Id1 (inhibitor of DNA binding 1) - Rat Genome Database

Name: Id1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Id1 (inhibitor of DNA binding 1) Rattus norvegicus

Analyze

Symbol:

Id1

Name:

inhibitor of DNA binding 1 (Ensembl:inhibitor of DNA binding 1, HLH protein)

RGD ID:

2858

Description:

Enables identical protein binding activity and proteasome binding activity. Involved in several processes, including cellular response to organonitrogen compound; negative regulation of cell differentiation; and nervous system development. Located in centrosome and nucleus. Used to study pulmonary hypertension. Biomarker of cholestasis. Orthologous to human ID1 (inhibitor of DNA binding 1); PARTICIPATES IN interleukin-3 signaling pathway; transforming growth factor-beta superfamily mediated signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DNA-binding protein inhibitor ID-1; ID125A; Idb1; inhibitor of differentiation 1; Inhibitor of DNA binding 1 helix-loop-helix protein (splice varaiation); inhibitor of DNA binding 1, dominant negative helix-loop-helix protein; Inhibitor of DNA binding 1, helix-loop-helix protein (splice variation); inhibitor of DNA binding 1, HLH protein; MGC156482

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ID1 (inhibitor of DNA binding 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Id1 (inhibitor of DNA binding 1, HLH protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Id1 (inhibitor of DNA binding 1, HLH protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ID1 (inhibitor of DNA binding 1, HLH protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ID1 (inhibitor of DNA binding 1, HLH protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Id1 (inhibitor of DNA binding 1, HLH protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ID1 (inhibitor of DNA binding 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103247994 (DNA-binding protein inhibitor ID-1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Id1 (inhibitor of DNA binding 1, HLH protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ID1 (inhibitor of DNA binding 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Id1 (inhibitor of DNA binding 1, HLH protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	id1 (inhibitor of DNA binding 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	emc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	141,210,666 - 141,212,420 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	141,211,267 - 141,212,419 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	145,116,210 - 145,117,337 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	153,700,048 - 153,701,175 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	151,439,728 - 151,440,855 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	148,214,623 - 148,216,715 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	148,215,540 - 148,216,718 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	154,619,728 - 154,621,190 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	143,086,162 - 143,087,289 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	142,991,791 - 142,992,906 (+)	NCBI
Celera	3	139,960,608 - 139,961,735 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cholestasis (IEP)

disease of cellular proliferation (ISO)

Experimental Diabetes Mellitus (ISO)

Experimental Mammary Neoplasms (ISO)

genetic disease (ISO)

glaucoma (ISO)

Myocardial Ischemia (ISO)

Neoplasm Metastasis (ISO)

primary pulmonary hypertension (ISO)

pulmonary hypertension (IDA)

Spinal Cord Injuries (IEP)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R)-pantothenic acid (ISO)

(S)-nicotine (ISO)

1,4-dioxane (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-acetamidofluorene (ISO)

2-amino-2-deoxy-D-glucopyranose (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

4-phenylbutyric acid (ISO)

5-aza-2'-deoxycytidine (ISO)

5-azacytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acetamide (EXP)

Actein (EXP)

actinomycin D (ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucosamine (ISO)

aldehydo-D-glucose (ISO)

aldrin (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

antimonite (ISO)

Archazolid B (ISO)

aristolochic acid A (ISO)

arsane (EXP)

arsenic atom (EXP)

arsenite(3-) (ISO)

arsenous acid (ISO)

avobenzone (ISO)

azoxystrobin (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[b]fluoranthene (EXP,ISO)

beta-D-glucosamine (ISO)

beta-naphthoflavone (ISO)

bexarotene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bucladesine (ISO)

butan-1-ol (ISO)

Butylbenzyl phthalate (EXP)

butyric acid (ISO)

cadmium dichloride (EXP,ISO)

cadmium sulfate (ISO)

candesartan (EXP)

cannabidiol (ISO)

cannabidiolic acid (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

choline (ISO)

chromium(6+) (ISO)

chrysene (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibrate (EXP,ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

crotonaldehyde (ISO)

curcumin (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

deguelin (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

diallyl disulfide (EXP)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (EXP,ISO)

dibenzo[a,l]pyrene (EXP)

dibutyl phthalate (EXP)

dichromium trioxide (ISO)

dioxygen (EXP,ISO)

dipentyl phthalate (EXP)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethane (ISO)

ethanol (ISO)

fenpyroximate (ISO)

ferric oxide (ISO)

flavonoids (EXP)

fluoranthene (EXP,ISO)

folic acid (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

furan (ISO)

furosemide (EXP)

gamma-hexachlorocyclohexane (ISO)

genistein (EXP,ISO)

gentamycin (EXP)

geraniol (ISO)

glucose (ISO)

gossypol (ISO)

hydrogen peroxide (ISO)

hydroquinone (ISO)

icariin (ISO)

iloprost (ISO)

indometacin (ISO)

isoprenaline (ISO)

L-methionine (ISO)

lead diacetate (ISO)

leflunomide (EXP,ISO)

lipopolysaccharide (ISO)

manganese(II) chloride (ISO)

menadione (ISO)

mercury dibromide (ISO)

methamphetamine (ISO)

methotrexate (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

methylseleninic acid (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monocrotaline (EXP)

Muraglitazar (EXP)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO)

N-ethyl-N-nitrosourea (EXP)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

N-nitrosodiethylamine (ISO)

N-nitrosodimethylamine (ISO)

N-nitrosomorpholine (EXP)

nickel atom (ISO)

nickel dichloride (EXP)

nickel sulfate (ISO)

nicotine (ISO)

ochratoxin A (EXP)

octreotide (ISO)

orphenadrine (EXP)

oxaliplatin (EXP)

ozone (EXP,ISO)

p-chloromercuribenzoic acid (ISO)

panaxydol (ISO)

paracetamol (ISO)

paraquat (EXP)

pasireotide (ISO)

perfluorooctanoic acid (EXP)

phenylephrine (EXP)

phenylmercury acetate (ISO)

phlorizin (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

pomalidomide (ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

progesterone (ISO)

propiconazole (ISO)

prostaglandin F2alpha (EXP)

quercetin (EXP)

rac-lactic acid (ISO)

raloxifene (ISO)

resorcinol (ISO)

resveratrol (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

Securinine (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

simvastatin (ISO)

sirolimus (ISO)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

sodium dichromate (EXP,ISO)

Soman (EXP)

succimer (ISO)

sulindac sulfide (ISO)

sunitinib (ISO)

tacrolimus hydrate (ISO)

tamoxifen (ISO)

tert-butyl hydroperoxide (ISO)

Tesaglitazar (EXP)

testosterone (EXP)

tetrachloromethane (ISO)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

treprostinil (EXP,ISO)

trichostatin A (ISO)

triclosan (ISO)

troglitazone (EXP)

trovafloxacin (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zearalenone (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (ISO)

BMP signaling pathway (ISO)

brain development (IEP)

cell differentiation (IBA)

cell-abiotic substrate adhesion (IEP)

cellular response to dopamine (IEP)

cellular response to epidermal growth factor stimulus (IEP)

cellular response to nerve growth factor stimulus (IEP)

cellular response to peptide (IEP)

cellular response to transforming growth factor beta stimulus (IEP)

circadian regulation of gene expression (IBA)

circadian rhythm (ISO)

collagen metabolic process (ISO)

endothelial cell apoptotic process (ISO)

endothelial cell morphogenesis (ISO)

heart development (ISO)

lung morphogenesis (ISO)

lung vasculature development (ISO)

negative regulation of apoptotic process (IMP)

negative regulation of cold-induced thermogenesis (ISO,ISS)

negative regulation of dendrite morphogenesis (IMP)

negative regulation of DNA binding (IMP,ISO)

negative regulation of DNA-binding transcription factor activity (ISO)

negative regulation of DNA-templated transcription (ISO,ISS)

negative regulation of endothelial cell apoptotic process (ISO)

negative regulation of endothelial cell differentiation (IMP)

negative regulation of gene expression (ISO)

negative regulation of osteoblast differentiation (ISO)

negative regulation of protein binding (IMP)

negative regulation of transcription by RNA polymerase II (IBA,IEA,IMP,ISO)

neuron differentiation (IEP)

positive regulation of actin filament bundle assembly (IMP)

positive regulation of epithelial cell proliferation (IMP)

positive regulation of gene expression (IMP,ISO)

protein destabilization (ISO)

regulation of angiogenesis (ISO)

regulation of MAPK cascade (ISO)

regulation of vasculature development (IMP)

response to antibiotic (ISO)

response to organic cyclic compound (IEP)

Cellular Component

centrosome (IDA)

cytoplasm (IEA,ISO)

Golgi apparatus (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA)

nucleus (IDA)

nucleus (IEA,ISO)

Molecular Function

identical protein binding (IPI)

proteasome binding (IPI)

protein binding (IDA,IPI,ISO)

protein dimerization activity (IEA)

protein self-association (ISO)

transcription factor binding (IPI)

transcription regulator inhibitor activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

interleukin-3 signaling pathway (ISO)

transforming growth factor-beta superfamily mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Regeneration of three layers vascular wall by using BMP2-treated MSC involving HIF-1alpha and Id1 expressions through JAK/STAT pathways.	Belmokhtar K, etal., Stem Cell Rev. 2011 Nov;7(4):847-59. doi: 10.1007/s12015-011-9254-6.
2.	TGF-beta repression of Id2 induces apoptosis in gut epithelial cells.	Cao Y, etal., Oncogene. 2009 Feb 26;28(8):1089-98. doi: 10.1038/onc.2008.456. Epub 2009 Jan 12.
3.	Bone morphogenetic protein 4, inhibitor of differentiation 1, and epidermal growth factor receptor regulate the survival of cochlear sensory epithelial cells.	Chen J, etal., J Neurosci Res. 2013 Apr;91(4):515-26. doi: 10.1002/jnr.23175. Epub 2013 Jan 18.
4.	Regulation of Id1 and its association with basic helix-loop-helix proteins during nerve growth factor-induced differentiation of PC12 cells.	Einarson MB and Chao MV, Mol Cell Biol. 1995 Aug;15(8):4175-83.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	A centrosomal Cdc20-APC pathway controls dendrite morphogenesis in postmitotic neurons.	Kim AH, etal., Cell. 2009 Jan 23;136(2):322-36.
8.	Id1, Id2 and Id3 are induced in rat melanotrophs of the pituitary gland by dopamine suppression under continuous stress.	Konishi H, etal., Neuroscience. 2010 Sep 15;169(4):1527-34. doi: 10.1016/j.neuroscience.2010.06.030. Epub 2010 Jun 20.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Activation of helix-loop-helix proteins Id1, Id2 and Id3 during neural differentiation.	Nagata Y and Todokoro K, Biochem Biophys Res Commun 1994 Mar 30;199(3):1355-62.
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	Id1 Promotes Obesity by Suppressing Brown Adipose Thermogenesis and White Adipose Browning.	Patil M, etal., Diabetes. 2017 Jun;66(6):1611-1625. doi: 10.2337/db16-1079. Epub 2017 Mar 7.
13.	Requirement for Id1 in opioid-induced oligodendrogenesis in cultured adult rat hippocampal progenitors.	Persson AI, etal., Eur J Neurosci. 2006 May;23(9):2277-88.
14.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
15.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
16.	The ubiquitin receptor S5a/Rpn10 links centrosomal proteasomes with dendrite development in the mammalian brain.	Puram SV, etal., Cell Rep. 2013 Jul 11;4(1):19-30. doi: 10.1016/j.celrep.2013.06.006. Epub 2013 Jul 3.
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	Transcriptional regulation in cardiac muscle. Coordinate expression of Id with a neonatal phenotype during development and following a hypertrophic stimulus in adult rat ventricular myocytes in vitro.	Springhorn JP, etal., J Biol Chem 1992 Jul 15;267(20):14360-5.
19.	Posttranscriptional regulation of Id1 activity in cardiac muscle. Alternative splicing of novel Id1 transcript permits homodimerization.	Springhorn JP, etal., J Biol Chem 1994 Feb 18;269(7):5132-6.
20.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
21.	Id1, Id2, and Id3 gene expression in neural cells during development.	Tzeng SF and de Vellis J, Glia. 1998 Dec;24(4):372-81.
22.	Upregulation of the HLH Id gene family in neural progenitors and glial cells of the rat spinal cord following contusion injury.	Tzeng SF, etal., J Neurosci Res. 2001 Dec 15;66(6):1161-72.
23.	Regulation of E-box DNA binding during in vivo and in vitro activation of rat and human hepatic stellate cells.	Vincent KJ, etal., Gut. 2001 Nov;49(5):713-9.
24.	Integrated microarray analysis provided novel insights to the pathogenesis of glaucoma.	Wang J, etal., Mol Med Rep. 2017 Dec;16(6):8735-8746. doi: 10.3892/mmr.2017.7711. Epub 2017 Oct 4.
25.	Id1 is a critical mediator in TGF-beta-induced transdifferentiation of rat hepatic stellate cells.	Wiercinska E, etal., Hepatology. 2006 May;43(5):1032-41.
26.	Smad-dependent and smad-independent induction of id1 by prostacyclin analogues inhibits proliferation of pulmonary artery smooth muscle cells in vitro and in vivo.	Yang J, etal., Circ Res. 2010 Jul 23;107(2):252-62. doi: 10.1161/CIRCRESAHA.109.209940. Epub 2010 Jun 3.
27.	CCN1 promotes the differentiation of endothelial progenitor cells and reendothelialization in the early phase after vascular injury.	Yu Y, etal., Basic Res Cardiol. 2010 Nov;105(6):713-24. doi: 10.1007/s00395-010-0117-0. Epub 2010 Sep 10.

Additional References at PubMed

PMID:1922066	PMID:7864897	PMID:8889548	PMID:9013644	PMID:9418957	PMID:12477932	PMID:12495223	PMID:12498716	PMID:15138269	PMID:15161906	PMID:15322112	PMID:15361847
PMID:15472070	PMID:15564458	PMID:15647457	PMID:15809768	PMID:15820682	PMID:16304207	PMID:16638616	PMID:16728343	PMID:17149750	PMID:17681138	PMID:17717145	PMID:19217292
PMID:19796622	PMID:20231428	PMID:22139302	PMID:25010525	PMID:25502463	PMID:27127787	PMID:29721855

Genomics

Comparative Map Data

Id1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	141,210,666 - 141,212,420 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	141,211,267 - 141,212,419 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	145,116,210 - 145,117,337 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	153,700,048 - 153,701,175 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	151,439,728 - 151,440,855 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	148,214,623 - 148,216,715 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	148,215,540 - 148,216,718 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	154,619,728 - 154,621,190 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	143,086,162 - 143,087,289 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	142,991,791 - 142,992,906 (+)	NCBI
Celera	3	139,960,608 - 139,961,735 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

ID1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	31,605,289 - 31,606,510 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	20	31,605,283 - 31,606,515 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	30,193,092 - 30,194,313 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	29,656,753 - 29,657,974 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	29,656,752 - 29,657,974	NCBI
Celera	20	26,949,273 - 26,950,494 (+)	NCBI		Celera
Cytogenetic Map	20	q11.21	NCBI
HuRef	20	26,981,781 - 26,983,013 (+)	NCBI		HuRef
CHM1_1	20	30,096,962 - 30,098,194 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	33,329,528 - 33,330,749 (+)	NCBI		T2T-CHM13v2.0

Id1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	152,578,171 - 152,579,330 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	152,578,171 - 152,579,330 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	152,736,251 - 152,737,410 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	152,736,251 - 152,737,410 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	152,562,010 - 152,563,146 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	152,427,715 - 152,428,851 (+)	NCBI		MGSCv36	mm8
Celera	2	158,552,315 - 158,553,451 (+)	NCBI		Celera
Cytogenetic Map	2	H1	NCBI
cM Map	2	75.41	NCBI

Id1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	29,337,757 - 29,339,178 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	29,337,969 - 29,339,178 (-)	NCBI	ChiLan1.0	ChiLan1.0

ID1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	20	28,535,470 - 28,536,726 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	28,535,582 - 28,536,311 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	20	27,895,177 - 27,896,414 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

ID1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	21,094,339 - 21,096,276 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	21,094,755 - 21,096,276 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	20,741,568 - 20,743,501 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	21,780,949 - 21,782,885 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	21,781,704 - 21,782,885 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	21,059,018 - 21,060,951 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	21,163,982 - 21,165,918 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	21,594,218 - 21,596,151 (+)	NCBI		UU_Cfam_GSD_1.0

Id1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	170,179,346 - 170,180,525 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	18,610,665 - 18,612,059 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936485	18,610,721 - 18,611,889 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ID1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	35,316,514 - 35,317,736 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	35,316,518 - 35,317,742 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	40,187,160 - 40,188,384 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103247994
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	36,008,660 - 36,009,880 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	36,008,636 - 36,010,017 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	90,944,637 - 90,945,863 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Id1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	896,932 - 898,343 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624741	897,038 - 898,249 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Id1
8 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	391
Count of miRNA genes:	230
Interacting mature miRNAs:	270
Transcripts:	ENSRNOT00000029660
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	140069424	146976080	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat

Markers in Region

PMC156147P2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	141,211,531 - 141,211,611 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	148,215,827 - 148,215,906	NCBI	Rnor6.0
Rnor_5.0	3	154,620,302 - 154,620,381	UniSTS	Rnor5.0
RGSC_v3.4	3	143,086,401 - 143,086,480	UniSTS	RGSC3.4
Celera	3	139,960,847 - 139,960,926	UniSTS
Cytogenetic Map	3	q41	UniSTS

PMC305683P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	141,211,352 - 141,212,020 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	148,215,648 - 148,216,315	NCBI	Rnor6.0
Rnor_5.0	3	154,620,123 - 154,620,790	UniSTS	Rnor5.0
RGSC_v3.4	3	143,086,222 - 143,086,889	UniSTS	RGSC3.4
Celera	3	139,960,668 - 139,961,335	UniSTS
Cytogenetic Map	3	q41	UniSTS

PMC133998P5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	141,211,352 - 141,212,020 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	148,215,648 - 148,216,315	NCBI	Rnor6.0
Rnor_5.0	3	154,620,123 - 154,620,790	UniSTS	Rnor5.0
RGSC_v3.4	3	143,086,222 - 143,086,889	UniSTS	RGSC3.4
Celera	3	139,960,668 - 139,961,335	UniSTS
Cytogenetic Map	3	q41	UniSTS

PMC145454P3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	141,211,592 - 141,211,668 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	148,215,888 - 148,215,963	NCBI	Rnor6.0
Rnor_5.0	3	154,620,363 - 154,620,438	UniSTS	Rnor5.0
RGSC_v3.4	3	143,086,462 - 143,086,537	UniSTS	RGSC3.4
Celera	3	139,960,908 - 139,960,983	UniSTS
Cytogenetic Map	3	q41	UniSTS

PMC33181P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	141,211,344 - 141,212,059 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	148,215,640 - 148,216,354	NCBI	Rnor6.0
Rnor_5.0	3	154,620,115 - 154,620,829	UniSTS	Rnor5.0
RGSC_v3.4	3	143,086,214 - 143,086,928	UniSTS	RGSC3.4
Celera	3	139,960,660 - 139,961,374	UniSTS
Cytogenetic Map	3	q41	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	41	25	19	25	4	4	74	35	37	11	4
Low			16	16		16	4	7			4		4
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012797	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006235267	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AI073271	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC127448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D10862	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227540	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232676	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233336	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L23148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M86708	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000029660 ⟹ ENSRNOP00000052261

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	141,211,267 - 141,212,419 (+)	Ensembl
Rnor_6.0 Ensembl	3	148,215,540 - 148,216,718 (+)	Ensembl

RefSeq Acc Id:

NM_012797 ⟹ NP_036929

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	141,211,293 - 141,212,420 (+)	NCBI
Rnor_6.0	3	148,215,588 - 148,216,715 (+)	NCBI
Rnor_5.0	3	154,619,728 - 154,621,190 (+)	NCBI
RGSC_v3.4	3	143,086,162 - 143,087,289 (+)	RGD
Celera	3	139,960,608 - 139,961,735 (+)	RGD

Sequence:

show sequence

GCTCTCTTCTAACACCCTGTTCTCAGACTCCTCCGCGCCTCTCCGCCTGTCCTCAGGATCATGA
AGGTCGCCAGTAGCAGTGCCGCGGCCACCGCAGGCCCCAGCTGTTCGCTGAAGGCAGGCAGGAC
GGCGGGCGAAGTGGTGCTTGGTCTGTCGGAGCAAAGCGTTGCCATCTCGCGCTGCGCTGGGACG
CGCCTGCCCGCCTTGCTGGACGAACAGCAGGTGAACGTTCTGCTCTACGACATGAACGGCTGCT
ACTCACGCCTCAAGGAGCTGGTGCCTACCCTGCCTCAGAACCGCAAAGTGAGCAAGGTGGAGAT
ACTGCAGCATGTTATCGACTACATCAGGGACCTGCAGCTGGAGCTGAACTCTGAGTCTGAAGTC
GCGACCGCCGGAGGCCGGGGGCTGCCCGTCCGGGCCCCGCTCAGCACCCTGAACGGCGAGATCA
GTGCCTTGGCGGCCGAGGCGGCATGTGTTCCAGCCGACGACCGCATCTTGTGTCGCTGAGGCGG
CGCACTGAGGAACCAGATGGACTCCAGCCCTTCAGGAGGCAAGAGGAAAAAAAGTGCTCTCGGT
TCCCCAGAGCAACCCGGGGAAAGACACTACCGCGGCCACGGGACTCTTGACGGATCTGTCCAGG
GGGTAGAGGGTTGATCAACGGAGTCTCGCCCTCTCCACCTTTCAGCCTCCAGAGACTTTGAGGA
GGGGGTTATTCAACCCCGTGTGTTTCTGTTTTTTTGAAAAAGCAGACATTTTTTTTAAATGGTC
ACATTTCGTGCTTCTCAGATTTCTGAGAAAATGTTTTGTATTGTATATTACAATGATCACTGGC
TGAGAATATTGTTTTACAATAGTTCTTATGGGGGTGGGTTTTTTGTTGTTATTAAACAAACACT
TTAGATAACGTAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006235267 ⟹ XP_006235329

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	141,210,666 - 141,212,417 (+)	NCBI
Rnor_6.0	3	148,214,623 - 148,216,712 (+)	NCBI
Rnor_5.0	3	154,619,728 - 154,621,190 (+)	NCBI

Sequence:

show sequence

CCCTTTCTGCAAAAGGCTGCAAATCCAGGGTAGAACTGGGGTCTGTAGTCCCACTCCACCGCGA
CCCTCTATCTAGTTCAGGTCTCAGATTCTGCCGCTTTAAAGAGGTTCCTAGTATCTCTTCCAGT
TCAACTGGCCTAGGTCCTGGATCTAGGGACTTTACAGTTCATTTTCTAGAAACTGAGTCAGACG
CGGAGTTCAAAGTAAAAGGGAGCCTGCTTAAAAAATCTGTCTCAAAACATGATGTGGCAGAGCA
CACCCGTGATTCAGAGCAAGGAACATCTTAATTTTAAGGTCATCTACCGCTAGCTACATAGCAA
GTTCCCAGTCTAGCATGGGCTAAAGTTACATGAGACTCTTAAAAAAAAAAAATCAGCGGGGTTG
GGGATTTAGCTCAGTGGTAGAGCGCTTGCCTAGCAAGCTCAAGGCCCTGGGTTCAGGCCCCAGC
TCCGAAAAAAAAAAAAAAAATCAGCAAACCCTCAAAAGTAAATAAATATAAAAATAAAATTCGG
CTTTTTAATAAGTAAAGATCACAGCCCAGTCTTCCAACAGCATCTGGGAGTCCTTGGCTAGTCC
TGAGTCACTGGCCAACCCAGGGCCAACCTGGTTCCTGTTTCATCTGCAAAATGGACCTGGAGAT
GTGAGAAAGAGACAGTGAGAAGCTGATTCCTGGGGTCTTTTTGTTAACTGCCAATATTAGCTTA
GCCTCTGCTTCCTTAAGGAAGAGCCCACTAACTGCTCTGCCTATGCCCTCCCACCCTCTCAGTT
CTTGAGACCCACCACCTCCCCATCAGCCTAAGGGTGTACTAGTAGATCCAGAGGTGGGACCGGA
GGGCAAGCTAAGTCACGCCTCCAGCAACCTATTGGTTGCTTTTGAACGTTCTGAACCCGCCCTG
GGTCCGCCCTTATAAAAGGCTGGCCCCAGAGCTGAGCCTACTCATTGTACAACCTTTCTCCAAC
TGCTTGCTCTCTTCTAACACCCTGTTCTCAGACTCCTCCGCGCCTCTCCGCCTGTCCTCAGGAT
CATGAAGGTCGCCAGTAGCAGTGCCGCGGCCACCGCAGGCCCCAGCTGTTCGCTGAAGGCAGGC
AGGACGGCGGGCGAAGTGGTGCTTGGTCTGTCGGAGCAAAGCGTTGCCATCTCGCGCTGCGCTG
GGACGCGCCTGCCCGCCTTGCTGGACGAACAGCAGGTGAACGTTCTGCTCTACGACATGAACGG
CTGCTACTCACGCCTCAAGGAGCTGGTGCCTACCCTGCCTCAGAACCGCAAAGTGAGCAAGGTG
GAGATACTGCAGCATGTTATCGACTACATCAGGGACCTGCAGCTGGAGCTGAACTCTGAGTCTG
AAGTCGCGACCGCCGGAGGCCGGGGGCTGCCCGTCCGGGCCCCGCTCAGCACCCTGAACGGCGA
GATCAGTGCCTTGGCGGCCGAGGTGAGGCGGCATGTGTTCCAGCCGACGACCGCATCTTGTGTC
GCTGAGGCGGCGCACTGAGGAACCAGATGGACTCCAGCCCTTCAGGAGGCAAGAGGAAAAAAAG
TGCTCTCGGTTCCCCAGAGCAACCCGGGGAAAGACACTACCGCGGCCACGGGACTCTTGACGGA
TCTGTCCAGGGGGTAGAGGGTTGATCAACGGAGTCTCGCCCTCTCCACCTTTCAGCCTCCAGAG
ACTTTGAGGAGGGGGTTATTCAACCCCGTGTGTTTCTGTTTTTTTGAAAAAGCAGACATTTTTT
TTAAATGGTCACATTTCGTGCTTCTCAGATTTCTGAGAAAATGTTTTGTATTGTATATTACAAT
GATCACTGGCTGAGAATATTGTTTTACAATAGTTCTTATGGGGGTGGGTTTTTTGTTGTTATTA
AACAAACACTTTAGATAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_036929	(Get FASTA)	NCBI Sequence Viewer
	XP_006235329	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA20403	(Get FASTA)	NCBI Sequence Viewer
	AAA41090	(Get FASTA)	NCBI Sequence Viewer
	AAI27449	(Get FASTA)	NCBI Sequence Viewer
	BAA01633	(Get FASTA)	NCBI Sequence Viewer
	EDL86049	(Get FASTA)	NCBI Sequence Viewer
	EDL86050	(Get FASTA)	NCBI Sequence Viewer
	P41135	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_036929 ⟸ NM_012797
- UniProtKB:	P41135 (UniProtKB/Swiss-Prot), A0JPJ2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKVASSSAAATAGPSCSLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLYDMNG CYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVATAGGRGLPVRAPLSTLNGE ISALAAEAACVPADDRILCR hide sequence

RefSeq Acc Id:	XP_006235329 ⟸ XM_006235267
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2QPI3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKVASSSAAATAGPSCSLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLYDMNG CYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVATAGGRGLPVRAPLSTLNGE ISALAAEVRRHVFQPTTASCVAEAAH hide sequence

RefSeq Acc Id:

ENSRNOP00000052261 ⟸ ENSRNOT00000029660

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P41135-F1-model_v2	AlphaFold	P41135	1-164	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692549

Promoter ID:

EPDNEW_R3073

Type:

single initiation site

Name:

Id1_1

Description:

inhibitor of DNA binding 1, HLH protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	148,215,562 - 148,215,622	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2858	AgrOrtholog
BioCyc Gene	G2FUF-47250	BioCyc
Ensembl Genes	ENSRNOG00000021750	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000052261	ENTREZGENE
	ENSRNOP00000052261.3	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000029660	ENTREZGENE
	ENSRNOT00000029660.6	UniProtKB/TrEMBL
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8372348	IMAGE-MGC_LOAD
InterPro	bHLH_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	DNA-bd_prot-inh	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25261	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:156482	IMAGE-MGC_LOAD
NCBI Gene	25261	ENTREZGENE
PANTHER	DNA-BINDING PROTEIN INHIBITOR ID-1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11723	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Id1	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47459	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC204468
UniProt	A0A8L2QPI3	ENTREZGENE, UniProtKB/TrEMBL
	A0JPJ2	ENTREZGENE, UniProtKB/TrEMBL
	ID1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-10-13	Id1	inhibitor of DNA binding 1	Id1	inhibitor of DNA binding 1, HLH protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-15	Id1	inhibitor of DNA binding 1, HLH protein	Id1	inhibitor of DNA binding 1, dominant negative helix-loop-helix protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-25	Id1	inhibitor of DNA binding 1, dominant negative helix-loop-helix protein	Id1	inhibitor of DNA binding 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Id1	inhibitor of DNA binding 1		Inhibitor of DNA binding 1, helix-loop-helix protein (splice variation)	Name updated	1299863	APPROVED
2002-06-10	Id1	Inhibitor of DNA binding 1, helix-loop-helix protein (splice variation)			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_process	may be involved in control of cardiac muscle cell phenotype	727553
gene_process	may be involved in the early stage of neural differentiation	729182

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)