Symbol:
Hrh1
Name:
histamine receptor H 1
RGD ID:
2830
Description:
Enables histamine binding activity. Involved in several processes, including negative regulation of steroid biosynthetic process; positive regulation of nitric oxide biosynthetic process; and positive regulation of vasoconstriction. Predicted to be located in cytosol. Predicted to be active in dendrite and plasma membrane. Orthologous to human HRH1 (histamine receptor H1); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2-pyridylethylamine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
H1R; HH1R; Hisr; histamine H1 receptor; Histamine receptor H1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HRH1 (histamine receptor H1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Hrh1 (histamine receptor H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Hrh1 (histamine receptor H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HRH1 (histamine receptor H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HRH1 (histamine receptor H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hrh1 (histamine receptor H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HRH1 (histamine receptor H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HRH1 (histamine receptor H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Hrh1 (histamine receptor H1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
WDR59 (WD repeat domain 59) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Hrh1 (histamine receptor H1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
HRH1 (histamine receptor H1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
hrh1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 149,120,511 - 149,204,267 (+) NCBI GRCr8 mRatBN7.2 4 147,564,963 - 147,649,353 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 147,645,995 - 147,647,455 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 152,949,786 - 153,033,522 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 148,730,672 - 148,814,402 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 147,360,109 - 147,443,854 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 146,374,596 - 146,458,148 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 146,455,332 - 146,457,074 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 209,668,412 - 209,751,766 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 150,431,239 - 150,432,699 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 150,676,079 - 150,677,540 (+) NCBI Celera 4 136,197,254 - 136,198,714 (+) NCBI Celera RH 3.4 Map 4 950.0 RGD Cytogenetic Map 4 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hrh1 Rat (S)-ropivacaine affects binding ISO HRH1 (Homo sapiens) 6480464 HRH1 protein binds to Ropivacaine CTD PMID:32061592 Hrh1 Rat 1,2-dimethylhydrazine decreases expression ISO Hrh1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of HRH1 mRNA CTD PMID:22206623 Hrh1 Rat 17beta-estradiol multiple interactions ISO HRH1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of HRH1 mRNA CTD PMID:30165855 Hrh1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO HRH1 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Hrh1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO HRH1 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Hrh1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of HRH1 mRNA CTD PMID:15977195 Hrh1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HRH1 mRNA CTD PMID:32109520 Hrh1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hrh1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HRH1 mRNA CTD PMID:21570461 Hrh1 Rat 2-palmitoylglycerol increases expression ISO HRH1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of HRH1 mRNA CTD PMID:37199045 Hrh1 Rat 2-pyridylethylamine multiple interactions EXP 6480464 2-(2-aminoethyl)pyridine binds to and results in increased activity of HRH1 protein CTD PMID:16143415 Hrh1 Rat 2-pyridylethylamine multiple interactions ISO Hrh1 (Mus musculus) 6480464 2-(2-aminoethyl)pyridine binds to and results in increased activity of HRH1 protein and HRH1 protein promotes the reaction [2-(2-aminoethyl)pyridine results in increased expression of IL6 mRNA] CTD PMID:9657254 Hrh1 Rat 3',5'-cyclic AMP multiple interactions ISO HRH1 (Homo sapiens) 6480464 1-Methyl-3-isobutylxanthine inhibits the reaction [HRH1 protein promotes the reaction [Histamine results in decreased abundance of Cyclic AMP]] more ... CTD PMID:2419744 Hrh1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Hrh1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of HRH1 mRNA CTD PMID:20188158 Hrh1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO HRH1 (Homo sapiens) 6480464 1-Methyl-3-isobutylxanthine inhibits the reaction [HRH1 protein promotes the reaction [Histamine results in decreased abundance of Cyclic AMP]] CTD PMID:2419744 Hrh1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Hrh1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of HRH1 mRNA CTD PMID:18648102 Hrh1 Rat 4,4'-sulfonyldiphenol increases methylation ISO HRH1 (Homo sapiens) 6480464 bisphenol S results in increased methylation of HRH1 gene CTD PMID:31601247 Hrh1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of HRH1 mRNA CTD PMID:24780913 and PMID:25825206 Hrh1 Rat aflatoxin B1 increases expression ISO HRH1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of HRH1 mRNA CTD PMID:22100608 Hrh1 Rat aflatoxin B1 increases methylation ISO HRH1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of HRH1 gene CTD PMID:27153756 Hrh1 Rat Aflatoxin B2 alpha decreases methylation ISO HRH1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of HRH1 intron CTD PMID:30157460 Hrh1 Rat all-trans-retinoic acid multiple interactions ISO Hrh1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of HRH1 mRNA CTD PMID:36189433 Hrh1 Rat aminophylline multiple interactions ISO Hrh1 (Mus musculus) 6480464 [Astemizole binds to and results in decreased activity of HRH1 protein] which affects the susceptibility to Aminophylline CTD PMID:16129921 Hrh1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HRH1 mRNA CTD PMID:16483693 Hrh1 Rat asbestos increases expression ISO HRH1 (Homo sapiens) 6480464 Asbestos results in increased expression of HRH1 mRNA CTD PMID:22398240 Hrh1 Rat astemizole multiple interactions ISO Hrh1 (Mus musculus) 6480464 [Astemizole binds to and results in decreased activity of HRH1 protein] which affects the susceptibility to Aminophylline CTD PMID:16129921 Hrh1 Rat astemizole multiple interactions ISO HRH1 (Homo sapiens) 6480464 Astemizole inhibits the reaction [Histamine results in decreased activity of [KCNQ2 protein co-treated with KCNQ3 protein co-treated with HRH1 protein]] CTD PMID:12147327 Hrh1 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of HRH1 mRNA CTD PMID:36841081 Hrh1 Rat azatadine multiple interactions ISO HRH1 (Homo sapiens) 6480464 azatadine binds to and results in decreased activity of HRH1 protein CTD PMID:2864258 Hrh1 Rat azelastine affects binding ISO HRH1 (Homo sapiens) 6480464 azelastine binds to HRH1 protein CTD PMID:2540229 Hrh1 Rat Bardoxolone methyl decreases activity ISO HRH1 (Homo sapiens) 6480464 bardoxolone methyl results in decreased activity of HRH1 protein CTD PMID:28790194 Hrh1 Rat benzo[a]pyrene multiple interactions ISO Hrh1 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to HRH1 promoter] CTD PMID:19654925 Hrh1 Rat benzo[a]pyrene increases expression ISO HRH1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of HRH1 mRNA CTD PMID:32234424 Hrh1 Rat benzo[a]pyrene increases methylation ISO Hrh1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of HRH1 intron CTD PMID:27901495 Hrh1 Rat benzo[a]pyrene decreases methylation ISO HRH1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of HRH1 3' UTR CTD PMID:27901495 Hrh1 Rat benzo[a]pyrene affects methylation ISO HRH1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HRH1 5' UTR and Benzo(a)pyrene affects the methylation of HRH1 promoter CTD PMID:27901495 Hrh1 Rat benzo[a]pyrene decreases expression ISO HRH1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of HRH1 mRNA CTD PMID:20064835 Hrh1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO HRH1 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Hrh1 Rat betahistine multiple interactions EXP 6480464 Betahistine binds to and results in increased activity of HRH1 protein CTD PMID:16143415 Hrh1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HRH1 mRNA CTD PMID:25181051 Hrh1 Rat bisphenol A multiple interactions ISO HRH1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of HRH1 gene CTD PMID:31601247 Hrh1 Rat bisphenol A decreases methylation ISO HRH1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of HRH1 gene CTD PMID:31601247 Hrh1 Rat bisphenol A increases expression ISO HRH1 (Homo sapiens) 6480464 bisphenol A results in increased expression of HRH1 mRNA CTD PMID:29275510 Hrh1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HRH1 mRNA CTD PMID:30816183 Hrh1 Rat bisphenol F decreases expression ISO Hrh1 (Mus musculus) 6480464 bisphenol F results in decreased expression of HRH1 mRNA CTD PMID:38685157 Hrh1 Rat bupivacaine affects binding ISO HRH1 (Homo sapiens) 6480464 HRH1 protein binds to Bupivacaine CTD PMID:32061592 Hrh1 Rat cadmium dichloride increases expression ISO HRH1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of HRH1 mRNA CTD PMID:38568856 Hrh1 Rat calcium atom multiple interactions ISO HRH1 (Homo sapiens) 6480464 [6-((2-(4-imidazolyl)ethyl)amino)heptanoic acid 4-toluidide binds to and results in increased activity of HRH1 protein] which results in increased abundance of Calcium more ... CTD PMID:11238657 more ... Hrh1 Rat calcium atom increases abundance ISO HRH1 (Homo sapiens) 6480464 HRH1 protein results in increased abundance of Calcium CTD PMID:19443731 Hrh1 Rat calcium(0) multiple interactions ISO HRH1 (Homo sapiens) 6480464 [6-((2-(4-imidazolyl)ethyl)amino)heptanoic acid 4-toluidide binds to and results in increased activity of HRH1 protein] which results in increased abundance of Calcium more ... CTD PMID:11238657 more ... Hrh1 Rat calcium(0) increases abundance ISO HRH1 (Homo sapiens) 6480464 HRH1 protein results in increased abundance of Calcium CTD PMID:19443731 Hrh1 Rat cannabidiol increases expression ISO HRH1 (Homo sapiens) 6480464 Cannabidiol results in increased expression of HRH1 mRNA CTD PMID:27918106 Hrh1 Rat cetirizine multiple interactions ISO HRH1 (Homo sapiens) 6480464 Cetirizine binds to and results in decreased activity of HRH1 protein CTD PMID:16401869 Hrh1 Rat cetirizine affects binding ISO HRH1 (Homo sapiens) 6480464 Cetirizine analog binds to HRH1 protein and Cetirizine binds to HRH1 protein CTD PMID:15482930 Hrh1 Rat chlordecone increases expression ISO Hrh1 (Mus musculus) 6480464 Chlordecone results in increased expression of HRH1 mRNA CTD PMID:33711761 Hrh1 Rat chlorphenamine multiple interactions ISO HRH1 (Homo sapiens) 6480464 Chlorpheniramine binds to and results in decreased activity of HRH1 protein CTD PMID:11432448 Hrh1 Rat chlorphenamine multiple interactions EXP 6480464 Chlorpheniramine binds to and results in decreased activity of HRH1 protein more ... CTD PMID:15054595 more ... Hrh1 Rat chlorphenamine multiple interactions ISO Hrh1 (Mus musculus) 6480464 Chlorpheniramine binds to and results in decreased activity of HRH1 protein and Chlorpheniramine inhibits the reaction [HRH1 results in decreased susceptibility to Morphine] CTD PMID:12128009 and PMID:14569158 Hrh1 Rat chlorphenamine decreases activity ISO HRH1 (Homo sapiens) 6480464 Chlorpheniramine results in decreased activity of HRH1 protein CTD PMID:8111568 Hrh1 Rat cimetidine multiple interactions ISO Hrh1 (Mus musculus) 6480464 Cimetidine inhibits the reaction [HRH1 results in decreased susceptibility to Morphine] CTD PMID:14569158 Hrh1 Rat cisplatin multiple interactions ISO HRH1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of HRH1 mRNA CTD PMID:27392435 Hrh1 Rat clemastine multiple interactions ISO HRH1 (Homo sapiens) 6480464 Clemastine binds to and results in decreased activity of HRH1 protein CTD PMID:2864258 Hrh1 Rat clobenpropit multiple interactions EXP 6480464 [Pyrilamine binds to and results in decreased activity of HRH1 protein] which results in decreased susceptibility to clobenpropit CTD PMID:16488453 Hrh1 Rat clozapine affects binding ISO HRH1 (Homo sapiens) 6480464 Clozapine binds to HRH1 protein CTD PMID:16983399 Hrh1 Rat crocidolite asbestos increases expression ISO HRH1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of HRH1 mRNA CTD PMID:18687144 Hrh1 Rat CU-O LINKAGE increases expression ISO HRH1 (Homo sapiens) 6480464 cupric oxide results in increased expression of HRH1 mRNA CTD PMID:22077320 Hrh1 Rat cyclosporin A increases expression ISO HRH1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of HRH1 mRNA CTD PMID:20106945 Hrh1 Rat cyclosporin A decreases methylation ISO HRH1 (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of HRH1 promoter CTD PMID:27989131 Hrh1 Rat desloratadine affects binding ISO HRH1 (Homo sapiens) 6480464 desloratadine binds to HRH1 protein CTD PMID:15482930 Hrh1 Rat dexamethasone multiple interactions EXP 6480464 Dexamethasone inhibits the reaction [Toluene 2 and 4-Diisocyanate results in increased expression of HRH1 mRNA] CTD PMID:15054595 more ... Hrh1 Rat dimetindene multiple interactions ISO HRH1 (Homo sapiens) 6480464 Dimethindene binds to and results in decreased activity of HRH1 protein CTD PMID:7512805 Hrh1 Rat diphenhydramine multiple interactions ISO HRH1 (Homo sapiens) 6480464 Diphenhydramine binds to and results in decreased activity of HRH1 protein more ... CTD PMID:1912125 more ... Hrh1 Rat diphenhydramine multiple interactions EXP 6480464 [Diphenhydramine results in decreased activity of HRH1 protein] which results in decreased susceptibility to Erythromycin CTD PMID:12856827 Hrh1 Rat diphenylpyraline multiple interactions ISO HRH1 (Homo sapiens) 6480464 diphenylpyraline binds to and results in increased activity of HRH1 protein and diphenylpyraline inhibits the reaction [Pyrilamine binds to HRH1 protein] CTD PMID:1912125 Hrh1 Rat dopamine multiple interactions EXP 6480464 [1-phenyl-3-dimethylamino-1 more ... CTD PMID:10661506 Hrh1 Rat doxorubicin decreases expression ISO HRH1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of HRH1 mRNA CTD PMID:29803840 Hrh1 Rat epinastine multiple interactions EXP 6480464 [epinastine binds to and results in decreased activity of HRH1 protein] which affects the susceptibility to Histamine more ... CTD PMID:12832840 and PMID:19075512 Hrh1 Rat epoxiconazole increases expression ISO Hrh1 (Mus musculus) 6480464 epoxiconazole results in increased expression of HRH1 mRNA CTD PMID:35436446 Hrh1 Rat erythromycin A multiple interactions EXP 6480464 [Diphenhydramine results in decreased activity of HRH1 protein] which results in decreased susceptibility to Erythromycin CTD PMID:12856827 Hrh1 Rat ethanol multiple interactions ISO Hrh1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of HRH1 mRNA CTD PMID:30517762 Hrh1 Rat Fexofenadine hydrochloride multiple interactions ISO HRH1 (Homo sapiens) 6480464 fexofenadine binds to and results in decreased activity of HRH1 protein more ... CTD PMID:11238657 Hrh1 Rat Fexofenadine hydrochloride multiple interactions ISO Hrh1 (Mus musculus) 6480464 fexofenadine binds to and results in decreased activity of HRH1 protein CTD PMID:19652466 Hrh1 Rat fluoxetine multiple interactions ISO HRH1 (Homo sapiens) 6480464 HRH1 protein results in increased susceptibility to [olanzapine co-treated with Fluoxetine] CTD PMID:20021991 Hrh1 Rat folic acid decreases expression ISO Hrh1 (Mus musculus) 6480464 Folic Acid results in decreased expression of HRH1 mRNA CTD PMID:25629700 Hrh1 Rat fructose decreases expression EXP 6480464 Fructose results in decreased expression of HRH1 mRNA CTD PMID:36049592 Hrh1 Rat fulvestrant multiple interactions ISO HRH1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of HRH1 gene CTD PMID:31601247 Hrh1 Rat galangin decreases expression ISO Hrh1 (Mus musculus) 6480464 galangin results in decreased expression of HRH1 mRNA CTD PMID:23535185 Hrh1 Rat gallic acid decreases expression ISO HRH1 (Homo sapiens) 6480464 Gallic Acid results in decreased expression of HRH1 mRNA CTD PMID:34408198 Hrh1 Rat GTP multiple interactions ISO HRH1 (Homo sapiens) 6480464 Guanosine Triphosphate analog affects the reaction [Histamine inhibits the reaction [Pyrilamine binds to HRH1 protein]] CTD PMID:2419744 Hrh1 Rat histamine increases expression ISO HRH1 (Homo sapiens) 6480464 Histamine results in increased expression of HRH1 mRNA CTD PMID:23333628 Hrh1 Rat histamine affects binding ISO HRH1 (Homo sapiens) 6480464 HRH1 protein binds to Histamine CTD PMID:32061592 Hrh1 Rat histamine increases expression EXP 6480464 Histamine results in increased expression of HRH1 mRNA CTD PMID:18360087 Hrh1 Rat histamine increases activity EXP 6480464 Histamine results in increased activity of HRH1 protein CTD PMID:16354729 Hrh1 Rat histamine affects response to substance ISO Hrh1 (Mus musculus) 6480464 HRH1 protein affects the susceptibility to Histamine CTD PMID:12095164 Hrh1 Rat histamine multiple interactions EXP 6480464 [epinastine binds to and results in decreased activity of HRH1 protein] which affects the susceptibility to Histamine more ... CTD PMID:12832840 more ... Hrh1 Rat histamine increases activity ISO HRH1 (Homo sapiens) 6480464 Histamine results in increased activity of HRH1 protein CTD PMID:11238657 Hrh1 Rat histamine multiple interactions ISO HRH1 (Homo sapiens) 6480464 1-Methyl-3-isobutylxanthine inhibits the reaction [HRH1 protein promotes the reaction [Histamine results in decreased abundance of Cyclic AMP]] more ... CTD PMID:11238657 more ... Hrh1 Rat hydroxyzine multiple interactions ISO HRH1 (Homo sapiens) 6480464 Hydroxyzine binds to and results in decreased activity of HRH1 protein CTD PMID:19057127 and PMID:2864258 Hrh1 Rat lamotrigine increases response to substance ISO HRH1 (Homo sapiens) 6480464 HRH1 protein results in increased susceptibility to lamotrigine CTD PMID:20021991 Hrh1 Rat lead(0) affects expression ISO HRH1 (Homo sapiens) 6480464 Lead affects the expression of HRH1 mRNA CTD PMID:28903495 Hrh1 Rat lidocaine affects binding ISO HRH1 (Homo sapiens) 6480464 HRH1 protein binds to Lidocaine CTD PMID:32061592 Hrh1 Rat lidocaine multiple interactions ISO HRH1 (Homo sapiens) 6480464 [HRH1 protein binds to Lidocaine] which results in increased import of Calcium CTD PMID:32061592 Hrh1 Rat lipopolysaccharide multiple interactions ISO HRH1 (Homo sapiens) 6480464 ethyl 6-(N-(2-chloro-4-fluorophenyl)sulfamoyl)cyclohex-1-ene-1-carboxylate inhibits the reaction [Lipopolysaccharides results in increased expression of HRH1 mRNA] more ... CTD PMID:21255012 Hrh1 Rat lipopolysaccharide increases expression ISO HRH1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of HRH1 mRNA and Lipopolysaccharides results in increased expression of HRH1 protein CTD PMID:21255012 Hrh1 Rat loratadine affects binding ISO HRH1 (Homo sapiens) 6480464 Loratadine analog binds to HRH1 protein and Loratadine binds to HRH1 protein CTD PMID:15482930 Hrh1 Rat manganese(II) chloride decreases methylation ISO HRH1 (Homo sapiens) 6480464 manganese chloride results in decreased methylation of HRH1 gene CTD PMID:27913844 Hrh1 Rat mepyramine multiple interactions ISO HRH1 (Homo sapiens) 6480464 Diphenhydramine inhibits the reaction [Pyrilamine binds to HRH1 protein] more ... CTD PMID:1912125 more ... Hrh1 Rat mepyramine decreases activity EXP 6480464 Pyrilamine results in decreased activity of HRH1 protein CTD PMID:21276809 Hrh1 Rat mepyramine affects binding ISO HRH1 (Homo sapiens) 6480464 Pyrilamine binds to HRH1 protein CTD PMID:1912125 more ... Hrh1 Rat mepyramine affects binding EXP 6480464 Pyrilamine binds to HRH1 protein CTD PMID:11927170 more ... Hrh1 Rat mepyramine multiple interactions EXP 6480464 8-fluoro-12-(4-methylpiperazin-1-yl)-6H-(1)benzothieno(2 more ... CTD PMID:11640976 more ... Hrh1 Rat mepyramine decreases activity ISO HRH1 (Homo sapiens) 6480464 Pyrilamine results in decreased activity of HRH1 protein CTD PMID:8111568 Hrh1 Rat methotrexate increases expression ISO HRH1 (Homo sapiens) 6480464 Methotrexate results in increased expression of HRH1 mRNA CTD PMID:17400583 Hrh1 Rat milnacipran increases expression ISO Hrh1 (Mus musculus) 6480464 milnacipran results in increased expression of HRH1 mRNA CTD PMID:21157932 Hrh1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Hrh1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of HRH1 mRNA CTD PMID:36189433 Hrh1 Rat morphine multiple interactions ISO Hrh1 (Mus musculus) 6480464 Chlorpheniramine inhibits the reaction [HRH1 results in decreased susceptibility to Morphine] and Cimetidine inhibits the reaction [HRH1 results in decreased susceptibility to Morphine] CTD PMID:12128009 and PMID:14569158 Hrh1 Rat morphine decreases response to substance ISO Hrh1 (Mus musculus) 6480464 HRH1 results in decreased susceptibility to Morphine CTD PMID:12128009 and PMID:14569158 Hrh1 Rat N-Nitrosopyrrolidine increases expression ISO HRH1 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of HRH1 mRNA CTD PMID:32234424 Hrh1 Rat nickel atom affects response to substance ISO Hrh1 (Mus musculus) 6480464 HRH1 affects the susceptibility to Nickel CTD PMID:19839048 Hrh1 Rat nickel atom increases expression ISO HRH1 (Homo sapiens) 6480464 Nickel results in increased expression of HRH1 mRNA CTD PMID:24768652 and PMID:25583101 Hrh1 Rat niclosamide increases expression ISO HRH1 (Homo sapiens) 6480464 Niclosamide results in increased expression of HRH1 mRNA CTD PMID:36318118 Hrh1 Rat olanzapine affects binding ISO HRH1 (Homo sapiens) 6480464 olanzapine binds to HRH1 protein CTD PMID:16983399 Hrh1 Rat olanzapine affects binding ISO Hrh1 (Mus musculus) 6480464 olanzapine binds to HRH1 protein CTD PMID:24389121 Hrh1 Rat olanzapine multiple interactions ISO HRH1 (Homo sapiens) 6480464 HRH1 protein results in increased susceptibility to [olanzapine co-treated with Fluoxetine] CTD PMID:20021991 Hrh1 Rat Olopatadine hydrochloride multiple interactions EXP 6480464 Olopatadine Hydrochloride inhibits the reaction [Toluene 2 and 4-Diisocyanate results in increased expression of HRH1 mRNA] CTD PMID:18360087 and PMID:19075512 Hrh1 Rat Olopatadine hydrochloride affects binding ISO HRH1 (Homo sapiens) 6480464 Olopatadine Hydrochloride binds to HRH1 protein CTD PMID:9433371 Hrh1 Rat paracetamol increases expression ISO HRH1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of HRH1 mRNA CTD PMID:29067470 Hrh1 Rat paroxetine increases expression ISO Hrh1 (Mus musculus) 6480464 Paroxetine results in increased expression of HRH1 mRNA CTD PMID:21157932 Hrh1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO HRH1 (Homo sapiens) 6480464 Quercetin inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of HRH1 mRNA] CTD PMID:23333628 Hrh1 Rat phorbol 13-acetate 12-myristate increases expression ISO HRH1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of HRH1 mRNA CTD PMID:23333628 Hrh1 Rat potassium atom multiple interactions EXP 6480464 [Histamine results in increased activity of HRH1 protein] which affects the transport of Potassium and [histamine trifluoromethyl-toluidide analog results in increased activity of HRH1 protein] which affects the transport of Potassium CTD PMID:16354729 Hrh1 Rat potassium chromate decreases expression ISO HRH1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of HRH1 mRNA CTD PMID:22714537 Hrh1 Rat procaine multiple interactions ISO HRH1 (Homo sapiens) 6480464 [HRH1 protein binds to Procaine] which results in increased import of Calcium more ... CTD PMID:32061592 Hrh1 Rat procaine affects binding ISO HRH1 (Homo sapiens) 6480464 HRH1 protein binds to Procaine CTD PMID:32061592 Hrh1 Rat promethazine multiple interactions ISO HRH1 (Homo sapiens) 6480464 Promethazine binds to and results in decreased activity of HRH1 protein more ... CTD PMID:1377455 and PMID:1912125 Hrh1 Rat quercetin multiple interactions ISO HRH1 (Homo sapiens) 6480464 Quercetin inhibits the reaction [Histamine results in increased expression of HRH1 mRNA] and Quercetin inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of HRH1 mRNA] CTD PMID:23333628 Hrh1 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Toluene 2 and 4-Diisocyanate results in increased expression of HRH1 mRNA] CTD PMID:23333628 Hrh1 Rat resveratrol multiple interactions ISO HRH1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of HRH1 mRNA CTD PMID:23557933 Hrh1 Rat rifampicin increases expression ISO HRH1 (Homo sapiens) 6480464 Rifampin results in increased expression of HRH1 mRNA CTD PMID:24552687 Hrh1 Rat Ro 31-8220 multiple interactions EXP 6480464 Ro 31-8220 inhibits the reaction [Histamine results in increased expression of HRH1 mRNA] CTD PMID:18360087 Hrh1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of HRH1 mRNA CTD PMID:28374803 Hrh1 Rat scopolamine multiple interactions EXP 6480464 [Histamine binds to and results in increased activity of HRH1 protein] which results in decreased susceptibility to Scopolamine and Pyrilamine inhibits the reaction [[Histamine binds to and results in increased activity of HRH1 protein] which results in decreased susceptibility to Scopolamine] CTD PMID:19215234 Hrh1 Rat silicon dioxide increases expression ISO HRH1 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of HRH1 mRNA CTD PMID:25351596 Hrh1 Rat sodium arsenite affects methylation ISO HRH1 (Homo sapiens) 6480464 sodium arsenite affects the methylation of HRH1 gene CTD PMID:28589171 Hrh1 Rat sodium arsenite increases expression ISO HRH1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of HRH1 mRNA CTD PMID:34032870 and PMID:38568856 Hrh1 Rat tacrine multiple interactions EXP 6480464 Tacrine inhibits the reaction [Pyrilamine binds to HRH1 protein] CTD PMID:2606156 Hrh1 Rat Terfenadine multiple interactions ISO Hrh1 (Mus musculus) 6480464 Terfenadine inhibits the reaction [histamine trifluoromethyl-toluidide results in increased activity of HRH1 protein] CTD PMID:18508907 Hrh1 Rat tetracaine multiple interactions ISO HRH1 (Homo sapiens) 6480464 [HRH1 protein binds to Tetracaine] which results in increased import of Calcium CTD PMID:32061592 Hrh1 Rat tetracaine affects binding ISO HRH1 (Homo sapiens) 6480464 HRH1 protein binds to Tetracaine CTD PMID:32061592 Hrh1 Rat tetrachloromethane multiple interactions ISO Hrh1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of HRH1 mRNA CTD PMID:30517762 Hrh1 Rat toluene 2,4-diisocyanate increases expression EXP 6480464 Toluene 2 more ... CTD PMID:15054595 more ... Hrh1 Rat toluene 2,4-diisocyanate multiple interactions EXP 6480464 Chlorpheniramine inhibits the reaction [Toluene 2 more ... CTD PMID:15054595 more ... Hrh1 Rat tributylstannane decreases expression ISO HRH1 (Homo sapiens) 6480464 tributyltin results in decreased expression of HRH1 mRNA CTD PMID:29580985 Hrh1 Rat Tripelennamine multiple interactions EXP 6480464 [Tripelennamine binds to and results in decreased activity of HRH1 protein] which affects the susceptibility to Histamine CTD PMID:12832840 Hrh1 Rat triprolidine multiple interactions ISO HRH1 (Homo sapiens) 6480464 [Triprolidine inhibits the reaction [Histamine binds to and results in increased activity of HRH1 protein]] which results in decreased expression of CD40 protein more ... CTD PMID:11306145 more ... Hrh1 Rat triprolidine multiple interactions EXP 6480464 Triprolidine binds to and results in decreased activity of HRH1 protein and Triprolidine inhibits the reaction [[Histamine binds to and results in increased activity of HRH1 protein] which results in increased expression of NGF protein] CTD PMID:10661506 more ... Hrh1 Rat triprolidine decreases activity EXP 6480464 Triprolidine results in decreased activity of HRH1 protein CTD PMID:21276809 Hrh1 Rat valproic acid affects expression ISO HRH1 (Homo sapiens) 6480464 Valproic Acid affects the expression of HRH1 mRNA CTD PMID:25979313 Hrh1 Rat valproic acid decreases methylation ISO HRH1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of HRH1 gene CTD PMID:29154799 Hrh1 Rat zinc atom multiple interactions ISO HRH1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of HRH1 mRNA CTD PMID:18593933 Hrh1 Rat zinc(0) multiple interactions ISO HRH1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of HRH1 mRNA CTD PMID:18593933
Imported Annotations - KEGG (archival)
(S)-ropivacaine (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-palmitoylglycerol (ISO) 2-pyridylethylamine (EXP,ISO) 3',5'-cyclic AMP (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) aminophylline (ISO) ammonium chloride (EXP) asbestos (ISO) astemizole (ISO) atrazine (EXP) azatadine (ISO) azelastine (ISO) Bardoxolone methyl (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) betahistine (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) bupivacaine (ISO) cadmium dichloride (ISO) calcium atom (ISO) calcium(0) (ISO) cannabidiol (ISO) cetirizine (ISO) chlordecone (ISO) chlorphenamine (EXP,ISO) cimetidine (ISO) cisplatin (ISO) clemastine (ISO) clobenpropit (EXP) clozapine (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) desloratadine (ISO) dexamethasone (EXP) dimetindene (ISO) diphenhydramine (EXP,ISO) diphenylpyraline (ISO) dopamine (EXP) doxorubicin (ISO) epinastine (EXP) epoxiconazole (ISO) erythromycin A (EXP) ethanol (ISO) Fexofenadine hydrochloride (ISO) fluoxetine (ISO) folic acid (ISO) fructose (EXP) fulvestrant (ISO) galangin (ISO) gallic acid (ISO) GTP (ISO) histamine (EXP,ISO) hydroxyzine (ISO) lamotrigine (ISO) lead(0) (ISO) lidocaine (ISO) lipopolysaccharide (ISO) loratadine (ISO) manganese(II) chloride (ISO) mepyramine (EXP,ISO) methotrexate (ISO) milnacipran (ISO) mono(2-ethylhexyl) phthalate (ISO) morphine (ISO) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) niclosamide (ISO) olanzapine (ISO) Olopatadine hydrochloride (EXP,ISO) paracetamol (ISO) paroxetine (ISO) phorbol 13-acetate 12-myristate (ISO) potassium atom (EXP) potassium chromate (ISO) procaine (ISO) promethazine (ISO) quercetin (EXP,ISO) resveratrol (ISO) rifampicin (ISO) Ro 31-8220 (EXP) rotenone (EXP) scopolamine (EXP) silicon dioxide (ISO) sodium arsenite (ISO) tacrine (EXP) Terfenadine (ISO) tetracaine (ISO) tetrachloromethane (ISO) toluene 2,4-diisocyanate (EXP) tributylstannane (ISO) Tripelennamine (EXP) triprolidine (EXP,ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Expression of mRNA encoding the H1, H2, and H3 histamine receptors in the rat cochlea.
Azuma H, etal., Neuroreport 2003 Mar 3;14(3):423-5.
2.
Genomic cloning of the rat histamine H1 receptor.
Fujimoto K, etal., Biochem Biophys Res Commun 1993 Jan 15;190(1):294-301.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Dual role of histamine in modulation of Leydig cell steroidogenesis via HRH1 and HRH2 receptor subtypes.
Mondillo C, etal., Biol Reprod. 2005 Nov;73(5):899-907. Epub 2005 May 25.
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
Potentiation by neuropeptide Y of histamine H1 receptor-mediated contraction in rat blood vessels.
Piao H, etal., Vascul Pharmacol. 2007 Apr;46(4):260-70. Epub 2006 Oct 27.
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Effects of hypergravity on histamine H1 receptor mRNA expression in hypothalamus and brainstem of rats: implications for development of motion sickness.
Sato G, etal., Acta Otolaryngol. 2009 Jan;129(1):45-51.
15.
Histamine H1-receptor modulation of inter-neuronal coupling among vasopressinergic neurons depends on nitric oxide synthase activation.
Yang QZ and Hatton GI, Brain Res 2002 Nov 15;955(1-2):115-22.
Hrh1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 149,120,511 - 149,204,267 (+) NCBI GRCr8 mRatBN7.2 4 147,564,963 - 147,649,353 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 147,645,995 - 147,647,455 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 152,949,786 - 153,033,522 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 148,730,672 - 148,814,402 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 147,360,109 - 147,443,854 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 146,374,596 - 146,458,148 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 146,455,332 - 146,457,074 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 209,668,412 - 209,751,766 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 150,431,239 - 150,432,699 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 150,676,079 - 150,677,540 (+) NCBI Celera 4 136,197,254 - 136,198,714 (+) NCBI Celera RH 3.4 Map 4 950.0 RGD Cytogenetic Map 4 q42 NCBI
HRH1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 11,137,238 - 11,263,557 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 11,137,093 - 11,263,557 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 11,178,924 - 11,305,243 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 11,153,779 - 11,279,939 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 11,269,399 - 11,279,415 NCBI Celera 3 11,114,216 - 11,240,363 (+) NCBI Celera Cytogenetic Map 3 p25.3 NCBI HuRef 3 11,113,586 - 11,239,205 (+) NCBI HuRef CHM1_1 3 11,128,810 - 11,254,995 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 11,131,678 - 11,258,484 (+) NCBI T2T-CHM13v2.0
Hrh1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 114,374,897 - 114,459,432 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 114,374,897 - 114,460,257 (+) Ensembl GRCm39 Ensembl GRCm38 6 114,397,936 - 114,483,298 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 114,397,936 - 114,483,296 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 114,347,930 - 114,433,290 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 114,363,531 - 114,448,891 (+) NCBI MGSCv36 mm8 Celera 6 116,219,517 - 116,304,883 (+) NCBI Celera Cytogenetic Map 6 E3 NCBI cM Map 6 53.05 NCBI
Hrh1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955429 14,067,405 - 14,068,853 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955429 14,022,332 - 14,069,931 (+) NCBI ChiLan1.0 ChiLan1.0
HRH1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 11,134,626 - 11,259,909 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 11,139,386 - 11,264,669 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 11,074,451 - 11,199,871 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 11,439,705 - 11,545,509 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 11,541,294 - 11,542,757 (+) Ensembl panpan1.1 panPan2
HRH1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 7,160,903 - 7,236,147 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 7,162,393 - 7,235,869 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 7,195,842 - 7,270,946 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 7,190,337 - 7,265,418 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 7,190,251 - 7,265,315 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 6,906,408 - 6,981,475 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 7,262,781 - 7,337,859 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 7,234,680 - 7,309,540 (-) NCBI UU_Cfam_GSD_1.0
Hrh1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404942 16,634,611 - 16,727,741 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936602 2,183,831 - 2,185,297 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936602 2,182,053 - 2,185,297 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HRH1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 67,209,127 - 67,411,170 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 67,209,261 - 67,411,174 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 74,579,748 - 74,631,302 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HRH1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 47,187,156 - 47,298,761 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 47,295,011 - 47,296,471 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 119,219,292 - 119,336,578 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hrh1
.
Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
4
146456761
146456762
G
A
snv
ACI/EurMcwi (MCW) , FXLE16/Stm (2020), GH/OmrMcwi (MCW), F344/NRrrc (MCW), F344/NCrl (RGD), F344/DuCrl (2019), F344/NCrl (2019), F344/N (2020), F344/Stm (2019), LEXF1C/Stm (2019), SBN/Ygl (MCW), ACI/N (MCW), ACI/EurMcwi (RGD), SBN/Ygl (RGD), ACI/EurMcwi (2019), ACI/N (2020), DA/OlaHsd (2019), COP/CrCrl (MCW & UW) View more Information
Predicted Target Of
Count of predictions: 30 Count of miRNA genes: 22 Interacting mature miRNAs: 28 Transcripts: ENSRNOT00000009775 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 1300116 Hrtrt5 Heart rate QTL 5 3.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 116179486 151161268 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 634342 Cia24 Collagen induced arthritis QTL 24 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 146565735 175236377 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 2293840 Kiddil9 Kidney dilation QTL 9 2.9 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 4 120926564 148090731 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 12798525 Anxrr57 Anxiety related response QTL 57 3.21 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 147278504 167139601 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
23
105
55
54
23
21
23
6
151
67
85
44
57
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009775 ⟹ ENSRNOP00000009775
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 147,645,995 - 147,647,455 (+) Ensembl Rnor_6.0 Ensembl 4 146,455,332 - 146,457,074 (+) Ensembl
RefSeq Acc Id:
NM_017018 ⟹ NP_058714
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 149,120,511 - 149,204,267 (+) NCBI mRatBN7.2 4 147,564,963 - 147,648,723 (+) NCBI Rnor_6.0 4 146,455,420 - 146,456,880 (+) NCBI Rnor_5.0 4 209,668,412 - 209,751,766 (+) NCBI RGSC_v3.4 4 150,431,239 - 150,432,699 (+) RGD Celera 4 136,197,254 - 136,198,714 (+) RGD
Sequence:
ATGAGCTTTGCCAATACCTCCTCTACCTTCGAAGACAAGATGTGTGAGGGGAACAGGACAGCCATGGCCAGCCCTCAGCTGCTGCCCCTGGTGGTGGTTCTCAGTAGTATCTCCCTGGTCACAGTGGG
hide sequence
RefSeq Acc Id:
XM_039107019 ⟹ XP_038962947
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 149,120,623 - 149,204,261 (+) NCBI mRatBN7.2 4 147,565,101 - 147,649,353 (+) NCBI
RefSeq Acc Id:
NP_058714 ⟸ NM_017018
- UniProtKB:
P31390 (UniProtKB/Swiss-Prot), G3V6X5 (UniProtKB/TrEMBL), A6IBV0 (UniProtKB/TrEMBL)
- Sequence:
MSFANTSSTFEDKMCEGNRTAMASPQLLPLVVVLSSISLVTVGLNLLVLYAVHSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLIMTKWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRS
hide sequence
Ensembl Acc Id:
ENSRNOP00000009775 ⟸ ENSRNOT00000009775
RefSeq Acc Id:
XP_038962947 ⟸ XM_039107019
- Peptide Label:
isoform X1
- UniProtKB:
P31390 (UniProtKB/Swiss-Prot), G3V6X5 (UniProtKB/TrEMBL), A6IBV0 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Hrh1
Histamine receptor H1
Symbol and Name status set to approved
70586 APPROVED
