Symbol:
Bet1
Name:
Bet1 golgi vesicular membrane trafficking protein
RGD ID:
2203
Description:
Enables syntaxin binding activity. Involved in vesicle fusion with Golgi apparatus. Acts upstream of or within endoplasmic reticulum to Golgi vesicle-mediated transport. Located in Golgi cis cisterna. Part of SNARE complex. Orthologous to human BET1 (Bet1 golgi vesicular membrane trafficking protein); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
BET1 homolog; blocked early in transport 1 homolog (S. cerevisiae); blocked early in transport 1 homolog (S.cerevisiae); Golgi vesicular membrane trafficking protein p18; golgi vesicular membrane-trafficking protein p18; MGC72488; rBET1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BET1 (Bet1 golgi vesicular membrane trafficking protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Bet1 (Bet1 golgi vesicular membrane trafficking protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bet1 (Bet1 golgi vesicular membrane trafficking protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BET1 (Bet1 golgi vesicular membrane trafficking protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BET1 (Bet1 golgi vesicular membrane trafficking protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bet1 (Bet1 golgi vesicular membrane trafficking protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BET1 (Bet1 golgi vesicular membrane trafficking protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BET1 (Bet1 golgi vesicular membrane trafficking protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bet1 (Bet1 golgi vesicular membrane trafficking protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SAMD1 (sterile alpha motif domain containing 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
BET1 (Bet1 golgi vesicular membrane trafficking protein)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Bet1 (Bet1 golgi vesicular membrane trafficking protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bet1 (Bet1 golgi vesicular membrane trafficking protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
BET1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Bet1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
nbet-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
bet1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 33,070,892 - 33,081,162 (-) NCBI GRCr8 mRatBN7.2 4 32,116,232 - 32,126,592 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 32,116,235 - 32,126,617 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 37,088,503 - 37,099,809 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 33,014,624 - 33,025,930 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 31,385,538 - 31,396,616 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 29,082,368 - 29,092,638 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 29,082,365 - 29,092,753 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 28,992,526 - 29,002,852 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 28,941,105 - 28,951,375 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 28,959,601 - 28,970,171 (-) NCBI Celera 4 27,501,409 - 27,511,460 (-) NCBI Celera Cytogenetic Map 4 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bet1 Rat 1,2-dimethylhydrazine decreases expression ISO Bet1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of BET1 mRNA CTD PMID:22206623 Bet1 Rat 17alpha-ethynylestradiol multiple interactions ISO Bet1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BET1 mRNA CTD PMID:17942748 Bet1 Rat 17beta-estradiol decreases expression ISO BET1 (Homo sapiens) 6480464 Estradiol results in decreased expression of BET1 mRNA CTD PMID:23019147 Bet1 Rat 17beta-estradiol increases expression ISO Bet1 (Mus musculus) 6480464 Estradiol results in increased expression of BET1 mRNA CTD PMID:39298647 Bet1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Bet1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Bet1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Bet1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BET1 mRNA CTD PMID:17942748 Bet1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Bet1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BET1 mRNA CTD PMID:21570461 Bet1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of BET1 mRNA CTD PMID:21215274 more ... Bet1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of BET1 mRNA CTD PMID:19162173 Bet1 Rat 4,4'-sulfonyldiphenol increases expression ISO Bet1 (Mus musculus) 6480464 bisphenol S results in increased expression of BET1 mRNA CTD PMID:39298647 Bet1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of BET1 mRNA CTD PMID:30047161 Bet1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of BET1 mRNA CTD PMID:31881176 Bet1 Rat aflatoxin B1 decreases expression ISO Bet1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of BET1 mRNA CTD PMID:19770486 Bet1 Rat aflatoxin B1 decreases expression ISO BET1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of BET1 mRNA CTD PMID:22100608 Bet1 Rat all-trans-retinoic acid decreases expression ISO BET1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of BET1 mRNA CTD PMID:21934132 Bet1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of BET1 mRNA CTD PMID:35163327 Bet1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of BET1 mRNA CTD PMID:30047161 Bet1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of BET1 mRNA CTD PMID:16483693 Bet1 Rat arsane multiple interactions ISO BET1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BET1 mRNA CTD PMID:39836092 Bet1 Rat arsenic atom multiple interactions ISO BET1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BET1 mRNA CTD PMID:39836092 Bet1 Rat arsenite(3-) multiple interactions ISO BET1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to BET1 mRNA] CTD PMID:32406909 Bet1 Rat benzene multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of BET1 mRNA CTD PMID:17905399 Bet1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BET1 mRNA CTD PMID:25181051 Bet1 Rat bisphenol A increases expression ISO BET1 (Homo sapiens) 6480464 bisphenol A results in increased expression of BET1 protein CTD PMID:33376534 Bet1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BET1 mRNA CTD PMID:30816183 more ... Bet1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of BET1 gene CTD PMID:28505145 Bet1 Rat cadmium atom multiple interactions ISO BET1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of BET1 mRNA CTD PMID:35301059 Bet1 Rat cadmium dichloride decreases expression ISO BET1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of BET1 mRNA CTD PMID:38382870 Bet1 Rat cadmium dichloride multiple interactions ISO BET1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of BET1 mRNA CTD PMID:35301059 Bet1 Rat carbon nanotube increases expression ISO Bet1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of BET1 mRNA CTD PMID:25620056 Bet1 Rat CGP 52608 multiple interactions ISO BET1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BET1 gene] CTD PMID:28238834 Bet1 Rat chromium(6+) affects expression ISO Bet1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of BET1 mRNA CTD PMID:28472532 Bet1 Rat copper(II) sulfate decreases expression ISO BET1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of BET1 mRNA CTD PMID:19549813 Bet1 Rat crocidolite asbestos decreases expression ISO Bet1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of BET1 mRNA CTD PMID:29279043 Bet1 Rat cyclosporin A increases expression ISO BET1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of BET1 mRNA CTD PMID:20106945 more ... Bet1 Rat Dibutyl phosphate affects expression ISO BET1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of BET1 mRNA CTD PMID:37042841 Bet1 Rat dibutyl phthalate decreases expression ISO Bet1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of BET1 mRNA CTD PMID:21266533 Bet1 Rat dicrotophos decreases expression ISO BET1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of BET1 mRNA CTD PMID:28302478 Bet1 Rat diuron decreases expression ISO BET1 (Homo sapiens) 6480464 Diuron results in decreased expression of BET1 mRNA CTD PMID:35967413 Bet1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of BET1 mRNA CTD PMID:29391264 Bet1 Rat ethyl methanesulfonate increases expression ISO BET1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of BET1 mRNA CTD PMID:23649840 Bet1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of BET1 mRNA CTD PMID:18035473 Bet1 Rat folic acid decreases expression ISO Bet1 (Mus musculus) 6480464 Folic Acid results in decreased expression of BET1 mRNA CTD PMID:25629700 Bet1 Rat FR900359 decreases phosphorylation ISO BET1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of BET1 protein CTD PMID:37730182 Bet1 Rat inulin multiple interactions ISO Bet1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of BET1 mRNA CTD PMID:36331819 Bet1 Rat ivermectin decreases expression ISO BET1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of BET1 protein CTD PMID:32959892 Bet1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of BET1 mRNA CTD PMID:30467583 Bet1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of BET1 mRNA CTD PMID:30047161 Bet1 Rat methyl methanesulfonate increases expression ISO BET1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of BET1 mRNA CTD PMID:23649840 Bet1 Rat methylmercury(1+) multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of BET1 mRNA CTD PMID:17905399 Bet1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of BET1 gene CTD PMID:33148267 Bet1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of BET1 mRNA CTD PMID:24136188 Bet1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of BET1 mRNA CTD PMID:24136188 Bet1 Rat Nivalenol decreases expression ISO Bet1 (Mus musculus) 6480464 nivalenol results in decreased expression of BET1 mRNA CTD PMID:35016910 Bet1 Rat paracetamol decreases expression ISO BET1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of BET1 mRNA CTD PMID:21420995 Bet1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of BET1 mRNA CTD PMID:33387578 Bet1 Rat perfluorohexanesulfonic acid increases expression ISO Bet1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of BET1 mRNA CTD PMID:37995155 Bet1 Rat perfluorooctane-1-sulfonic acid affects expression ISO Bet1 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of BET1 mRNA CTD PMID:19429403 Bet1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Bet1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of BET1 mRNA CTD PMID:36331819 Bet1 Rat perfluorooctanoic acid affects expression ISO Bet1 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of BET1 mRNA CTD PMID:19429403 Bet1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of BET1 mRNA CTD PMID:35163327 Bet1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of BET1 gene CTD PMID:33148267 Bet1 Rat pirinixic acid multiple interactions ISO BET1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of BET1 mRNA CTD PMID:19710929 Bet1 Rat pirinixic acid increases expression ISO Bet1 (Mus musculus) 6480464 pirinixic acid results in increased expression of BET1 mRNA CTD PMID:17426115 Bet1 Rat progesterone increases expression ISO BET1 (Homo sapiens) 6480464 Progesterone results in increased expression of BET1 mRNA CTD PMID:18037150 Bet1 Rat resveratrol increases expression ISO BET1 (Homo sapiens) 6480464 resveratrol results in increased expression of BET1 protein CTD PMID:18089832 Bet1 Rat sodium arsenite multiple interactions ISO BET1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BET1 mRNA CTD PMID:39836092 Bet1 Rat sodium fluoride decreases expression ISO Bet1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of BET1 mRNA CTD PMID:27862939 Bet1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of BET1 mRNA CTD PMID:30047161 Bet1 Rat sunitinib increases expression ISO BET1 (Homo sapiens) 6480464 Sunitinib results in increased expression of BET1 mRNA CTD PMID:31533062 Bet1 Rat thapsigargin decreases expression ISO BET1 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of BET1 mRNA CTD PMID:19442820 Bet1 Rat thapsigargin multiple interactions ISO BET1 (Homo sapiens) 6480464 [Thapsigargin co-treated with 4-methoxycinnamate methyl ester] results in decreased expression of BET1 mRNA CTD PMID:19442820 Bet1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of BET1 mRNA CTD PMID:34492290 Bet1 Rat trichloroethene multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of BET1 mRNA CTD PMID:17905399 Bet1 Rat triphenyl phosphate affects expression ISO BET1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BET1 mRNA CTD PMID:37042841 Bet1 Rat triptonide increases expression ISO Bet1 (Mus musculus) 6480464 triptonide results in increased expression of BET1 mRNA CTD PMID:33045310 Bet1 Rat tunicamycin increases expression ISO BET1 (Homo sapiens) 6480464 Tunicamycin results in increased expression of BET1 mRNA CTD PMID:22378314 Bet1 Rat ursodeoxycholic acid increases expression EXP 6480464 Ursodeoxycholic Acid results in increased expression of BET1 mRNA CTD PMID:15885361 Bet1 Rat valproic acid decreases methylation ISO BET1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of BET1 gene CTD PMID:29154799 Bet1 Rat valproic acid increases expression ISO BET1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of BET1 mRNA CTD PMID:37505509 Bet1 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of BET1 gene CTD PMID:31079544
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzene (EXP) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chromium(6+) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diuron (ISO) endosulfan (EXP) ethyl methanesulfonate (ISO) flavonoids (EXP) folic acid (ISO) FR900359 (ISO) inulin (ISO) ivermectin (ISO) methapyrilene (EXP) methimazole (EXP) methyl methanesulfonate (ISO) methylmercury(1+) (EXP) N,N-diethyl-m-toluamide (EXP) nefazodone (EXP) nimesulide (EXP) Nivalenol (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) permethrin (EXP) pirinixic acid (ISO) progesterone (ISO) resveratrol (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) sunitinib (ISO) thapsigargin (ISO) thioacetamide (EXP) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) tunicamycin (ISO) ursodeoxycholic acid (EXP) valproic acid (ISO) vinclozolin (EXP)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Mammalian vesicle trafficking proteins of the endoplasmic reticulum and Golgi apparatus.
Hay JC, etal., J Biol Chem 1996 Mar 8;271(10):5671-9.
4.
The SNARE motif contributes to rbet1 intracellular targeting and dynamics independently of SNARE interactions.
Joglekar AP, etal., J Biol Chem 2003 Apr 18;278(16):14121-33. Epub 2003 Feb 2.
5.
Mammalian Bet3 functions as a cytosolic factor participating in transport from the ER to the Golgi apparatus.
Loh E, etal., J Cell Sci. 2005 Mar 15;118(Pt 6):1209-22. Epub 2005 Feb 22.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
The identification of a novel endoplasmic reticulum to Golgi SNARE complex used by the prechylomicron transport vesicle.
Siddiqi SA, etal., J Biol Chem. 2006 Jul 28;281(30):20974-82. Epub 2006 May 30.
12.
Syntaxin 17 is abundant in steroidogenic cells and implicated in smooth endoplasmic reticulum membrane dynamics.
Steegmaier M, etal., Mol Biol Cell. 2000 Aug;11(8):2719-31.
13.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
14.
Countercurrent distribution of two distinct SNARE complexes mediating transport within the Golgi stack.
Volchuk A, etal., Mol Biol Cell. 2004 Apr;15(4):1506-18. doi: 10.1091/mbc.e03-08-0625. Epub 2004 Jan 23.
15.
GS15, a 15-kilodalton Golgi soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) homologous to rbet1.
Xu Y, etal., J Biol Chem 1997 Aug 8;272(32):20162-6.
Bet1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 33,070,892 - 33,081,162 (-) NCBI GRCr8 mRatBN7.2 4 32,116,232 - 32,126,592 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 32,116,235 - 32,126,617 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 37,088,503 - 37,099,809 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 33,014,624 - 33,025,930 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 31,385,538 - 31,396,616 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 29,082,368 - 29,092,638 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 29,082,365 - 29,092,753 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 28,992,526 - 29,002,852 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 28,941,105 - 28,951,375 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 28,959,601 - 28,970,171 (-) NCBI Celera 4 27,501,409 - 27,511,460 (-) NCBI Celera Cytogenetic Map 4 q13 NCBI
BET1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 93,962,762 - 94,004,355 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 93,962,762 - 94,004,382 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 93,592,074 - 93,633,667 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 93,458,936 - 93,471,626 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 93,267,213 - 93,278,341 NCBI Celera 7 88,319,269 - 88,331,959 (-) NCBI Celera Cytogenetic Map 7 q21.3 NCBI HuRef 7 88,228,528 - 88,241,219 (-) NCBI HuRef CHM1_1 7 93,551,233 - 93,563,923 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 95,198,654 - 95,240,247 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 92,950,170 - 92,962,860 (-) NCBI
Bet1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 4,076,899 - 4,086,930 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 4,076,899 - 4,086,972 (-) Ensembl GRCm39 Ensembl GRCm38 6 4,076,899 - 4,086,998 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 4,076,899 - 4,086,972 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 4,026,904 - 4,036,927 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 4,026,904 - 4,036,927 (-) NCBI MGSCv36 mm8 Celera 6 4,223,554 - 4,233,571 (-) NCBI Celera Cytogenetic Map 6 A1 NCBI cM Map 6 1.81 NCBI
Bet1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955432 10,762,903 - 10,774,780 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955432 10,762,973 - 10,774,744 (-) NCBI ChiLan1.0 ChiLan1.0
BET1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 111,835,749 - 111,846,933 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 160,100,388 - 160,111,552 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 85,947,997 - 85,959,151 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 99,508,461 - 99,550,129 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 99,539,001 - 99,550,125 (-) Ensembl panpan1.1 panPan2
BET1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 19,490,556 - 19,499,960 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 19,491,218 - 19,554,327 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 19,050,097 - 19,059,492 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 19,304,858 - 19,314,241 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 19,304,862 - 19,368,983 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 19,457,564 - 19,466,950 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 19,192,880 - 19,202,265 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 19,450,007 - 19,459,393 (-) NCBI UU_Cfam_GSD_1.0
Bet1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 32,818,459 - 32,826,847 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936585 6,036,472 - 6,043,832 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936585 6,036,452 - 6,044,827 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BET1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 73,782,168 - 73,792,648 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 73,782,157 - 73,792,653 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 80,823,432 - 80,833,925 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BET1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 55,014,065 - 55,024,958 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 55,014,079 - 55,024,964 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 49,261,547 - 49,307,140 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bet1
.
Predicted Target Of
Count of predictions: 429 Count of miRNA genes: 239 Interacting mature miRNAs: 286 Transcripts: ENSRNOT00000014810 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
2302371 Stl22 Serum triglyceride level QTL 22 5.15 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 57114705 Rat 2303585 Bw86 Body weight QTL 86 4 body mass (VT:0001259) body weight (CMO:0000012) 4 14678065 59678065 Rat 8552906 Pigfal3 Plasma insulin-like growth factor 1 level QTL 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 4 10084089 55084089 Rat 1357341 Gluco5 Glucose level QTL 5 6.4 adipocyte free fatty acid secretion trait (VT:0010465) absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446) 4 1 33250345 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357343 Gluco4 Glucose level QTL 4 0.00002 adipocyte glucose uptake trait (VT:0004185) adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874) 4 1 33250345 Rat 6478766 Anxrr47 Anxiety related response QTL 47 0.09637 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 10084089 55084089 Rat 70222 Eae2 Experimental allergic encephalomyelitis QTL 2 4.3 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 4 21333343 39505420 Rat 631642 Stl2 Serum triglyceride level QTL 2 3.3 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5219178 56647776 Rat 6478769 Anxrr48 Anxiety related response QTL 48 0.02514 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 10084089 55084089 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 634323 Hc2 Hypercalciuria QTL 2 2.15 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 4 210796 45210796 Rat 2313401 Anxrr27 Anxiety related response QTL 27 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 4 17933508 62933508 Rat 631209 Bw2 Body weight QTL2 4.2 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 9940885 44463908 Rat 8552803 Bw144 Body weight QTL 144 16 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 4 22710685 34430484 Rat 6909128 Pancm4 Pancreatic morphology QTL 4 11.35 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 4 26907285 75585128 Rat 8694374 Bw155 Body weight QTL 155 3.39 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 4 10084089 55084089 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 61412 Pia2 Pristane induced arthritis QTL 2 3.9 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 4 21333343 62278020 Rat 6478724 Anxrr35 Anxiety related response QTL 35 0.00449 defecation behavior trait (VT:0010462) defecation measurement (CMO:0000997) 4 10084089 55084089 Rat 8655906 Rf60 Renal function QTL 60 3.8 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 4 29494195 81006281 Rat 61415 Eae11 Experimental allergic encephalomyelitis QTL 11 2.9 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 4 1 39505420 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 7387227 Uae40 Urinary albumin excretion QTL 40 2.9 0.0052 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 17946999 62946999 Rat 6909122 Insul22 Insulin level QTL 22 4.63 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 4 26907285 75585128 Rat 738021 Hcar13 Hepatocarcinoma resistance QTL 13 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 4 1 32584199 Rat 1358203 Stl19 Serum triglyceride level QTL 19 2.8 0.002 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 65958103 Rat 9590304 Scort17 Serum corticosterone level QTL 17 4.96 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 10084089 55084089 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1354665 Stl10 Serum triglyceride level QTL 10 3.57 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 21333343 44463908 Rat 1300141 Bp178 Blood pressure QTL 178 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 10024901 39524530 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014810 ⟹ ENSRNOP00000014810
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 32,116,235 - 32,126,617 (-) Ensembl Rnor_6.0 Ensembl 4 29,082,365 - 29,092,753 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106013 ⟹ ENSRNOP00000090632
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 32,116,235 - 32,122,356 (-) Ensembl
RefSeq Acc Id:
NM_019251 ⟹ NP_062124
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 33,070,892 - 33,081,162 (-) NCBI mRatBN7.2 4 32,116,232 - 32,126,502 (-) NCBI Rnor_6.0 4 29,082,368 - 29,092,638 (-) NCBI Rnor_5.0 4 28,992,526 - 29,002,852 (-) NCBI RGSC_v3.4 4 28,941,105 - 28,951,375 (-) RGD Celera 4 27,501,409 - 27,511,460 (-) RGD
Sequence:
CTTAGGACTGAAGCCGAGGTTGGGTGACCCTGGCCCTTTCCTACCCACTCTTCCTTGCCCTCCTTCCCCTCTCGTGGCAGGATGAGGCGTGCAGGCCTGGGTGATGGAGCACCTCCTGGCGGCTATGG
hide sequence
RefSeq Acc Id:
NP_062124 ⟸ NM_019251
- UniProtKB:
Q62896 (UniProtKB/Swiss-Prot), A6K2B6 (UniProtKB/TrEMBL), A0A8I6ANQ2 (UniProtKB/TrEMBL)
- Sequence:
MRRAGLGDGAPPGGYGNYGYANSGYNACEEENDRLTESLRSKVTAIKSLSIEIGHEVKNQNKLLAEMDSQFDSTTGFLGKTMGRLKILSRGSQTKLLCYMMLFSLFVFFVIYWIIKLR
hide sequence
Ensembl Acc Id:
ENSRNOP00000014810 ⟸ ENSRNOT00000014810
Ensembl Acc Id:
ENSRNOP00000090632 ⟸ ENSRNOT00000106013
RGD ID: 13692856 Promoter ID: EPDNEW_R3380 Type: initiation region Name: Bet1_1 Description: Bet1 golgi vesicular membrane trafficking protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 29,092,685 - 29,092,745 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-03-20
Bet1
Bet1 golgi vesicular membrane trafficking protein
Bet1
blocked early in transport 1 homolog (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Bet1
blocked early in transport 1 homolog (S. cerevisiae)
Symbol and Name status set to approved
70586 APPROVED
2001-10-23
Bet1
blocked early in transport 1 homolog (S.cerevisiae)
Name updated to reflect Human and Mouse nomenclature
68913 APPROVED
