ID1 enhancer and titanium dioxide results in decreased methylation of ID1 promoter CTD PMID:35295148 Id1 Rat titanium dioxide decreases response to substance ISO ID1 (Homo sapiens) 6480464 ID1 protein results in decreased susceptibility to titanium dioxide CTD PMID:19486931 Id1 Rat titanium dioxide decreases expression ISO ID1 (Homo sapiens) 6480464 titanium dioxide results in decreased expression of ID1 mRNA CTD PMID:19486931 Id1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of ID1 mRNA CTD PMID:25729387 Id1 Rat treprostinil increases expression ISO ID1 (Homo sapiens) 6480464 treprostinil results in increased expression of ID1 protein CTD PMID:20522807 Id1 Rat treprostinil multiple interactions EXP 6480464 treprostinil inhibits the reaction [Monocrotaline results in decreased expression of ID1 mRNA] CTD PMID:20522807 Id1 Rat treprostinil increases expression EXP 6480464 treprostinil results in increased expression of ID1 protein CTD PMID:20522807 Id1 Rat trichostatin A increases expression ISO ID1 (Homo sapiens) 6480464 trichostatin A results in increased expression of ID1 mRNA CTD PMID:24935251 Id1 Rat triclosan decreases expression ISO ID1 (Homo sapiens) 6480464 Triclosan results in decreased expression of ID1 mRNA CTD PMID:30510588 Id1 Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of ID1 mRNA CTD PMID:21515302 Id1 Rat trovafloxacin increases expression ISO Id1 (Mus musculus) 6480464 trovafloxacin results in increased expression of ID1 mRNA CTD PMID:35537566 Id1 Rat tunicamycin decreases expression ISO ID1 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of ID1 mRNA CTD PMID:29453283 Id1 Rat valproic acid increases expression ISO Id1 (Mus musculus) 6480464 Valproic Acid results in increased expression of ID1 mRNA CTD PMID:15345369 and PMID:19136453 Id1 Rat valproic acid increases expression ISO ID1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ID1 mRNA CTD PMID:23179753 more ... Id1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of ID1 mRNA CTD PMID:19015723 Id1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of ID1 mRNA CTD PMID:23034163 Id1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of ID1 mRNA CTD PMID:23034163 Id1 Rat zearalenone decreases expression ISO ID1 (Homo sapiens) 6480464 Zearalenone results in decreased expression of ID1 mRNA CTD PMID:25424538 Id1 Rat zoledronic acid multiple interactions ISO ID1 (Homo sapiens) 6480464 zoledronic acid promotes the reaction [Gossypol results in decreased expression of ID1 mRNA] CTD PMID:19825521
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) (R)-pantothenic acid (ISO) (S)-nicotine (ISO) 1,4-dioxane (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-acetamidofluorene (ISO) 2-amino-2-deoxy-D-glucopyranose (ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 4-phenylbutyric acid (ISO) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acetamide (EXP) Actein (EXP) actinomycin D (ISO) aflatoxin B1 (EXP,ISO) aldehydo-D-glucosamine (ISO) aldehydo-D-glucose (ISO) aldrin (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) angiotensin II (ISO) antimonite (ISO) Archazolid B (ISO) aristolochic acid A (ISO) arsane (EXP,ISO) arsenic atom (EXP,ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP) avobenzone (ISO) azoxystrobin (ISO) benzalkonium chloride (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (EXP,ISO) beta-D-glucosamine (ISO) beta-naphthoflavone (ISO) bexarotene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) bucladesine (ISO) butan-1-ol (ISO) Butylbenzyl phthalate (EXP) butyric acid (ISO) cadmium dichloride (EXP,ISO) cadmium sulfate (ISO) candesartan (EXP) cannabidiol (ISO) cannabidiolic acid (ISO) carbamazepine (ISO) carbon nanotube (ISO) celastrol (ISO) chloropicrin (ISO) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) chrysene (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) clobetasol (ISO) clofibrate (EXP,ISO) cobalt dichloride (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) crotonaldehyde (ISO) curcumin (ISO) cyclosporin A (ISO) D-glucose (ISO) DDE (ISO) deguelin (ISO) deoxynivalenol (ISO) dexamethasone (ISO) diallyl disulfide (EXP) diarsenic trioxide (ISO) dibenz[a,h]anthracene (EXP,ISO) dibenzo[a,l]pyrene (EXP) dibutyl phthalate (EXP) dichromium trioxide (ISO) dioxygen (EXP,ISO) dipentyl phthalate (EXP) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) diquat (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) epoxiconazole (ISO) ethane (ISO) ethanol (ISO) fenpyroximate (ISO) ferric oxide (ISO) flavonoids (EXP) fluoranthene (EXP,ISO) folic acid (ISO) formaldehyde (ISO) fulvestrant (ISO) furan (ISO) furosemide (EXP) gamma-hexachlorocyclohexane (ISO) genistein (EXP,ISO) gentamycin (EXP) geraniol (ISO) glucose (ISO) gossypol (ISO) hydrogen peroxide (ISO) hydroquinone (ISO) icariin (ISO) iloprost (ISO) indometacin (ISO) inulin (ISO) iron dichloride (ISO) isoprenaline (EXP,ISO) L-methionine (ISO) lead diacetate (ISO) leflunomide (EXP,ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) mercury dibromide (ISO) methamphetamine (ISO) methimazole (EXP) methotrexate (ISO) methoxychlor (EXP) methylmercury chloride (ISO) methylseleninic acid (ISO) mono(2-ethylhexyl) phthalate (ISO) monocrotaline (EXP) Muraglitazar (EXP) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO) N-ethyl-N-nitrosourea (EXP) N-methyl-4-phenylpyridinium (EXP,ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (ISO) N-nitrosomorpholine (EXP) nickel atom (ISO) nickel dichloride (EXP) nickel sulfate (ISO) niclosamide (ISO) nicotine (ISO) ochratoxin A (EXP) octreotide (ISO) orphenadrine (EXP) oxaliplatin (EXP) ozone (EXP,ISO) p-chloromercuribenzoic acid (ISO) panaxydol (ISO) paracetamol (ISO) paraquat (EXP) pasireotide (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenylephrine (EXP) phenylmercury acetate (ISO) phlorizin (ISO) picoxystrobin (ISO) pirinixic acid (ISO) pomalidomide (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) propiconazole (ISO) prostaglandin F2alpha (EXP) quercetin (EXP) rac-lactic acid (ISO) raloxifene (ISO) resorcinol (ISO) resveratrol (ISO) rotenone (ISO) Rutecarpine (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) Securinine (ISO) selenium atom (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) simvastatin (ISO) sirolimus (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium dichromate (EXP,ISO) Soman (EXP) succimer (ISO) sulfadimethoxine (EXP) sulindac sulfide (ISO) sunitinib (ISO) tacrolimus (anhydrous) (ISO) tacrolimus hydrate (ISO) tamoxifen (ISO) tert-butyl hydroperoxide (ISO) Tesaglitazar (EXP) testosterone (EXP) tetrachloromethane (ISO) tetraphene (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) treprostinil (EXP,ISO) trichostatin A (ISO) triclosan (ISO) troglitazone (EXP) trovafloxacin (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) zearalenone (ISO) zoledronic acid (ISO)
Biological Process
apoptotic process (IEA,ISO) BMP signaling pathway (IEA,ISO) cell differentiation (IEA) cell-abiotic substrate adhesion (IEP) cellular response to dopamine (IEP) cellular response to epidermal growth factor stimulus (IEP) cellular response to nerve growth factor stimulus (IEP) cellular response to peptide (IEP) cellular response to transforming growth factor beta stimulus (IEP) circadian rhythm (IEA,ISO) collagen metabolic process (IEA,ISO) endothelial cell apoptotic process (IEA,ISO) endothelial cell morphogenesis (IEA,ISO) heart development (IEA,ISO) lung morphogenesis (IEA,ISO) lung vasculature development (IEA,ISO) negative regulation of apoptotic process (IMP) negative regulation of cold-induced thermogenesis (IEA,ISO,ISS) negative regulation of dendrite morphogenesis (IMP) negative regulation of DNA binding (IMP) negative regulation of DNA-binding transcription factor activity (ISO) negative regulation of DNA-templated transcription (IEA,ISO,ISS) negative regulation of endothelial cell apoptotic process (IEA,ISO) negative regulation of endothelial cell differentiation (IMP) negative regulation of gene expression (IEA,ISO) negative regulation of osteoblast differentiation (IEA,ISO) negative regulation of protein binding (IMP) negative regulation of transcription by RNA polymerase II (IBA,IEA,IMP,ISO) neuron differentiation (IBA,IEP) positive regulation of actin filament bundle assembly (IMP) positive regulation of epithelial cell proliferation (IMP) positive regulation of gene expression (IEA,IMP,ISO) protein destabilization (IEA,ISO) regulation of angiogenesis (IEA,ISO) regulation of MAPK cascade (IEA,ISO) regulation of nucleobase-containing compound metabolic process (IEA) regulation of vasculature development (IMP) response to antibiotic (IEA,ISO) rhythmic process (IEA)
1.
Regeneration of three layers vascular wall by using BMP2-treated MSC involving HIF-1alpha and Id1 expressions through JAK/STAT pathways.
Belmokhtar K, etal., Stem Cell Rev. 2011 Nov;7(4):847-59. doi: 10.1007/s12015-011-9254-6.
2.
TGF-beta repression of Id2 induces apoptosis in gut epithelial cells.
Cao Y, etal., Oncogene. 2009 Feb 26;28(8):1089-98. doi: 10.1038/onc.2008.456. Epub 2009 Jan 12.
3.
Bone morphogenetic protein 4, inhibitor of differentiation 1, and epidermal growth factor receptor regulate the survival of cochlear sensory epithelial cells.
Chen J, etal., J Neurosci Res. 2013 Apr;91(4):515-26. doi: 10.1002/jnr.23175. Epub 2013 Jan 18.
4.
Regulation of Id1 and its association with basic helix-loop-helix proteins during nerve growth factor-induced differentiation of PC12 cells.
Einarson MB and Chao MV, Mol Cell Biol. 1995 Aug;15(8):4175-83.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
A centrosomal Cdc20-APC pathway controls dendrite morphogenesis in postmitotic neurons.
Kim AH, etal., Cell. 2009 Jan 23;136(2):322-36.
8.
Id1, Id2 and Id3 are induced in rat melanotrophs of the pituitary gland by dopamine suppression under continuous stress.
Konishi H, etal., Neuroscience. 2010 Sep 15;169(4):1527-34. doi: 10.1016/j.neuroscience.2010.06.030. Epub 2010 Jun 20.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Activation of helix-loop-helix proteins Id1, Id2 and Id3 during neural differentiation.
Nagata Y and Todokoro K, Biochem Biophys Res Commun 1994 Mar 30;199(3):1355-62.
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
Id1 Promotes Obesity by Suppressing Brown Adipose Thermogenesis and White Adipose Browning.
Patil M, etal., Diabetes. 2017 Jun;66(6):1611-1625. doi: 10.2337/db16-1079. Epub 2017 Mar 7.
13.
Requirement for Id1 in opioid-induced oligodendrogenesis in cultured adult rat hippocampal progenitors.
Persson AI, etal., Eur J Neurosci. 2006 May;23(9):2277-88.
14.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
15.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
16.
The ubiquitin receptor S5a/Rpn10 links centrosomal proteasomes with dendrite development in the mammalian brain.
Puram SV, etal., Cell Rep. 2013 Jul 11;4(1):19-30. doi: 10.1016/j.celrep.2013.06.006. Epub 2013 Jul 3.
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
BMP type I receptor ALK2 is required for angiotensin II-induced cardiac hypertrophy.
Shahid M, etal., Am J Physiol Heart Circ Physiol. 2016 Apr 15;310(8):H984-94. doi: 10.1152/ajpheart.00879.2015. Epub 2016 Feb 12.
19.
FK506 activates BMPR2, rescues endothelial dysfunction, and reverses pulmonary hypertension.
Spiekerkoetter E, etal., J Clin Invest. 2013 Aug;123(8):3600-13. doi: 10.1172/JCI65592. Epub 2013 Jul 15.
20.
Transcriptional regulation in cardiac muscle. Coordinate expression of Id with a neonatal phenotype during development and following a hypertrophic stimulus in adult rat ventricular myocytes in vitro.
Springhorn JP, etal., J Biol Chem 1992 Jul 15;267(20):14360-5.
21.
Posttranscriptional regulation of Id1 activity in cardiac muscle. Alternative splicing of novel Id1 transcript permits homodimerization.
Springhorn JP, etal., J Biol Chem 1994 Feb 18;269(7):5132-6.
22.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
23.
Id1, Id2, and Id3 gene expression in neural cells during development.
Tzeng SF and de Vellis J, Glia. 1998 Dec;24(4):372-81.
24.
Upregulation of the HLH Id gene family in neural progenitors and glial cells of the rat spinal cord following contusion injury.
Tzeng SF, etal., J Neurosci Res. 2001 Dec 15;66(6):1161-72.
25.
Regulation of E-box DNA binding during in vivo and in vitro activation of rat and human hepatic stellate cells.
Vincent KJ, etal., Gut. 2001 Nov;49(5):713-9.
26.
Integrated microarray analysis provided novel insights to the pathogenesis of glaucoma.
Wang J, etal., Mol Med Rep. 2017 Dec;16(6):8735-8746. doi: 10.3892/mmr.2017.7711. Epub 2017 Oct 4.
27.
Id1 is a critical mediator in TGF-beta-induced transdifferentiation of rat hepatic stellate cells.
Wiercinska E, etal., Hepatology. 2006 May;43(5):1032-41.
28.
Smad-dependent and smad-independent induction of id1 by prostacyclin analogues inhibits proliferation of pulmonary artery smooth muscle cells in vitro and in vivo.
Yang J, etal., Circ Res. 2010 Jul 23;107(2):252-62. doi: 10.1161/CIRCRESAHA.109.209940. Epub 2010 Jun 3.
29.
CCN1 promotes the differentiation of endothelial progenitor cells and reendothelialization in the early phase after vascular injury.
Yu Y, etal., Basic Res Cardiol. 2010 Nov;105(6):713-24. doi: 10.1007/s00395-010-0117-0. Epub 2010 Sep 10.
Id1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 161,671,525 - 161,672,691 (+) NCBI GRCr8 mRatBN7.2 3 141,210,666 - 141,212,420 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 141,211,267 - 141,212,419 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 145,116,210 - 145,117,337 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 153,700,048 - 153,701,175 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 151,439,728 - 151,440,855 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 148,214,623 - 148,216,715 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 148,215,540 - 148,216,718 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 154,619,728 - 154,621,190 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 143,086,162 - 143,087,289 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 142,991,791 - 142,992,906 (+) NCBI Celera 3 139,960,608 - 139,961,735 (+) NCBI Celera Cytogenetic Map 3 q41 NCBI
ID1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 31,605,289 - 31,606,510 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 31,573,014 - 31,606,515 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 30,193,092 - 30,194,313 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 29,656,753 - 29,657,974 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 29,656,752 - 29,657,974 NCBI Celera 20 26,949,273 - 26,950,494 (+) NCBI Celera Cytogenetic Map 20 q11.21 NCBI HuRef 20 26,981,781 - 26,983,013 (+) NCBI HuRef CHM1_1 20 30,096,962 - 30,098,194 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 33,329,528 - 33,330,749 (+) NCBI T2T-CHM13v2.0
Id1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 152,578,171 - 152,579,330 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 152,578,171 - 152,579,330 (+) Ensembl GRCm39 Ensembl GRCm38 2 152,736,251 - 152,737,410 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 152,736,251 - 152,737,410 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 152,562,010 - 152,563,146 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 152,427,715 - 152,428,851 (+) NCBI MGSCv36 mm8 Celera 2 158,552,315 - 158,553,451 (+) NCBI Celera Cytogenetic Map 2 H1 NCBI cM Map 2 75.41 NCBI
Id1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 29,337,757 - 29,339,178 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 29,337,969 - 29,339,178 (-) NCBI ChiLan1.0 ChiLan1.0
ID1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 37,296,445 - 37,299,392 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 37,290,399 - 37,292,483 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 27,895,177 - 27,896,414 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 28,535,470 - 28,536,726 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 28,535,582 - 28,536,311 (+) Ensembl panpan1.1 panPan2
ID1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 21,094,339 - 21,096,276 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 21,094,755 - 21,096,276 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 20,741,568 - 20,743,501 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 21,780,949 - 21,782,885 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 21,781,704 - 21,782,885 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 21,059,018 - 21,060,951 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 21,163,982 - 21,165,918 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 21,594,218 - 21,596,151 (+) NCBI UU_Cfam_GSD_1.0
Id1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 170,179,346 - 170,180,525 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936485 18,610,665 - 18,612,059 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936485 18,610,721 - 18,611,889 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ID1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 35,316,514 - 35,317,736 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 35,316,518 - 35,317,742 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 40,187,160 - 40,188,384 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC103247994 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 36,008,660 - 36,009,880 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 36,008,636 - 36,010,017 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 90,944,637 - 90,945,863 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Id1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 391 Count of miRNA genes: 230 Interacting mature miRNAs: 270 Transcripts: ENSRNOT00000029660 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 5686842 Rf59 Renal function QTL 59 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 3 140069424 146976080 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
PMC156147P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 141,211,531 - 141,211,611 (+) MAPPER mRatBN7.2 Rnor_6.0 3 148,215,827 - 148,215,906 NCBI Rnor6.0 Rnor_5.0 3 154,620,302 - 154,620,381 UniSTS Rnor5.0 RGSC_v3.4 3 143,086,401 - 143,086,480 UniSTS RGSC3.4 Celera 3 139,960,847 - 139,960,926 UniSTS Cytogenetic Map 3 q41 UniSTS
PMC305683P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 141,211,352 - 141,212,020 (+) MAPPER mRatBN7.2 Rnor_6.0 3 148,215,648 - 148,216,315 NCBI Rnor6.0 Rnor_5.0 3 154,620,123 - 154,620,790 UniSTS Rnor5.0 RGSC_v3.4 3 143,086,222 - 143,086,889 UniSTS RGSC3.4 Celera 3 139,960,668 - 139,961,335 UniSTS Cytogenetic Map 3 q41 UniSTS
PMC133998P5
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 141,211,352 - 141,212,020 (+) MAPPER mRatBN7.2 Rnor_6.0 3 148,215,648 - 148,216,315 NCBI Rnor6.0 Rnor_5.0 3 154,620,123 - 154,620,790 UniSTS Rnor5.0 RGSC_v3.4 3 143,086,222 - 143,086,889 UniSTS RGSC3.4 Celera 3 139,960,668 - 139,961,335 UniSTS Cytogenetic Map 3 q41 UniSTS
PMC145454P3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 141,211,592 - 141,211,668 (+) MAPPER mRatBN7.2 Rnor_6.0 3 148,215,888 - 148,215,963 NCBI Rnor6.0 Rnor_5.0 3 154,620,363 - 154,620,438 UniSTS Rnor5.0 RGSC_v3.4 3 143,086,462 - 143,086,537 UniSTS RGSC3.4 Celera 3 139,960,908 - 139,960,983 UniSTS Cytogenetic Map 3 q41 UniSTS
PMC33181P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 141,211,344 - 141,212,059 (+) MAPPER mRatBN7.2 Rnor_6.0 3 148,215,640 - 148,216,354 NCBI Rnor6.0 Rnor_5.0 3 154,620,115 - 154,620,829 UniSTS Rnor5.0 RGSC_v3.4 3 143,086,214 - 143,086,928 UniSTS RGSC3.4 Celera 3 139,960,660 - 139,961,374 UniSTS Cytogenetic Map 3 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000029660 ⟹ ENSRNOP00000052261
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 141,211,267 - 141,212,419 (+) Ensembl Rnor_6.0 Ensembl 3 148,215,540 - 148,216,718 (+) Ensembl
RefSeq Acc Id:
NM_012797 ⟹ NP_036929
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 161,671,564 - 161,672,691 (+) NCBI mRatBN7.2 3 141,211,293 - 141,212,420 (+) NCBI Rnor_6.0 3 148,215,588 - 148,216,715 (+) NCBI Rnor_5.0 3 154,619,728 - 154,621,190 (+) NCBI RGSC_v3.4 3 143,086,162 - 143,087,289 (+) RGD Celera 3 139,960,608 - 139,961,735 (+) RGD
Sequence:
GCTCTCTTCTAACACCCTGTTCTCAGACTCCTCCGCGCCTCTCCGCCTGTCCTCAGGATCATGAAGGTCGCCAGTAGCAGTGCCGCGGCCACCGCAGGCCCCAGCTGTTCGCTGAAGGCAGGCAGGAC GGCGGGCGAAGTGGTGCTTGGTCTGTCGGAGCAAAGCGTTGCCATCTCGCGCTGCGCTGGGACGCGCCTGCCCGCCTTGCTGGACGAACAGCAGGTGAACGTTCTGCTCTACGACATGAACGGCTGCT ACTCACGCCTCAAGGAGCTGGTGCCTACCCTGCCTCAGAACCGCAAAGTGAGCAAGGTGGAGATACTGCAGCATGTTATCGACTACATCAGGGACCTGCAGCTGGAGCTGAACTCTGAGTCTGAAGTC GCGACCGCCGGAGGCCGGGGGCTGCCCGTCCGGGCCCCGCTCAGCACCCTGAACGGCGAGATCAGTGCCTTGGCGGCCGAGGCGGCATGTGTTCCAGCCGACGACCGCATCTTGTGTCGCTGAGGCGG CGCACTGAGGAACCAGATGGACTCCAGCCCTTCAGGAGGCAAGAGGAAAAAAAGTGCTCTCGGTTCCCCAGAGCAACCCGGGGAAAGACACTACCGCGGCCACGGGACTCTTGACGGATCTGTCCAGG GGGTAGAGGGTTGATCAACGGAGTCTCGCCCTCTCCACCTTTCAGCCTCCAGAGACTTTGAGGAGGGGGTTATTCAACCCCGTGTGTTTCTGTTTTTTTGAAAAAGCAGACATTTTTTTTAAATGGTC ACATTTCGTGCTTCTCAGATTTCTGAGAAAATGTTTTGTATTGTATATTACAATGATCACTGGCTGAGAATATTGTTTTACAATAGTTCTTATGGGGGTGGGTTTTTTGTTGTTATTAAACAAACACT TTAGATAACGTAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_006235267 ⟹ XP_006235329
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 161,671,525 - 161,672,688 (+) NCBI mRatBN7.2 3 141,210,666 - 141,212,417 (+) NCBI Rnor_6.0 3 148,214,623 - 148,216,712 (+) NCBI Rnor_5.0 3 154,619,728 - 154,621,190 (+) NCBI
Sequence:
CCCTTTCTGCAAAAGGCTGCAAATCCAGGGTAGAACTGGGGTCTGTAGTCCCACTCCACCGCGA CCCTCTATCTAGTTCAGGTCTCAGATTCTGCCGCTTTAAAGAGGTTCCTAGTATCTCTTCCAGTTCAACTGGCCTAGGTCCTGGATCTAGGGACTTTACAGTTCATTTTCTAGAAACTGAGTCAGACG CGGAGTTCAAAGTAAAAGGGAGCCTGCTTAAAAAATCTGTCTCAAAACATGATGTGGCAGAGCACACCCGTGATTCAGAGCAAGGAACATCTTAATTTTAAGGTCATCTACCGCTAGCTACATAGCAA GTTCCCAGTCTAGCATGGGCTAAAGTTACATGAGACTCTTAAAAAAAAAAAATCAGCGGGGTTGGGGATTTAGCTCAGTGGTAGAGCGCTTGCCTAGCAAGCTCAAGGCCCTGGGTTCAGGCCCCAGC TCCGAAAAAAAAAAAAAAAATCAGCAAACCCTCAAAAGTAAATAAATATAAAAATAAAATTCGGCTTTTTAATAAGTAAAGATCACAGCCCAGTCTTCCAACAGCATCTGGGAGTCCTTGGCTAGTCC TGAGTCACTGGCCAACCCAGGGCCAACCTGGTTCCTGTTTCATCTGCAAAATGGACCTGGAGATGTGAGAAAGAGACAGTGAGAAGCTGATTCCTGGGGTCTTTTTGTTAACTGCCAATATTAGCTTA GCCTCTGCTTCCTTAAGGAAGAGCCCACTAACTGCTCTGCCTATGCCCTCCCACCCTCTCAGTTCTTGAGACCCACCACCTCCCCATCAGCCTAAGGGTGTACTAGTAGATCCAGAGGTGGGACCGGA GGGCAAGCTAAGTCACGCCTCCAGCAACCTATTGGTTGCTTTTGAACGTTCTGAACCCGCCCTGGGTCCGCCCTTATAAAAGGCTGGCCCCAGAGCTGAGCCTACTCATTGTACAACCTTTCTCCAAC TGCTTGCTCTCTTCTAACACCCTGTTCTCAGACTCCTCCGCGCCTCTCCGCCTGTCCTCAGGATCATGAAGGTCGCCAGTAGCAGTGCCGCGGCCACCGCAGGCCCCAGCTGTTCGCTGAAGGCAGGC AGGACGGCGGGCGAAGTGGTGCTTGGTCTGTCGGAGCAAAGCGTTGCCATCTCGCGCTGCGCTGGGACGCGCCTGCCCGCCTTGCTGGACGAACAGCAGGTGAACGTTCTGCTCTACGACATGAACGG CTGCTACTCACGCCTCAAGGAGCTGGTGCCTACCCTGCCTCAGAACCGCAAAGTGAGCAAGGTGGAGATACTGCAGCATGTTATCGACTACATCAGGGACCTGCAGCTGGAGCTGAACTCTGAGTCTG AAGTCGCGACCGCCGGAGGCCGGGGGCTGCCCGTCCGGGCCCCGCTCAGCACCCTGAACGGCGAGATCAGTGCCTTGGCGGCCGAGGTGAGGCGGCATGTGTTCCAGCCGACGACCGCATCTTGTGTC GCTGAGGCGGCGCACTGAGGAACCAGATGGACTCCAGCCCTTCAGGAGGCAAGAGGAAAAAAAGTGCTCTCGGTTCCCCAGAGCAACCCGGGGAAAGACACTACCGCGGCCACGGGACTCTTGACGGA TCTGTCCAGGGGGTAGAGGGTTGATCAACGGAGTCTCGCCCTCTCCACCTTTCAGCCTCCAGAGACTTTGAGGAGGGGGTTATTCAACCCCGTGTGTTTCTGTTTTTTTGAAAAAGCAGACATTTTTT TTAAATGGTCACATTTCGTGCTTCTCAGATTTCTGAGAAAATGTTTTGTATTGTATATTACAATGATCACTGGCTGAGAATATTGTTTTACAATAGTTCTTATGGGGGTGGGTTTTTTGTTGTTATTA AACAAACACTTTAGATAA
hide sequence
RefSeq Acc Id:
NP_036929 ⟸ NM_012797
- UniProtKB:
P41135 (UniProtKB/Swiss-Prot), A0JPJ2 (UniProtKB/TrEMBL), A6KHQ6 (UniProtKB/TrEMBL)
- Sequence:
MKVASSSAAATAGPSCSLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVATAGGRGLPVRAPLSTLNGE ISALAAEAACVPADDRILCR
hide sequence
RefSeq Acc Id:
XP_006235329 ⟸ XM_006235267
- Peptide Label:
isoform X1
- UniProtKB:
P41135 (UniProtKB/Swiss-Prot), A0A8L2QPI3 (UniProtKB/TrEMBL), A6KHQ6 (UniProtKB/TrEMBL)
- Sequence:
MKVASSSAAATAGPSCSLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLYDMNG CYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVATAGGRGLPVRAPLSTLNGEISALAAEVRRHVFQPTTASCVAEAAH
hide sequence
Ensembl Acc Id:
ENSRNOP00000052261 ⟸ ENSRNOT00000029660
RGD ID: 13692549
Promoter ID: EPDNEW_R3073
Type: single initiation site
Name: Id1_1
Description: inhibitor of DNA binding 1, HLH protein
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 148,215,562 - 148,215,622 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-10-13
Id1
inhibitor of DNA binding 1
Id1
inhibitor of DNA binding 1, HLH protein
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2016-03-15
Id1
inhibitor of DNA binding 1, HLH protein
Id1
inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2016-02-25
Id1
inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Id1
inhibitor of DNA binding 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-03-30
Id1
inhibitor of DNA binding 1
Inhibitor of DNA binding 1, helix-loop-helix protein (splice variation)
Name updated
1299863
APPROVED
2002-06-10
Id1
Inhibitor of DNA binding 1, helix-loop-helix protein (splice variation)
Symbol and Name status set to approved
70586
APPROVED
Note Type
Note
Reference
gene_process
may be involved in control of cardiac muscle cell phenotype
727553
gene_process
may be involved in the early stage of neural differentiation
729182