Myod1 (myogenic differentiation 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| FTP Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References FTP Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Myod1 (myogenic differentiation 1) Mus musculus

Analyze

Symbol:

Myod1

Name:

myogenic differentiation 1

RGD ID:

1332500

MGI Page

MGI

Description:

Exhibits several functions, including DNA binding activity; DNA-binding transcription activator activity, RNA polymerase II-specific; and RNA polymerase II activating transcription factor binding activity. Contributes to DNA binding activity. Involved in several processes, including cellular response to lipid; histone acetylation; and myotube differentiation. Localizes to myofibril; nuclear euchromatin; and transcription regulator complex. Is expressed in several structures, including alimentary system; branchial arch; embryo mesenchyme; limb; and musculature. Orthologous to human MYOD1 (myogenic differentiation 1); INTERACTS WITH 1,2-dimethylhydrazine; 17beta-estradiol; 17beta-hydroxy-5alpha-androstan-3-one.

Type:

protein-coding

RefSeq Status:

VALIDATED

Also known as:

AI503393; bHLHc; bHLHc1; MYF3; Myo; myoblast determination protein 1; MyoD; Myod-; Myod-1

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MYOD1 (myogenic differentiation 1)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Myod1 (myogenic differentiation 1)	HGNC	Treefam, EggNOG, OrthoMCL, NCBI, OMA, HomoloGene, Inparanoid, Panther, OrthoDB, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	Myod1 (myogenic differentiation 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MYOD1 (myogenic differentiation 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MYOD1 (myogenic differentiation 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Myod1 (myogenic differentiation 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MYOD1 (myogenic differentiation 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	LOC103239432 (myoblast determination protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Myod1 (myogenic differentiation 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Myod1 (myogenic differentiation 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|TreeFam)
Homo sapiens (human):	MYOD1 (myogenic differentiation 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Danio rerio (zebrafish):	myod1 (myogenic differentiation 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam\|ZFIN)
Caenorhabditis elegans (roundworm):	hlh-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|Roundup\|TreeFam)
Drosophila melanogaster (fruit fly):	nau	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	46,025,898 - 46,028,516 (+)	NCBI	GRCm39		mm39
GRCm38	7	46,376,474 - 46,379,092 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	46,376,474 - 46,379,099 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	53,631,844 - 53,634,462 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	7	46,244,524 - 46,247,137 (+)	NCBI			mm8
Celera	7	41,849,969 - 41,852,587 (+)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	30.03	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

centronuclear myopathy 1 (ISO)

congenital diaphragmatic hernia (ISO)

congestive heart failure (ISO)

Diaphragmatic Hernia (ISO)

embryonal rhabdomyosarcoma (ISO)

Experimental Arthritis (ISO)

hypertension (ISO)

MYOPATHY, CONGENITAL, WITH DIAPHRAGMATIC DEFECTS, RESPIRATORY INSUFFICIENCY, AND DYSMORPHIC FACIES (ISO)

obesity (ISO)

Prenatal Exposure Delayed Effects (ISO)

Skeletal Muscle Injuries (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

1,2-dimethylhydrazine (EXP)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

3,4-methylenedioxymethamphetamine (EXP)

4,4'-sulfonyldiphenol (EXP)

5-azacytidine (EXP,ISO)

5-fluorouracil (EXP)

acetic acid (EXP)

aflatoxin B1 (ISO)

ammonium chloride (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

boric acid (ISO)

Botulinum toxin type A (ISO)

bromochloroacetic acid (EXP)

bupivacaine (ISO)

butanal (ISO)

carmustine (ISO)

chromium atom (ISO)

Diacetylmonoxime (EXP)

dimethylarsinous acid (EXP)

genistein (ISO)

indinavir (EXP)

indoxyl sulfate (EXP)

isotretinoin (ISO)

lamivudine (EXP)

latrunculin B (EXP)

leflunomide (EXP)

ML-7 (EXP)

nitrofen (ISO)

Ptaquiloside (EXP)

raloxifene (ISO)

resveratrol (EXP)

salubrinal (EXP)

saquinavir (EXP)

SB 203580 (EXP)

sirolimus (EXP)

sodium arsenite (EXP)

spermine (EXP)

tamoxifen (ISO)

testosterone (EXP)

valproic acid (EXP)

zidovudine (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cardiac muscle cell differentiation (NAS)

cell differentiation (IEA)

cellular response to estradiol stimulus (IDA)

cellular response to glucocorticoid stimulus (IDA)

cellular response to oxygen levels (IDA)

cellular response to starvation (IDA)

cellular response to tumor necrosis factor (IDA)

histone H3 acetylation (IDA)

histone H4 acetylation (IDA)

multicellular organism development (IEA)

muscle organ development (IDA,IGI)

myoblast differentiation (IDA)

myoblast fate determination (IDA)

myoblast fusion (IMP)

myotube cell development (ISO)

myotube differentiation (IDA)

myotube differentiation involved in skeletal muscle regeneration (IMP)

negative regulation of chromatin binding (IDA,IMP)

negative regulation of myoblast proliferation (IMP)

positive regulation of binding (IDA,IMP)

positive regulation of muscle cell differentiation (IDA,ISO)

positive regulation of myoblast differentiation (IBA)

positive regulation of myoblast fusion (ISO)

positive regulation of skeletal muscle fiber development (IBA)

positive regulation of skeletal muscle tissue regeneration (IMP)

positive regulation of snRNA transcription by RNA polymerase II (IMP)

positive regulation of transcription by RNA polymerase II (IDA,IGI,IMP,ISO)

positive regulation of transcription, DNA-templated (IDA)

regulation of alternative mRNA splicing, via spliceosome (IDA,IMP)

regulation of gene expression (IDA)

regulation of RNA splicing (ISO)

regulation of transcription by RNA polymerase II (IBA,IDA)

regulation of transcription, DNA-templated (IEA)

response to muscle stretch (ISO)

skeletal muscle atrophy (ISO)

skeletal muscle cell differentiation (IBA,IDA,IMP,NAS)

skeletal muscle fiber adaptation (IMP)

skeletal muscle fiber development (IMP)

skeletal muscle tissue development (IDA,IGI,IMP,TAS)

skeletal muscle tissue regeneration (IDA,IMP,ISO)

striated muscle cell differentiation (IMP)

Cellular Component

chromatin (IDA)

cytoplasm (IDA)

euchromatin (IDA)

myofibril (IDA)

nucleoplasm (ISO,TAS)

nucleus (IDA,ISO,TAS)

transcription regulator complex (IDA)

Molecular Function

chromatin binding (IDA)

chromatin DNA binding (IDA)

cis-regulatory region sequence-specific DNA binding (IDA)

DNA binding (IDA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IDA,IMP,ISO)

DNA-binding transcription factor activity (IDA,IMP)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,TAS)

E-box binding (IDA,ISO)

enzyme binding (IPI)

nuclear hormone receptor binding (ISO)

promoter-specific chromatin binding (IDA)

protein binding (IPI,ISO)

protein dimerization activity (IEA)

protein homodimerization activity (IDA)

RNA polymerase II activating transcription factor binding (IPI)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IDA)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO)

sequence-specific DNA binding (IDA)

sequence-specific double-stranded DNA binding (ISO)

transcription factor binding (IPI)

ubiquitin protein ligase binding (IPI)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal adipose tissue distribution (IAGP)

abnormal heart ventricle morphology (IAGP)

abnormal muscle development (IAGP)

abnormal muscle morphology (IAGP)

abnormal muscle physiology (IAGP)

abnormal myogenesis (IAGP)

abnormal myotube morphology (IAGP)

abnormal rib morphology (IAGP)

abnormal skeletal muscle regeneration (IAGP)

absent skeletal muscle (IAGP)

cardiac fibrosis (IAGP)

cardiac interstitial fibrosis (IAGP)

centrally nucleated skeletal muscle fibers (IAGP)

decreased body size (IAGP)

decreased fetal size (IAGP)

decreased litter size (IAGP)

decreased physiological sensitivity to xenobiotic (IAGP)

decreased satellite cell number (IAGP)

decreased skeletal muscle fiber number (IAGP)

dilated cardiomyopathy (IAGP)

enlarged myocardial fiber (IAGP)

increased heart weight (IAGP)

increased sarcoma incidence (IAGP)

increased satellite cell number (IAGP)

increased tumor incidence (IAGP)

kyphosis (IAGP)

muscle hypoplasia (IAGP)

myocardium necrosis (IAGP)

neonatal lethality, complete penetrance (IAGP)

no abnormal phenotype detected (IAGP)

postnatal lethality (IAGP)

postnatal lethality, complete penetrance (IAGP)

premature death (IAGP)

respiratory failure (IAGP)

References

References - curated


1.	Castillero E, etal., Endocr Connect. 2012 Jun 8;1(1):1-12. doi: 10.1530/EC-12-0003. Print 2012 Jul 1.
2.	Dingemann J, etal., Pediatr Surg Int. 2011 Jun;27(6):579-82. doi: 10.1007/s00383-010-2834-8.
3.	MGD and Homologene mouse data transfer
4.	MGD data from the GO Consortium
5.	MGD IEA
6.	Miyazaki M, etal., PLoS One. 2011;6(11):e27168. doi: 10.1371/journal.pone.0027168. Epub 2011 Nov 4.
7.	Nakasa T, etal., J Cell Mol Med. 2010 Oct;14(10):2495-505. doi: 10.1111/j.1582-4934.2009.00898.x.
8.	Peterson JM, etal., Am J Physiol Cell Physiol. 2008 Aug;295(2):C521-8. Epub 2008 May 28.
9.	RGD automated import pipeline
10.	RGD automated import pipeline for gene-chemical interactions
11.	Santos DP, etal., Growth Horm IGF Res. 2010 Apr;20(2):149-55. doi: 10.1016/j.ghir.2009.11.007. Epub 2010 Jan 8.
12.	Zhou D, etal., Obesity (Silver Spring). 2012 Aug;20(8):1577-84. doi: 10.1038/oby.2012.42. Epub 2012 Feb 21.

Additional References at PubMed

PMID:1303276	PMID:1309507	PMID:1311614	PMID:1315077	PMID:1324843	PMID:1330322	PMID:1347472	PMID:1348494	PMID:1374351	PMID:1406681	PMID:1618140	PMID:1618148
PMID:1652425	PMID:1668275	PMID:1673668	PMID:1754380	PMID:1846704	PMID:1850513	PMID:1911647	PMID:1970795	PMID:1981054	PMID:1989904	PMID:2045411	PMID:2176177
PMID:2315312	PMID:2503252	PMID:2552320	PMID:2748593	PMID:3175662	PMID:3286015	PMID:3690668	PMID:7532173	PMID:7556922	PMID:7588068	PMID:7589813	PMID:7590262
PMID:7601470	PMID:7607707	PMID:7659522	PMID:7698755	PMID:7720554	PMID:7720572	PMID:7720708	PMID:7787235	PMID:7797078	PMID:7824267	PMID:7835903	PMID:7863329
PMID:7929574	PMID:7940021	PMID:8001787	PMID:8020965	PMID:8026334	PMID:8034307	PMID:8035824	PMID:8076526	PMID:8095242	PMID:8095339	PMID:8125164	PMID:8136524
PMID:8162858	PMID:8181063	PMID:8269513	PMID:8288260	PMID:8294401	PMID:8383334	PMID:8393145	PMID:8400402	PMID:8404542	PMID:8421497	PMID:8452817	PMID:8482411
PMID:8565825	PMID:8565855	PMID:8573720	PMID:8575308	PMID:8587605	PMID:8601493	PMID:8601494	PMID:8617206	PMID:8627340	PMID:8631261	PMID:8633043	PMID:8675005
PMID:8681797	PMID:8759016	PMID:8797820	PMID:8812484	PMID:8837770	PMID:8866021	PMID:8901056	PMID:8903733	PMID:8950513	PMID:8999959	PMID:9011744	PMID:9029156
PMID:9039266	PMID:9050988	PMID:9060416	PMID:9061445	PMID:9076685	PMID:9094721	PMID:9106663	PMID:9118475	PMID:9172305	PMID:9184158	PMID:9216993	PMID:9226440
PMID:9234731	PMID:9268575	PMID:9284043	PMID:9284044	PMID:9343420	PMID:9344650	PMID:9359635	PMID:9368741	PMID:9374397	PMID:9382869	PMID:9407021	PMID:9428409
PMID:9438383	PMID:9488722	PMID:9520323	PMID:9525963	PMID:9528857	PMID:9585504	PMID:9609818	PMID:9659901	PMID:9664688	PMID:9808779	PMID:9811581	PMID:9833687
PMID:9874799	PMID:9986734	PMID:10037786	PMID:10072440	PMID:10075840	PMID:10075844	PMID:10079229	PMID:10199981	PMID:10208749	PMID:10322110	PMID:10349636	PMID:10357902
PMID:10392718	PMID:10403250	PMID:10439029	PMID:10457014	PMID:10508520	PMID:10512192	PMID:10556048	PMID:10590474	PMID:10603349	PMID:10603357	PMID:10635459	PMID:10652346
PMID:10656756	PMID:10669094	PMID:10694423	PMID:10725239	PMID:10733231	PMID:10751147	PMID:10794165	PMID:10804168	PMID:10926754	PMID:10974667	PMID:10985858	PMID:11036096
PMID:11042159	PMID:11044626	PMID:11060232	PMID:11066097	PMID:11076861	PMID:11171399	PMID:11201041	PMID:11217851	PMID:11285237	PMID:11447261	PMID:11455436	PMID:11458388
PMID:11493522	PMID:11525743	PMID:11532390	PMID:11562355	PMID:11570822	PMID:11684023	PMID:11700944	PMID:11711431	PMID:11714687	PMID:11718554	PMID:11784080	PMID:11809751
PMID:11819203	PMID:11839816	PMID:11931766	PMID:11940648	PMID:11969267	PMID:12015303	PMID:12023284	PMID:12032356	PMID:12037571	PMID:12037670	PMID:12115029	PMID:12135755
PMID:12162885	PMID:12167713	PMID:12184991	PMID:12242286	PMID:12244043	PMID:12372284	PMID:12415271	PMID:12421714	PMID:12427866	PMID:12441290	PMID:12441295	PMID:12466851
PMID:12477932	PMID:12485625	PMID:12486129	PMID:12493912	PMID:12619134	PMID:12657651	PMID:12665587	PMID:12668636	PMID:12694204	PMID:12705871	PMID:12782625	PMID:12798290
PMID:12802082	PMID:12812790	PMID:12832540	PMID:12861012	PMID:12878168	PMID:12887892	PMID:12895031	PMID:12941952	PMID:12948444	PMID:14499644	PMID:14504233	PMID:14517256
PMID:14595115	PMID:14623241	PMID:14660660	PMID:14667415	PMID:14681479	PMID:14706073	PMID:14732408	PMID:14749395	PMID:14754880	PMID:14762206	PMID:14769817	PMID:15020674
PMID:15075292	PMID:15132998	PMID:15138500	PMID:15149596	PMID:15169898	PMID:15173318	PMID:15183306	PMID:15189813	PMID:15192231	PMID:15233999	PMID:15254975	PMID:15282310
PMID:15286803	PMID:15351717	PMID:15366017	PMID:15366018	PMID:15376315	PMID:15385444	PMID:15386014	PMID:15466486	PMID:15489287	PMID:15497153	PMID:15520228	PMID:15531760
PMID:15563453	PMID:15568017	PMID:15572127	PMID:15604102	PMID:15618518	PMID:15634692	PMID:15653949	PMID:15706034	PMID:15719023	PMID:15729689	PMID:15739233	PMID:15743821
PMID:15746098	PMID:15788460	PMID:15804569	PMID:15843801	PMID:15844178	PMID:15857912	PMID:15870273	PMID:15888449	PMID:15890200	PMID:15937819	PMID:15964993	PMID:16007160
PMID:16007210	PMID:16024790	PMID:16040801	PMID:16129691	PMID:16141072	PMID:16141073	PMID:16166380	PMID:16183241	PMID:16193506	PMID:16208536	PMID:16219688	PMID:16245309
PMID:16267055	PMID:16275751	PMID:16323077	PMID:16368089	PMID:16387292	PMID:16405903	PMID:16424906	PMID:16437161	PMID:16452092	PMID:16461349	PMID:16500621	PMID:16584724
PMID:16598734	PMID:16638982	PMID:16705021	PMID:16797743	PMID:16847330	PMID:16858404	PMID:16901893	PMID:16951257	PMID:16952014	PMID:17011493	PMID:17028574	PMID:17030984
PMID:17043109	PMID:17098221	PMID:17107996	PMID:17111365	PMID:17138667	PMID:17166778	PMID:17194759	PMID:17275805	PMID:17289022	PMID:17295338	PMID:17330803	PMID:17331176
PMID:17352741	PMID:17360543	PMID:17377068	PMID:17384148	PMID:17428829	PMID:17436272	PMID:17477400	PMID:17487425	PMID:17506979	PMID:17540357	PMID:17553906	PMID:17569791
PMID:17592144	PMID:17652354	PMID:17684061	PMID:17693064	PMID:17761773	PMID:17785180	PMID:17855775	PMID:17875930	PMID:17881575	PMID:17904117	PMID:17919536	PMID:17932502
PMID:17940048	PMID:17940050	PMID:17959144	PMID:17961534	PMID:17965412	PMID:18047787	PMID:18065432	PMID:18078839	PMID:18215268	PMID:18243171	PMID:18253507	PMID:18255059
PMID:18287559	PMID:18316399	PMID:18331721	PMID:18334251	PMID:18367555	PMID:18415939	PMID:18424556	PMID:18442487	PMID:18511457	PMID:18513743	PMID:18557763	PMID:18593883
PMID:18619954	PMID:18676376	PMID:18719582	PMID:18795097	PMID:18816441	PMID:18816853	PMID:18816858	PMID:18820033	PMID:18836078	PMID:18851836	PMID:18854138	PMID:19073597
PMID:19121967	PMID:19123137	PMID:19129464	PMID:19165827	PMID:19198652	PMID:19223199	PMID:19229108	PMID:19269978	PMID:19303854	PMID:19304887	PMID:19319192	PMID:19346403
PMID:19384958	PMID:19443691	PMID:19460349	PMID:19464281	PMID:19520072	PMID:19521566	PMID:19531352	PMID:19553684	PMID:19641492	PMID:19646513	PMID:19698141	PMID:19712265
PMID:19723804	PMID:19796622	PMID:19801895	PMID:19812254	PMID:19835856	PMID:19943111	PMID:19956724	PMID:20005263	PMID:20013826	PMID:20045680	PMID:20048262	PMID:20059953
PMID:20059958	PMID:20063414	PMID:20069545	PMID:20124407	PMID:20139084	PMID:20211142	PMID:20307260	PMID:20334626	PMID:20399744	PMID:20412779	PMID:20412780	PMID:20412781
PMID:20458750	PMID:20466877	PMID:20503368	PMID:20534536	PMID:20544915	PMID:20833138	PMID:20881014	PMID:20940258	PMID:20948544	PMID:20956306	PMID:20956382	PMID:20956524
PMID:20978076	PMID:21035439	PMID:21041476	PMID:21078671	PMID:21127072	PMID:21131290	PMID:21143873	PMID:21177349	PMID:21211521	PMID:21212806	PMID:21254332	PMID:21256960
PMID:21267068	PMID:21288905	PMID:21305318	PMID:21339173	PMID:21397010	PMID:21422169	PMID:21425413	PMID:21454680	PMID:21478499	PMID:21512107	PMID:21556048	PMID:21683695
PMID:21689628	PMID:21708977	PMID:21731673	PMID:21741963	PMID:21782525	PMID:21832073	PMID:21852201	PMID:21873635	PMID:21936881	PMID:21985497	PMID:21989910	PMID:22068056
PMID:22076929	PMID:22079119	PMID:22147266	PMID:22174917	PMID:22192089	PMID:22210883	PMID:22215600	PMID:22228095	PMID:22242125	PMID:22279050	PMID:22298038	PMID:22315423
PMID:22318627	PMID:22333916	PMID:22351927	PMID:22358842	PMID:22362755	PMID:22431088	PMID:22438570	PMID:22460713	PMID:22522309	PMID:22569126	PMID:22613845	PMID:22621191
PMID:22638570	PMID:22666383	PMID:22673621	PMID:22723526	PMID:22723710	PMID:22736793	PMID:22740650	PMID:22768305	PMID:22771117	PMID:22819676	PMID:22848585	PMID:22859371
PMID:22940113	PMID:22983009	PMID:22987639	PMID:22987640	PMID:23034633	PMID:23079662	PMID:23112163	PMID:23192345	PMID:23249738	PMID:23266826	PMID:23406902	PMID:23438194
PMID:23460641	PMID:23477786	PMID:23650549	PMID:23671652	PMID:23717575	PMID:23785297	PMID:23794713	PMID:23840772	PMID:23868259	PMID:23907538	PMID:23928680	PMID:23933088
PMID:23946446	PMID:23969310	PMID:23987512	PMID:23993744	PMID:24019467	PMID:24055173	PMID:24056763	PMID:24074615	PMID:24092238	PMID:24239359	PMID:24301466	PMID:24349514
PMID:24357723	PMID:24361185	PMID:24394376	PMID:24440912	PMID:24472550	PMID:24613379	PMID:24671706	PMID:24703692	PMID:24703953	PMID:24705356	PMID:24742196	PMID:24760765
PMID:24844572	PMID:24912677	PMID:24927569	PMID:24942009	PMID:25002401	PMID:25005473	PMID:25006242	PMID:25055037	PMID:25069613	PMID:25085416	PMID:25087979	PMID:25111334
PMID:25130140	PMID:25197048	PMID:25217815	PMID:25220152	PMID:25224227	PMID:25236433	PMID:25329411	PMID:25403490	PMID:25452432	PMID:25482443	PMID:25490265	PMID:25490270
PMID:25534856	PMID:25605943	PMID:25640239	PMID:25715398	PMID:25737281	PMID:25774500	PMID:25801030	PMID:25807280	PMID:25848030	PMID:26074812	PMID:26149774	PMID:26229056
PMID:26238020	PMID:26275053	PMID:26387456	PMID:26387956	PMID:26393505	PMID:26468207	PMID:26499038	PMID:26562264	PMID:26658965	PMID:26669898	PMID:26688546	PMID:26801181
PMID:26839363	PMID:26880551	PMID:26881702	PMID:26902638	PMID:26906734	PMID:26951610	PMID:26954549	PMID:26963625	PMID:26969076	PMID:27120339	PMID:27166947	PMID:27185876
PMID:27302134	PMID:27349543	PMID:27705798	PMID:27743478	PMID:27798115	PMID:27823936	PMID:27880908	PMID:27906130	PMID:27920252	PMID:27930960	PMID:27977683	PMID:27993983
PMID:28091529	PMID:28117277	PMID:28118982	PMID:28228264	PMID:28286175	PMID:28336234	PMID:28351977	PMID:28438836	PMID:28569745	PMID:28600496	PMID:28607151	PMID:28607928
PMID:28609469	PMID:28637957	PMID:28827394	PMID:28865032	PMID:28878038	PMID:28918507	PMID:28919111	PMID:28927261	PMID:28956216	PMID:28973166	PMID:28981706	PMID:28982687
PMID:29073096	PMID:29084951	PMID:29097153	PMID:29158520	PMID:29166613	PMID:29187383	PMID:29231808	PMID:29241530	PMID:29273440	PMID:29316425	PMID:29328071	PMID:29343749
PMID:29396429	PMID:29449644	PMID:29478898	PMID:29483576	PMID:29543863	PMID:29555813	PMID:29679560	PMID:29768404	PMID:29882512	PMID:30016497	PMID:30037979	PMID:30206360
PMID:30225906	PMID:30237319	PMID:30389854	PMID:30415659	PMID:30429366	PMID:30511745	PMID:30568302	PMID:30683662	PMID:30789342	PMID:30791960	PMID:30858352	PMID:30862660
PMID:30872276	PMID:30964448	PMID:30996264	PMID:31138662	PMID:31353205	PMID:31393265	PMID:31433978	PMID:31519520	PMID:31519691	PMID:31535973	PMID:31591561	PMID:31647919
PMID:31685980	PMID:31693883	PMID:31719045	PMID:31736098	PMID:31857580	PMID:32014863	PMID:32051546	PMID:32094117	PMID:32160556	PMID:32193486	PMID:32231311	PMID:32314958
PMID:32768399	PMID:33093635	PMID:33201874

Genomics

Comparative Map Data

Myod1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	46,025,898 - 46,028,516 (+)	NCBI	GRCm39		mm39
GRCm38	7	46,376,474 - 46,379,092 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	46,376,474 - 46,379,099 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	53,631,844 - 53,634,462 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	7	46,244,524 - 46,247,137 (+)	NCBI			mm8
Celera	7	41,849,969 - 41,852,587 (+)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	30.03	NCBI

MYOD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	11	17,719,571 - 17,722,136 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	11	17,719,571 - 17,722,136 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	11	17,741,118 - 17,743,683 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
GRCh37	11	17,741,110 - 17,743,678 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	17,697,686 - 17,700,254 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	11	17,697,734 - 17,700,254	NCBI
Celera	11	17,873,623 - 17,876,191 (+)	NCBI
Cytogenetic Map	11	p15.1	NCBI
HuRef	11	17,425,110 - 17,427,678 (+)	NCBI		HuRef
CHM1_1	11	17,740,837 - 17,743,405 (+)	NCBI		CHM1_1

Myod1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	96,884,864 - 96,887,574 (+)	NCBI
Rnor_6.0 Ensembl	1	102,396,538 - 102,399,248 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0	1	102,396,538 - 102,399,248 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	1	103,481,604 - 103,484,314 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	96,910,190 - 96,912,900 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	1	96,988,300 - 96,991,011 (+)	NCBI
Celera	1	91,133,211 - 91,135,921 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

Myod1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955414	32,523,924 - 32,526,674 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955414	32,523,959 - 32,526,575 (+)	NCBI	ChiLan1.0	ChiLan1.0

MYOD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	11	17,456,124 - 17,458,690 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	17,456,124 - 17,458,690 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	11	17,772,317 - 17,774,884 (+)	NCBI	Mhudiblu_PPA_v0		panPan3

MYOD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1 Ensembl	21	40,258,027 - 40,259,712 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1	21	40,257,792 - 40,260,461 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Myod1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
SpeTri2.0	NW_004936528	1,407,187 - 1,409,683 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MYOD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	41,415,735 - 41,425,234 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	41,422,522 - 41,424,236 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	44,483,015 - 44,484,730 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103239432
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	47,250,927 - 47,254,572 (-)	NCBI
ChlSab1.1 Ensembl	1	47,251,551 - 47,253,284 (-)	Ensembl

Myod1
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624766	9,345,390 - 9,347,985 (+)	NCBI

Position Markers

AI503393

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,378,759 - 46,378,877	UniSTS	GRCm38
MGSCv37	7	53,634,129 - 53,634,247	UniSTS	GRCm37
Celera	7	41,852,254 - 41,852,372	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS
Whitehead/MRC_RH	7	580.96	UniSTS

Myod1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
MGSCv37	7	53,632,524 - 53,633,777	UniSTS	GRCm37
MGSCv37	7	53,632,522 - 53,633,777	UniSTS	GRCm37
MGSCv37	7	53,631,861 - 53,632,250	UniSTS	GRCm37
Celera	7	41,849,986 - 41,850,375	UniSTS
Celera	7	41,850,649 - 41,851,902	UniSTS
Celera	7	41,850,647 - 41,851,902	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS
cM Map	7	23.5	UniSTS

PMC133998P3

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,377,038 - 46,377,806	UniSTS	GRCm38
MGSCv37	7	53,632,408 - 53,633,176	UniSTS	GRCm37
Celera	7	41,850,533 - 41,851,301	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

PMC151607P3

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,378,761 - 46,379,087	UniSTS	GRCm38
MGSCv37	7	53,634,131 - 53,634,457	UniSTS	GRCm37
Celera	7	41,852,256 - 41,852,582	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

PMC162217P1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,378,487 - 46,379,008	UniSTS	GRCm38
MGSCv37	7	53,633,857 - 53,634,378	UniSTS	GRCm37
Celera	7	41,851,982 - 41,852,503	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

PMC86965P5

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,376,360 - 46,376,514	UniSTS	GRCm38
MGSCv37	7	53,631,730 - 53,631,884	UniSTS	GRCm37
Celera	7	41,849,855 - 41,850,009	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

Myod1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

Myod1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	7	B4	UniSTS

Myod1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,377,152 - 46,378,407	UniSTS	GRCm38
MGSCv37	7	53,632,522 - 53,633,777	UniSTS	GRCm37
Celera	7	41,850,647 - 41,851,902	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

Myod1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,376,491 - 46,376,880	UniSTS	GRCm38
MGSCv37	7	53,631,861 - 53,632,250	UniSTS	GRCm37
Celera	7	41,849,986 - 41,850,375	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

Myod1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	7	46,377,154 - 46,378,407	UniSTS	GRCm38
MGSCv37	7	53,632,524 - 53,633,777	UniSTS	GRCm37
Celera	7	41,850,649 - 41,851,902	UniSTS
Cytogenetic Map	7	B4	UniSTS
cM Map	7	23.5	UniSTS

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300722	Sle3_m	systemic lupus erythmatosus susceptibility 3 (mouse)			Not determined		7	3463212	87493512	Mouse
38501068	Tip1_m	tuberculosis immunophenotype 1, spleen CFU (mouse)					7	3600000	72900000	Mouse
25314307	Mlh1fc2_m	MLH1 foci count 2 (mouse)					7	6500000	133900000	Mouse
10449139	Eosn1_m	eosinophil differential 1 (mouse)					7	12781452	46781452	Mouse
10449158	Eosn3_m	eosinophil differential 3 (mouse)					7	12781452	46781452	Mouse
4141566	Femwf8_m	femur work to failure 8 (mouse)			Not determined			13333060	47333196	Mouse
11522751	Cocia17_m	cocaine-induced activity, QTL 17 (mouse)					7	13435779	47435779	Mouse
25314314	Sccor1_m	synaptonemal complex length to mean MLH1 count ratio 1 (mouse)					7	13600000	47700000	Mouse
1559016	Drsi_m	DCC-related Spp1 induction (mouse)			Not determined		7	16903368	49509583	Mouse
10412199	Sst2_m	susceptibility to tuberculosis 2 (mouse)			Not determined		7	18994869	119886157	Mouse
1301158	Eae4_m	susceptibility to experimental allergic encephalomyelitis 4 (mouse)			Not determined		7	19413473	142366067	Mouse
1301622	Eae12_m	susceptibility to experimental allergic encephalomyelitis 12 (mouse)			Not determined		7	19580590	53580679	Mouse
1301052	Bhr6_m	bronchial hyperresponsiveness 6 (mouse)			Not determined		7	20142825	54142942	Mouse
12904742	Litsq2_m	litter size QTL 2 (mouse)					7	23024463	57024609	Mouse
1301709	Bdt4_m	bone density traits 4 (mouse)			Not determined		7	23239148	57239292	Mouse
11354952	Pdcc1_m	plasmacytoid dentritic cell compartment 1 (mouse)					7	23417107	57417107	Mouse
1301969	Lbw5_m	lupus NZB x NZW 5 (mouse)			Not determined		7	27198191	61202351	Mouse
12790989	Tgl6_m	triglyceride 6 (mouse)					7	27891125	61891125	Mouse
4141805	Sle19_m	systematic lupus erythematosus susceptibility 19 (mouse)			Not determined			30333060	81485905	Mouse
26884404	Huml1_m	humerus length 1, 5 week (mouse)					7	30500000	109400000	Mouse
1301175	Ap7q_m	alcohol preference 7 QTL (mouse)			Not determined		7	32065097	66065329	Mouse
1300996	Aorls2_m	aortic lesion size 2 (mouse)			Not determined		7	32744784	66744933	Mouse
4141909	W10q18_m	weight 10 weeks QTL 18 (mouse)			Not determined			33798302	58499217	Mouse
4142218	W6q17_m	weight 6 weeks QTL 17 (mouse)			Not determined			33798302	58499217	Mouse
4142102	Tailq5_m	tail length QTL 5 (mouse)			Not determined			33798302	58499217	Mouse
4142003	W3q10_m	weight 3 weeks QTL 10 (mouse)			Not determined			33798302	58499217	Mouse
1357469	Kidq5_m	kidney weight QTL 5 (mouse)			Not determined		7	33798302	58499217	Mouse
1357731	Lvrq6_m	liver weight QTL 6 (mouse)			Not determined		7	33798302	58499217	Mouse
1357634	Splq7_m	spleen weight QTL 7 (mouse)			Not determined		7	33798302	58499217	Mouse
1357883	Epfq5_m	epididymal fat pad weight QTL 5 (mouse)			Not determined		7	33798302	58499217	Mouse
39128210	Lwq19_m	liver weight QTL 19 (mouse)					7	33798302	58499217	Mouse
1559000	Ossc1_m	osteosarcoma susceptibility 1 (mouse)			Not determined		7	34403277	68403475	Mouse
38501071	Stsl6_m	Salmonella typhimurium susceptibility locus 6 (mouse)					7	34500000	51500000	Mouse
10045622	Heal20_m	wound healing/regeneration 20 (mouse)			Not determined		7	34667139	68667295	Mouse
1357586	Mdmsc3_m	modifier of muscularity 3 (mouse)			Not determined		7	34798121	68798270	Mouse
1301514	Rigs1_m	radiation induced gastroschisis 1 (mouse)			Not determined		7	36580590	92745138	Mouse
1301082	Bbaa16_m	B.burgdorferi-associated arthritis 16 (mouse)			Not determined		7	36580590	116817642	Mouse
25314301	Vmm3_m	variable multisystem mineralization 3, lung (mouse)					7	37600000	72400000	Mouse
25314303	Vmm4_m	variable multisystem mineralization 4, kidney (mouse)					7	37600000	87400000	Mouse
1300878	Skts1_m	skin tumor susceptibility 1 (mouse)			Not determined		7	38241638	72241834	Mouse
10402488	Dipa2_m	drug induced psychomotor activation 2 (mouse)			Not determined		7	38771800	72771936	Mouse
1300791	Abbp3_m	A/J and C57BL/6 blood pressure 3 (mouse)			Not determined		7	40024463	103860803	Mouse
4141929	Chlq18_m	circulating hormone level QTL 18 (mouse)			Not determined		7	41499072	75499217	Mouse
11252140	Fdr1_m	fat response to dietary restriction 1 (mouse)					7	41499072	75499217	Mouse
10043926	Bw1n_m	body weight 1 in NSY (mouse)			Not determined		7	45512542	119094307	Mouse
12880417	V125Dq5_m	vitamin D active form serum level QTL 5 (mouse)					7	45600000	79600000	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	444
Count of miRNA genes:	314
Interacting mature miRNAs:	347
Transcripts:	ENSMUST00000072514
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_010866	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC020786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK076157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK142859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466603	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M18779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M84918	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X61655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000072514 ⟹ ENSMUSP00000072330

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	7	46,376,474 - 46,379,099 (+)	Ensembl

RefSeq Acc Id:

NM_010866 ⟹ NP_034996

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	7	46,025,898 - 46,028,516 (+)	NCBI
GRCm38	7	46,376,474 - 46,379,092 (+)	ENTREZGENE
MGSCv37	7	53,631,844 - 53,634,462 (+)	RGD
Celera	7	41,849,969 - 41,852,587 (+)	RGD
cM Map	7		ENTREZGENE

Sequence:

show sequence

AGGGGCCAGGACGCCCCAGGACACGACTGCTTTCTTCACCACTCCTCTGACAGGACAGGACAGG
GAGGAGGGGTAGAGGACAGCCGGTGTGCATTCCAACCCACAGAACCTTTGTCATTGTACTGTTG
GGGTTCCGGAGTGGCAGAAAGTTAAGACGACTCTCACGGCTTGGGTTGAGGCTGGACCCAGGAA
CTGGGATATGGAGCTTCTATCGCCGCCACTCCGGGACATAGACTTGACAGGCCCCGACGGCTCT
CTCTGCTCCTTTGAGACAGCAGACGACTTCTATGATGACCCGTGTTTCGACTCACCAGACCTGC
GCTTTTTTGAGGACCTGGACCCGCGCCTGGTGCACATGGGAGCCCTCCTGAAACCGGAGGAGCA
CGCACACTTCCCTACTGCGGTGCACCCAGGCCCAGGCGCTCGTGAGGATGAGCATGTGCGCGCG
CCCAGCGGGCACCACCAGGCGGGTCGCTGCTTGCTGTGGGCCTGCAAGGCGTGCAAGCGCAAGA
CCACCAACGCTGATCGCCGCAAGGCCGCCACCATGCGCGAGCGCCGCCGCCTGAGCAAAGTGAA
TGAGGCCTTCGAGACGCTCAAGCGCTGCACGTCCAGCAACCCGAACCAGCGGCTACCCAAGGTG
GAGATCCTGCGCAACGCCATCCGCTACATCGAAGGTCTGCAGGCTCTGCTGCGCGACCAGGACG
CCGCGCCCCCTGGCGCCGCTGCCTTCTACGCACCTGGACCGCTGCCCCCAGGCCGTGGCAGCGA
GCACTACAGTGGCGACTCAGATGCATCCAGCCCGCGCTCCAACTGCTCTGATGGCATGATGGAT
TACAGCGGCCCCCCAAGCGGCCCCCGGCGGCAGAATGGCTACGACACCGCCTACTACAGTGAGG
CGGCGCGCGAGTCCAGGCCAGGGAAGAGTGCGGCTGTGTCGAGCCTCGACTGCCTGTCCAGCAT
AGTGGAGCGCATCTCCACAGACAGCCCCGCTGCGCCTGCGCTGCTTTTGGCAGATGCACCACCA
GAGTCGCCTCCGGGTCCGCCAGAGGGGGCATCCCTAAGCGACACAGAACAGGGAACCCAGACCC
CGTCTCCCGACGCCGCCCCTCAGTGTCCTGCAGGCTCAAACCCCAATGCGATTTATCAGGTGCT
TTGAGAGATCGACTGCAGCAGCAGAGGGCGCACCACCGTAGGCACTCCTGGGGATGGTGTCCCT
GGTTCTTCACGCCCAAAAGATGAAGCTTAAATGACACTCTTCCCAACTGTCCTTTCGAAGCCGT
TCTTCCAGAGGGAAGGGAAGAGCAGAAGTCTGTCCTAGATCCAGCCCCAAAGAAAGGACATAGT
CCTTTTTGTTGTTGTTGTTGTAGTCCTTCAGTTGTTTGTTTGTTTTTTCATGCGGCTCACAGCG
AAGGCCACTTGCACTCTGGCTGCACCTCACTGGGCCAGAGCTGATCCTTGAGTGGCCAGGCGCT
CTTCCTTTCCTCATAGCACAGGGGTGAGCCTTGCACACCTAAGCCCTGCCCTCCACATCCTTTT
GTTTGTCACTTTCTGGAGCCCTCCTGGCACCCACTTTTCCCCACAGCTTGCGGAGGCCACTCAG
GTCTCAGGTGTAACAGGTGTAACCATACCCCACTCTCCCCCTTCCCGCGGTTCAGGACCACTTA
TTTTTTTATATAAGACTTTTGTAATCTATTCGTGTAAATAAGAGTTGCTTGGCCAGAGCGGGAG
CCCCTTGGGCTATATTTATCTCCCAGGCATGCTGTGTAGTGCAACAAAAACTTTGTATGTTTAT
TCCTCAAGCGGGCGAGCCTCGAGGCTCGCTCGCTCAGGTGTTGGAAATAAAGACGCTAATTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_034996	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA39798	(Get FASTA)	NCBI Sequence Viewer
	AAA39799	(Get FASTA)	NCBI Sequence Viewer
	AAI03614	(Get FASTA)	NCBI Sequence Viewer
	AAI03619	(Get FASTA)	NCBI Sequence Viewer
	AAI03620	(Get FASTA)	NCBI Sequence Viewer
	BAC36224	(Get FASTA)	NCBI Sequence Viewer
	BAE25213	(Get FASTA)	NCBI Sequence Viewer
	CAA43836	(Get FASTA)	NCBI Sequence Viewer
	EDL22927	(Get FASTA)	NCBI Sequence Viewer
	P10085	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_034996 ⟸ NM_010866

- UniProtKB:

P10085 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MELLSPPLRDIDLTGPDGSLCSFETADDFYDDPCFDSPDLRFFEDLDPRLVHMGALLKPEEHAH
FPTAVHPGPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEA
FETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAFYAPGPLPPGRGSEHY
SGDSDASSPRSNCSDGMMDYSGPPSGPRRQNGYDTAYYSEAARESRPGKSAAVSSLDCLSSIVE
RISTDSPAAPALLLADAPPESPPGPPEGASLSDTEQGTQTPSPDAAPQCPAGSNPNAIYQVL

hide sequence

RefSeq Acc Id:

ENSMUSP00000072330 ⟸ ENSMUST00000072514

Protein Domains

bHLH

Promoters

RGD ID:

8664121

Promoter ID:

EPDNEW_M10091

Type:

multiple initiation site

Name:

Myod1_1

Description:

Mus musculus myogenic differentiation 1 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	7	46,376,474 - 46,376,534	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:97275	AgrOrtholog
Ensembl Genes	ENSMUSG00000009471	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000072330	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000072514	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot
InterPro	Basic	UniProtKB/Swiss-Prot
	bHLH_dom	UniProtKB/Swiss-Prot
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot
	Myf5	UniProtKB/Swiss-Prot
	Myogenic_factor	UniProtKB/Swiss-Prot
KEGG Report	mmu:17927	UniProtKB/Swiss-Prot
MGD	MGI:97275	ENTREZGENE
NCBI Gene	17927	ENTREZGENE
PANTHER	PTHR11534	UniProtKB/Swiss-Prot
Pfam	Basic	UniProtKB/Swiss-Prot
	HLH	UniProtKB/Swiss-Prot
	Myf5	UniProtKB/Swiss-Prot
PhenoGen	Myod1	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot
SMART	BASIC	UniProtKB/Swiss-Prot
	HLH	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47459	UniProtKB/Swiss-Prot
UniProt	MYOD1_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	Q8C6B1	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM