Symbol:
Adra1b
Name:
adrenoceptor alpha 1B
RGD ID:
2054
Description:
Enables alpha1-adrenergic receptor activity. Involved in several processes, including positive regulation of cytosolic calcium ion concentration; response to estrogen; and response to steroid hormone. Acts upstream of or within negative regulation of Rho protein signal transduction. Located in T-tubule and intercalated disc. Biomarker of polycystic ovary syndrome. Orthologous to human ADRA1B (adrenoceptor alpha 1B); PARTICIPATES IN G protein mediated signaling pathway via Galphaq family; calcium/calcium-mediated signaling pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
adrenergic alpha 1B receptor; Adrenergic alpha 1B- receptor; adrenergic receptor, alpha 1b; adrenergic, alpha 1B, receptor; Adrenergic, alpha 1B-, receptor; adrenergic, alpha-1B-, receptor; alpha 1B-adrenoceptor; alpha 1B-adrenoreceptor; alpha-1B adrenergic receptor; alpha-1B adrenoceptor; alpha-1B adrenoreceptor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 28,756,461 - 28,874,831 (-) NCBI GRCr8 mRatBN7.2 10 28,255,025 - 28,373,418 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 28,255,025 - 28,312,919 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 33,014,641 - 33,072,459 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 1,553,026 - 1,610,850 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 27,985,197 - 28,043,019 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 29,392,762 - 29,450,644 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 29,392,762 - 29,450,644 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 29,233,972 - 29,291,344 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 28,889,092 - 28,946,889 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 28,890,140 - 28,947,938 (-) NCBI Celera 10 27,744,674 - 27,802,198 (-) NCBI Celera Cytogenetic Map 10 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Adra1b Rat (+)-pilocarpine increases response to substance ISO Adra1b (Mus musculus) 6480464 ADRA1B protein results in increased susceptibility to Pilocarpine CTD PMID:19125850 Adra1b Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ADRA1B mRNA] CTD PMID:31150632 Adra1b Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ADRA1B mRNA CTD PMID:22079256 Adra1b Rat (R)-adrenaline multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [Epinephrine binds to and results in increased activity of ADRA1B protein] which results in increased abundance of Calcium more ... CTD PMID:15306222 and PMID:20030735 Adra1b Rat (R)-adrenaline increases activity ISO ADRA1B (Homo sapiens) 6480464 Epinephrine results in increased activity of ADRA1B protein CTD PMID:15306222 Adra1b Rat (R)-noradrenaline multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [Norepinephrine binds to and results in increased activity of ADRA1B protein] which results in increased abundance of Calcium more ... CTD PMID:20030735 Adra1b Rat (S)-amphetamine increases response to substance ISO Adra1b (Mus musculus) 6480464 ADRA1B gene results in increased susceptibility to Dextroamphetamine CTD PMID:14556232 Adra1b Rat 1,2-dichloroethane increases expression ISO Adra1b (Mus musculus) 6480464 ethylene dichloride results in increased expression of ADRA1B mRNA CTD PMID:28960355 Adra1b Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of ADRA1B mRNA CTD PMID:25380136 Adra1b Rat 17beta-estradiol multiple interactions EXP 6480464 Estradiol promotes the reaction [ADRA1B protein results in increased susceptibility to Phenylephrine] CTD PMID:18480251 Adra1b Rat 17beta-estradiol decreases expression ISO Adra1b (Mus musculus) 6480464 Estradiol results in decreased expression of ADRA1B mRNA CTD PMID:39298647 Adra1b Rat 17beta-estradiol multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of ADRA1B mRNA CTD PMID:30165855 Adra1b Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ADRA1B mRNA and Estradiol results in increased expression of ADRA1B protein CTD PMID:18480251 Adra1b Rat 1D-myo-inositol 1,4,5-trisphosphate increases abundance ISO ADRA1B (Homo sapiens) 6480464 ADRA1B protein results in increased abundance of Inositol 1 more ... CTD PMID:9570190 Adra1b Rat 1D-myo-inositol 1,4,5-trisphosphate increases metabolic processing ISO Adra1b (Mus musculus) 6480464 ADRA1B protein results in increased metabolism of Inositol 1 more ... CTD PMID:11278430 Adra1b Rat 1D-myo-inositol 1,4,5-trisphosphate multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [Quinidine co-treated with Verapamil] inhibits the reaction [ADRA1B protein results in increased abundance of Inositol 1 more ... CTD PMID:9570190 Adra1b Rat 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:23829299 Adra1b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ADRA1B mRNA CTD PMID:21215274 and PMID:32109520 Adra1b Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ADRA1B mRNA CTD PMID:21346803 Adra1b Rat 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [Quinidine co-treated with Verapamil] inhibits the reaction [ADRA1B protein results in increased abundance of Inositol 1 more ... CTD PMID:9570190 Adra1b Rat 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile affects binding ISO ADRA1B (Homo sapiens) 6480464 Verapamil binds to ADRA1B protein CTD PMID:9570190 Adra1b Rat 3',5'-cyclic AMP multiple interactions ISO Adra1b (Mus musculus) 6480464 ADRA1B protein affects the reaction [Isoproterenol results in increased abundance of Cyclic AMP] CTD PMID:12649302 Adra1b Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Adra1b Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:32119087 Adra1b Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Adra1b (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ADRA1B mRNA CTD PMID:26251327 Adra1b Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ADRA1B mRNA CTD PMID:28628672 Adra1b Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of ADRA1B mRNA CTD PMID:19162173 Adra1b Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of ADRA1B mRNA CTD PMID:25380136 Adra1b Rat 4,4'-sulfonyldiphenol decreases expression ISO Adra1b (Mus musculus) 6480464 bisphenol S results in decreased expression of ADRA1B mRNA CTD PMID:39298647 Adra1b Rat 4,4'-sulfonyldiphenol affects methylation ISO Adra1b (Mus musculus) 6480464 bisphenol S affects the methylation of ADRA1B gene CTD PMID:31683443 Adra1b Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ADRA1B mRNA CTD PMID:36041667 Adra1b Rat 4,4'-sulfonyldiphenol increases methylation ISO Adra1b (Mus musculus) 6480464 bisphenol S results in increased methylation of ADRA1B exon CTD PMID:33297965 Adra1b Rat 4-aminopyridine multiple interactions EXP 6480464 4-Aminopyridine inhibits the reaction [ADRA1B protein results in increased susceptibility to Phenylephrine] CTD PMID:18480251 Adra1b Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ADRA1B mRNA CTD PMID:24780913 and PMID:25825206 Adra1b Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of ADRA1B mRNA CTD PMID:31881176 Adra1b Rat alfuzosin affects binding ISO ADRA1B (Homo sapiens) 6480464 alfuzosin binds to ADRA1B protein CTD PMID:8183249 Adra1b Rat all-trans-retinoic acid increases expression ISO ADRA1B (Homo sapiens) 6480464 Tretinoin results in increased expression of ADRA1B mRNA CTD PMID:23830798 Adra1b Rat all-trans-retinoic acid increases expression ISO Adra1b (Mus musculus) 6480464 Tretinoin results in increased expression of ADRA1B mRNA CTD PMID:36189433 Adra1b Rat all-trans-retinoic acid multiple interactions ISO Adra1b (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of ADRA1B mRNA CTD PMID:36189433 Adra1b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ADRA1B mRNA CTD PMID:16483693 Adra1b Rat aristolochic acid A increases expression ISO ADRA1B (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ADRA1B mRNA CTD PMID:33212167 Adra1b Rat arsane affects methylation ISO ADRA1B (Homo sapiens) 6480464 Arsenic affects the methylation of ADRA1B gene CTD PMID:25304211 Adra1b Rat arsenic atom affects methylation ISO ADRA1B (Homo sapiens) 6480464 Arsenic affects the methylation of ADRA1B gene CTD PMID:25304211 Adra1b Rat arsenite(3-) increases expression ISO Adra1b (Mus musculus) 6480464 arsenite results in increased expression of ADRA1B mRNA CTD PMID:18191166 and PMID:33053406 Adra1b Rat Bardoxolone methyl decreases activity ISO ADRA1B (Homo sapiens) 6480464 bardoxolone methyl results in decreased activity of ADRA1B protein CTD PMID:28790194 Adra1b Rat benzene decreases expression ISO Adra1b (Mus musculus) 6480464 Benzene results in decreased expression of ADRA1B mRNA CTD PMID:37084897 Adra1b Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of ADRA1B mRNA CTD PMID:21839799 Adra1b Rat benzo[a]pyrene increases methylation ISO ADRA1B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ADRA1B 3' UTR CTD PMID:27901495 Adra1b Rat benzo[a]pyrene increases mutagenesis ISO ADRA1B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of ADRA1B gene CTD PMID:25435355 Adra1b Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of ADRA1B mRNA CTD PMID:16648578 Adra1b Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of ADRA1B mRNA CTD PMID:15620428 and PMID:33789034 Adra1b Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ADRA1B mRNA CTD PMID:25181051 Adra1b Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ADRA1B mRNA CTD PMID:36041667 Adra1b Rat bisphenol A increases expression ISO Adra1b (Mus musculus) 6480464 bisphenol A results in increased expression of ADRA1B mRNA CTD PMID:33221593 Adra1b Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ADRA1B gene CTD PMID:28505145 Adra1b Rat bisphenol A multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ADRA1B mRNA CTD PMID:28628672 Adra1b Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ADRA1B mRNA CTD PMID:36041667 Adra1b Rat bleomycin A2 decreases expression EXP 6480464 Bleomycin results in decreased expression of ADRA1B mRNA CTD PMID:15808516 Adra1b Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of ADRA1B mRNA CTD PMID:19167457 Adra1b Rat calcitriol increases expression ISO ADRA1B (Homo sapiens) 6480464 Calcitriol results in increased expression of ADRA1B mRNA CTD PMID:16002434 Adra1b Rat calcium atom multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [Epinephrine binds to and results in increased activity of ADRA1B protein] which results in increased abundance of Calcium more ... CTD PMID:15306222 more ... Adra1b Rat calcium(0) multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [Epinephrine binds to and results in increased activity of ADRA1B protein] which results in increased abundance of Calcium more ... CTD PMID:15306222 more ... Adra1b Rat cantharidin decreases expression ISO Adra1b (Mus musculus) 6480464 Cantharidin results in decreased expression of ADRA1B mRNA CTD PMID:36907384 Adra1b Rat carbon nanotube decreases expression ISO Adra1b (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Adra1b Rat carmustine decreases expression ISO ADRA1B (Homo sapiens) 6480464 Carmustine results in decreased expression of ADRA1B mRNA CTD PMID:15980968 Adra1b Rat carvedilol multiple interactions ISO ADRA1B (Homo sapiens) 6480464 carvedilol binds to and results in decreased activity of ADRA1B protein more ... CTD PMID:15306222 Adra1b Rat CGP 52608 multiple interactions ISO ADRA1B (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ADRA1B gene] CTD PMID:28238834 Adra1b Rat chlorpromazine decreases activity EXP 6480464 Chlorpromazine results in decreased activity of ADRA1B protein CTD PMID:23611293 Adra1b Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of ADRA1B mRNA CTD PMID:22023808 Adra1b Rat cisplatin multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of ADRA1B mRNA CTD PMID:27392435 Adra1b Rat cisplatin decreases expression ISO ADRA1B (Homo sapiens) 6480464 Cisplatin results in decreased expression of ADRA1B mRNA CTD PMID:27392435 Adra1b Rat clofibrate multiple interactions ISO Adra1b (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ADRA1B mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ADRA1B mRNA] CTD PMID:17585979 Adra1b Rat cocaine increases response to substance ISO Adra1b (Mus musculus) 6480464 ADRA1B gene results in increased susceptibility to Cocaine CTD PMID:14556232 Adra1b Rat copper atom multiple interactions ISO Adra1b (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of ADRA1B mRNA CTD PMID:15467011 Adra1b Rat copper(0) multiple interactions ISO Adra1b (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of ADRA1B mRNA CTD PMID:15467011 Adra1b Rat cyclazosin multiple interactions EXP 6480464 cyclazosin binds to and results in decreased activity of ADRA1B protein CTD PMID:15951348 Adra1b Rat dexamethasone increases expression ISO ADRA1B (Homo sapiens) 6480464 Dexamethasone results in increased expression of ADRA1B mRNA and Dexamethasone results in increased expression of ADRA1B protein CTD PMID:10229127 Adra1b Rat dexamethasone multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ADRA1B mRNA CTD PMID:28628672 Adra1b Rat diazinon increases expression EXP 6480464 Diazinon results in increased expression of ADRA1B mRNA CTD PMID:29108742 Adra1b Rat doxazosin affects binding ISO ADRA1B (Homo sapiens) 6480464 Doxazosin binds to ADRA1B protein CTD PMID:8183249 Adra1b Rat ethylparaben increases expression ISO ADRA1B (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of ADRA1B mRNA CTD PMID:37690743 Adra1b Rat fipronil multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [fipronil co-treated with DEET] results in decreased expression of ADRA1B mRNA CTD PMID:27091632 Adra1b Rat folic acid increases expression ISO Adra1b (Mus musculus) 6480464 Folic Acid results in increased expression of ADRA1B mRNA CTD PMID:25629700 Adra1b Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of ADRA1B mRNA CTD PMID:24395379 Adra1b Rat gold atom multiple interactions ISO Adra1b (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in increased expression of ADRA1B mRNA CTD PMID:19695318 Adra1b Rat gold(0) multiple interactions ISO Adra1b (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in increased expression of ADRA1B mRNA CTD PMID:19695318 Adra1b Rat indometacin multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ADRA1B mRNA CTD PMID:28628672 Adra1b Rat inulin multiple interactions ISO Adra1b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ADRA1B mRNA CTD PMID:36331819 Adra1b Rat iron dichloride decreases expression ISO ADRA1B (Homo sapiens) 6480464 ferrous chloride results in decreased expression of ADRA1B mRNA CTD PMID:35984750 Adra1b Rat isoprenaline multiple interactions ISO Adra1b (Mus musculus) 6480464 ADRA1B protein affects the reaction [Isoproterenol results in increased abundance of Cyclic AMP] CTD PMID:12649302 Adra1b Rat isoprenaline decreases expression ISO Adra1b (Mus musculus) 6480464 Isoproterenol results in decreased expression of ADRA1B mRNA CTD PMID:20003209 Adra1b Rat kainic acid increases response to substance ISO Adra1b (Mus musculus) 6480464 ADRA1B protein results in increased susceptibility to Kainic Acid CTD PMID:19125850 Adra1b Rat ketanserin multiple interactions ISO ADRA1B (Homo sapiens) 6480464 Ketanserin inhibits the reaction [Prazosin binds to ADRA1B protein] CTD PMID:11937776 Adra1b Rat lipopolysaccharide increases expression ISO ADRA1B (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of ADRA1B mRNA CTD PMID:35811015 Adra1b Rat lipopolysaccharide multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Adra1b Rat methamphetamine affects response to substance ISO Adra1b (Mus musculus) 6480464 ADRA1B protein affects the susceptibility to Methamphetamine CTD PMID:12871582 Adra1b Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of ADRA1B gene CTD PMID:23303685 Adra1b Rat methylphenidate increases expression EXP 6480464 Methylphenidate results in increased expression of ADRA1B mRNA CTD PMID:17105903 Adra1b Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Adra1b (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of ADRA1B mRNA CTD PMID:36189433 Adra1b Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of ADRA1B mRNA CTD PMID:21515302 Adra1b Rat N,N-diethyl-m-toluamide multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [fipronil co-treated with DEET] results in decreased expression of ADRA1B mRNA CTD PMID:27091632 Adra1b Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of ADRA1B mRNA CTD PMID:19638242 Adra1b Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of ADRA1B mRNA CTD PMID:28943392 Adra1b Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of ADRA1B mRNA CTD PMID:25380136 Adra1b Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of ADRA1B mRNA CTD PMID:24136188 Adra1b Rat oxymetazoline multiple interactions ISO ADRA1B (Homo sapiens) 6480464 Oxymetazoline inhibits the reaction [ADRA1B protein binds to Prazosin] CTD PMID:20030735 Adra1b Rat oxymetazoline affects binding ISO ADRA1B (Homo sapiens) 6480464 Oxymetazoline binds to ADRA1B protein CTD PMID:20030735 Adra1b Rat paracetamol multiple interactions ISO Adra1b (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ADRA1B mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ADRA1B mRNA] CTD PMID:17585979 Adra1b Rat paracetamol increases expression ISO ADRA1B (Homo sapiens) 6480464 Acetaminophen results in increased expression of ADRA1B mRNA CTD PMID:26690555 Adra1b Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of ADRA1B mRNA CTD PMID:19162173 Adra1b Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Adra1b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ADRA1B mRNA CTD PMID:36331819 Adra1b Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of ADRA1B mRNA CTD PMID:19162173 Adra1b Rat phenobarbital increases expression ISO Adra1b (Mus musculus) 6480464 Phenobarbital results in increased expression of ADRA1B mRNA CTD PMID:19270015 Adra1b Rat phentolamine multiple interactions ISO ADRA1B (Homo sapiens) 6480464 Phentolamine inhibits the reaction [[Epinephrine results in increased activity of ADRA1B protein] which results in increased abundance of Calcium] more ... CTD PMID:15306222 Adra1b Rat phentolamine affects binding ISO ADRA1B (Homo sapiens) 6480464 Phentolamine binds to ADRA1B protein CTD PMID:15306222 Adra1b Rat phenylephrine affects response to substance ISO ADRA1B (Homo sapiens) 6480464 ADRA1B protein affects the susceptibility to Phenylephrine CTD PMID:18257748 Adra1b Rat phenylephrine multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [Phenylephrine co-treated with ADRA1B protein] results in increased phosphorylation of MAPK1 protein more ... CTD PMID:15306222 and PMID:16498073 Adra1b Rat phenylephrine increases activity ISO ADRA1B (Homo sapiens) 6480464 Phenylephrine results in increased activity of ADRA1B protein CTD PMID:15306222 and PMID:16498073 Adra1b Rat phenylephrine decreases expression EXP 6480464 Phenylephrine results in decreased expression of ADRA1B mRNA and Phenylephrine results in decreased expression of ADRA1B protein CTD PMID:11693201 Adra1b Rat phenylephrine increases response to substance EXP 6480464 ADRA1B protein results in increased susceptibility to Phenylephrine CTD PMID:18480251 Adra1b Rat phenylephrine multiple interactions EXP 6480464 4-Aminopyridine inhibits the reaction [ADRA1B protein results in increased susceptibility to Phenylephrine] more ... CTD PMID:10801782 and PMID:18480251 Adra1b Rat phenylephrine multiple interactions ISO Adra1b (Mus musculus) 6480464 [Phenylephrine co-treated with ADRA1B protein] results in decreased expression of ATP2A2 protein more ... CTD PMID:11499749 Adra1b Rat phenylephrine increases response to substance ISO Adra1b (Mus musculus) 6480464 ADRA1B protein results in increased susceptibility to Phenylephrine CTD PMID:11499749 Adra1b Rat picrotoxin increases expression EXP 6480464 Picrotoxin results in increased expression of ADRA1B mRNA CTD PMID:15170462 Adra1b Rat pirinixic acid multiple interactions ISO Adra1b (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of ADRA1B mRNA CTD PMID:19710929 Adra1b Rat pirinixic acid decreases expression ISO Adra1b (Mus musculus) 6480464 pirinixic acid results in decreased expression of ADRA1B mRNA CTD PMID:23811191 Adra1b Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of ADRA1B mRNA CTD PMID:19162173 and PMID:22484513 Adra1b Rat potassium chromate decreases expression ISO ADRA1B (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ADRA1B mRNA CTD PMID:22079256 Adra1b Rat potassium chromate multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ADRA1B mRNA CTD PMID:22079256 Adra1b Rat potassium dichromate increases expression ISO Adra1b (Mus musculus) 6480464 Potassium Dichromate results in increased expression of ADRA1B mRNA CTD PMID:23608068 Adra1b Rat prazosin multiple interactions ISO ADRA1B (Homo sapiens) 6480464 1-(2-(3-methoxyphenyl)ethyl)phenoxy-3-(dimethylamino)-2-propanol inhibits the reaction [Prazosin binds to ADRA1B protein] more ... CTD PMID:11937776 and PMID:20030735 Adra1b Rat prazosin increases expression EXP 6480464 Prazosin results in increased expression of ADRA1B protein CTD PMID:11934817 Adra1b Rat prazosin multiple interactions EXP 6480464 Prazosin binds to and affects the activity of ADRA1B protein CTD PMID:9639061 Adra1b Rat prazosin affects binding ISO ADRA1B (Homo sapiens) 6480464 ADRA1B protein binds to Prazosin and Prazosin binds to ADRA1B protein CTD PMID:20030735 and PMID:8183249 Adra1b Rat propiconazole decreases expression ISO Adra1b (Mus musculus) 6480464 propiconazole results in decreased expression of ADRA1B mRNA CTD PMID:21278054 Adra1b Rat quinidine affects binding ISO ADRA1B (Homo sapiens) 6480464 Quinidine binds to ADRA1B protein CTD PMID:9570190 Adra1b Rat quinidine multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [Quinidine co-treated with Verapamil] inhibits the reaction [ADRA1B protein results in increased abundance of Inositol 1 more ... CTD PMID:9570190 Adra1b Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ADRA1B mRNA CTD PMID:28374803 Adra1b Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO ADRA1B (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of ADRA1B mRNA CTD PMID:33725128 Adra1b Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Adra1b Rat sarpogrelate multiple interactions ISO ADRA1B (Homo sapiens) 6480464 sarpogrelate inhibits the reaction [Prazosin binds to ADRA1B protein] CTD PMID:11937776 Adra1b Rat sodium arsenite increases expression ISO ADRA1B (Homo sapiens) 6480464 sodium arsenite results in increased expression of ADRA1B mRNA CTD PMID:34032870 Adra1b Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of ADRA1B mRNA CTD PMID:25993096 Adra1b Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of ADRA1B mRNA CTD PMID:19298542 Adra1b Rat sunitinib increases expression ISO ADRA1B (Homo sapiens) 6480464 Sunitinib results in increased expression of ADRA1B mRNA CTD PMID:31533062 Adra1b Rat taurine increases expression ISO ADRA1B (Homo sapiens) 6480464 Taurine results in increased expression of ADRA1B mRNA CTD PMID:16579726 Adra1b Rat terazosin affects binding ISO ADRA1B (Homo sapiens) 6480464 Terazosin binds to ADRA1B protein CTD PMID:8183249 Adra1b Rat terbutaline increases expression ISO ADRA1B (Homo sapiens) 6480464 Terbutaline results in increased expression of ADRA1B mRNA and Terbutaline results in increased expression of ADRA1B protein CTD PMID:10229127 Adra1b Rat testosterone affects expression EXP 6480464 Testosterone affects the expression of ADRA1B mRNA CTD PMID:22028410 Adra1b Rat tetrachloromethane decreases expression ISO Adra1b (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ADRA1B mRNA CTD PMID:17484886 Adra1b Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ADRA1B mRNA] CTD PMID:31150632 Adra1b Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ADRA1B mRNA CTD PMID:31150632 Adra1b Rat tetraphene decreases expression ISO Adra1b (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of ADRA1B mRNA CTD PMID:26377693 Adra1b Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ADRA1B mRNA CTD PMID:23411599 Adra1b Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of ADRA1B mRNA CTD PMID:28943392 Adra1b Rat titanium dioxide increases expression ISO Adra1b (Mus musculus) 6480464 titanium dioxide results in increased expression of ADRA1B mRNA CTD PMID:23557971 Adra1b Rat titanium dioxide decreases methylation ISO Adra1b (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ADRA1B gene CTD PMID:35295148 Adra1b Rat trimellitic anhydride decreases expression ISO Adra1b (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of ADRA1B mRNA CTD PMID:19042947 Adra1b Rat triptonide decreases expression ISO Adra1b (Mus musculus) 6480464 triptonide results in decreased expression of ADRA1B mRNA CTD PMID:33045310 Adra1b Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of ADRA1B mRNA CTD PMID:21515302 Adra1b Rat verapamil affects binding ISO ADRA1B (Homo sapiens) 6480464 Verapamil binds to ADRA1B protein CTD PMID:9570190 Adra1b Rat verapamil multiple interactions ISO ADRA1B (Homo sapiens) 6480464 [Quinidine co-treated with Verapamil] inhibits the reaction [ADRA1B protein results in increased abundance of Inositol 1 more ... CTD PMID:9570190 Adra1b Rat Xylometazoline affects binding ISO ADRA1B (Homo sapiens) 6480464 xylometazoline binds to ADRA1B protein CTD PMID:20030735 Adra1b Rat Xylometazoline multiple interactions ISO ADRA1B (Homo sapiens) 6480464 xylometazoline inhibits the reaction [ADRA1B protein binds to Prazosin] CTD PMID:20030735
Imported Annotations - KEGG (archival)
(+)-pilocarpine (ISO) (+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) (R)-adrenaline (ISO) (R)-noradrenaline (ISO) (S)-amphetamine (ISO) 1,2-dichloroethane (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 1D-myo-inositol 1,4,5-trisphosphate (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dinitrotoluene (EXP) 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (ISO) 3',5'-cyclic AMP (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-aminopyridine (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) alfuzosin (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) Bardoxolone methyl (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP) bleomycin A2 (EXP) C60 fullerene (EXP) calcitriol (ISO) calcium atom (ISO) calcium(0) (ISO) cantharidin (ISO) carbon nanotube (ISO) carmustine (ISO) carvedilol (ISO) CGP 52608 (ISO) chlorpromazine (EXP) cisplatin (EXP,ISO) clofibrate (ISO) cocaine (ISO) copper atom (ISO) copper(0) (ISO) cyclazosin (EXP) dexamethasone (ISO) diazinon (EXP) doxazosin (ISO) ethylparaben (ISO) fipronil (ISO) folic acid (ISO) glycidol (EXP) gold atom (ISO) gold(0) (ISO) indometacin (ISO) inulin (ISO) iron dichloride (ISO) isoprenaline (ISO) kainic acid (ISO) ketanserin (ISO) lipopolysaccharide (ISO) methamphetamine (ISO) methoxychlor (EXP) methylphenidate (EXP) mono(2-ethylhexyl) phthalate (ISO) Muraglitazar (EXP) N,N-diethyl-m-toluamide (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nefazodone (EXP) oxymetazoline (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phentolamine (ISO) phenylephrine (EXP,ISO) picrotoxin (EXP) pirinixic acid (EXP,ISO) potassium chromate (ISO) potassium dichromate (ISO) prazosin (EXP,ISO) propiconazole (ISO) quinidine (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sarpogrelate (ISO) sodium arsenite (ISO) sodium dichromate (EXP) streptozocin (EXP) sunitinib (ISO) taurine (ISO) terazosin (ISO) terbutaline (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) trimellitic anhydride (ISO) triptonide (ISO) troglitazone (EXP) verapamil (ISO) Xylometazoline (ISO)
1.
Impaired glucose homeostasis in mice lacking the alpha1b-adrenergic receptor subtype.
Burcelin R, etal., J Biol Chem. 2004 Jan 9;279(2):1108-15. Epub 2003 Oct 27.
2.
Effects of castration and of testosterone replacement on alpha(1)-adrenoceptor subtypes in the rat vas deferens.
Campos M, etal., Eur J Pharmacol. 2003 Jun 20;471(2):149-55.
3.
Adrenaline (via alpha(1B)-adrenoceptors) and ethanol stimulate OH* radical production in isolated rat hepatocytes.
Castrejon-Sosa M, etal., Life Sci. 2002 Oct 11;71(21):2469-74.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Circadian-related heteromerization of adrenergic and dopamine D4 receptors modulates melatonin synthesis and release in the pineal gland.
González S, etal., PLoS Biol. 2012;10(6):e1001347. doi: 10.1371/journal.pbio.1001347. Epub 2012 Jun 19.
7.
Cell surface expression of alpha1D-adrenergic receptors is controlled by heterodimerization with alpha1B-adrenergic receptors.
Hague C, etal., J Biol Chem. 2004 Apr 9;279(15):15541-9. Epub 2004 Jan 21.
8.
Modulation of intracellular Ca(2+) via alpha(1B)-adrenoreceptor signaling molecules, G alpha(h) (transglutaminase II) and phospholipase C-delta 1.
Kang SK, etal., Biochem Biophys Res Commun 2002 Apr 26;293(1):383-90.
9.
Nandrolone treatment decreases the alpha1B-adrenoceptor mRNA level in rat kidney, but not the density of alpha1B-adrenoceptors in cultured MDCK-D1 kidney cells.
Lindblom J, etal., Eur J Pharmacol. 2005 Dec 19;527(1-3):157-62. Epub 2005 Nov 23.
10.
Molecular cloning and expression of the cDNA for the alpha 1A-adrenergic receptor. The gene for which is located on human chromosome 5.
Lomasney JW, etal., J Biol Chem 1991 Apr 5;266(10):6365-9.
11.
Ovarian expression of alpha (1)- and beta (2)-adrenoceptors and p75 neurotrophin receptors in rats with steroid-induced polycystic ovaries.
Manni L, etal., Auton Neurosci. 2005 Mar 31;118(1-2):79-87.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.
Interaction of alpha1-adrenoceptor subtypes with different G proteins induces opposite effects on cardiac L-type Ca2+ channel.
O-Uchi J, etal., Circ Res. 2008 Jun 6;102(11):1378-88. Epub 2008 May 8.
15.
MURC, a muscle-restricted coiled-coil protein that modulates the Rho/ROCK pathway, induces cardiac dysfunction and conduction disturbance.
Ogata T, etal., Mol Cell Biol. 2008 May;28(10):3424-36. doi: 10.1128/MCB.02186-07. Epub 2008 Mar 10.
16.
Alpha-1B adrenoceptors mediate neurogenic constriction in mesenteric arteries of normotensive and DOCA-salt hypertensive mice.
Perez-Rivera AA, etal., Auton Neurosci. 2005 Aug 31;121(1-2):64-73.
17.
Alpha1-adrenergic receptors: new insights and directions.
Piascik MT and Perez DM, J Pharmacol Exp Ther. 2001 Aug;298(2):403-10.
18.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
19.
Functional interactions between estrogen and insulin-like growth factor-I in the regulation of alpha 1B-adrenoceptors and female reproductive function.
Quesada A and Etgen AM, J Neurosci. 2002 Mar 15;22(6):2401-8.
20.
GOA pipeline
RGD automated data pipeline
21.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
22.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
23.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
24.
Gene-based anchoring of the rat genetic linkage and cytogenetic maps: new regional localizations, orientation of the linkage groups, and insights into mammalian chromosome evolution.
Szpirer C, etal., Mamm Genome 1998 Sep;9(9):721-34
25.
Sequence of a rat brain cDNA encoding an alpha-1B adrenergic receptor.
Voigt MM, etal., Nucleic Acids Res 1990 Feb 25;18(4):1053.
Adra1b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 28,756,461 - 28,874,831 (-) NCBI GRCr8 mRatBN7.2 10 28,255,025 - 28,373,418 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 28,255,025 - 28,312,919 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 33,014,641 - 33,072,459 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 1,553,026 - 1,610,850 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 27,985,197 - 28,043,019 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 29,392,762 - 29,450,644 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 29,392,762 - 29,450,644 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 29,233,972 - 29,291,344 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 28,889,092 - 28,946,889 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 28,890,140 - 28,947,938 (-) NCBI Celera 10 27,744,674 - 27,802,198 (-) NCBI Celera Cytogenetic Map 10 q21 NCBI
ADRA1B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 159,865,086 - 159,989,205 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 159,865,080 - 159,973,012 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 159,343,489 - 159,400,019 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 159,276,318 - 159,332,595 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 159,276,317 - 159,332,129 NCBI Celera 5 155,374,535 - 155,430,824 (+) NCBI Celera Cytogenetic Map 5 q33.3 NCBI HuRef 5 154,438,201 - 154,494,477 (+) NCBI HuRef CHM1_1 5 158,776,756 - 158,833,023 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 160,393,464 - 160,517,778 (+) NCBI T2T-CHM13v2.0
Adra1b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 43,665,432 - 43,792,076 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 43,665,433 - 43,792,037 (-) Ensembl GRCm39 Ensembl GRCm38 11 43,774,605 - 43,901,250 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 43,774,606 - 43,901,210 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 43,588,108 - 43,649,834 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 43,618,029 - 43,679,755 (-) NCBI MGSCv36 mm8 Celera 11 48,401,465 - 48,463,919 (-) NCBI Celera Cytogenetic Map 11 B1.1 NCBI cM Map 11 25.81 NCBI
Adra1b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955408 13,883,574 - 13,937,709 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955408 13,883,574 - 13,937,798 (+) NCBI ChiLan1.0 ChiLan1.0
ADRA1B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 155,101,569 - 155,158,235 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 153,241,121 - 153,297,783 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 155,307,148 - 155,363,785 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 161,923,708 - 161,954,901 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 161,923,895 - 161,979,461 (+) Ensembl panpan1.1 panPan2
ADRA1B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 50,676,816 - 50,724,999 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 50,677,255 - 50,724,999 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 50,570,905 - 50,619,105 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 51,111,625 - 51,159,868 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 51,111,625 - 51,159,868 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 50,919,759 - 50,967,913 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 51,043,059 - 51,091,264 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 51,563,698 - 51,612,138 (-) NCBI UU_Cfam_GSD_1.0
Adra1b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 105,074,452 - 105,123,271 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936515 3,523,797 - 3,572,596 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936515 3,523,799 - 3,572,467 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ADRA1B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 63,550,130 - 63,603,034 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 63,550,123 - 64,010,838 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 69,039,634 - 69,092,211 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ADRA1B
Adra1b
.
6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 2298480 Eau7 Experimental allergic uveoretinitis QTL 7 0.0049 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 27957626 34490668 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 631531 Iresp2 Immunoglobin response QTL2 6.3 blood immunoglobulin E amount (VT:0002492) serum immunoglobulin E level (CMO:0002101) 10 22918268 36400810 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
D10Wox8
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 10 298.61 UniSTS RH 3.4 Map 10 298.61 RGD RH 2.0 Map 10 367.3 RGD Cytogenetic Map 10 q21 UniSTS
RH133503
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 28,255,057 - 28,255,254 (+) MAPPER mRatBN7.2 Rnor_6.0 10 29,392,795 - 29,392,991 NCBI Rnor6.0 Rnor_5.0 10 29,234,005 - 29,234,201 UniSTS Rnor5.0 RGSC_v3.4 10 28,889,125 - 28,889,321 UniSTS RGSC3.4 Celera 10 27,744,707 - 27,744,903 UniSTS RH 3.4 Map 10 296.7 UniSTS Cytogenetic Map 10 q21 UniSTS
PMC150908P1
Rat Assembly Chr Position (strand) Source JBrowse Rnor_6.0 10 29,449,417 - 29,450,205 NCBI Rnor6.0 Rnor_5.0 10 29,290,117 - 29,290,905 UniSTS Rnor5.0 RGSC_v3.4 10 28,945,662 - 28,946,450 UniSTS RGSC3.4 Cytogenetic Map 10 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
11
49
113
90
89
59
24
59
6
216
96
93
45
60
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000087937 ⟹ ENSRNOP00000073309
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 28,255,025 - 28,312,919 (-) Ensembl Rnor_6.0 Ensembl 10 29,392,762 - 29,450,644 (-) Ensembl
RefSeq Acc Id:
NM_016991 ⟹ NP_058687
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 28,756,461 - 28,814,347 (-) NCBI mRatBN7.2 10 28,255,025 - 28,312,919 (-) NCBI Rnor_6.0 10 29,392,762 - 29,450,644 (-) NCBI Rnor_5.0 10 29,233,972 - 29,291,344 (-) NCBI RGSC_v3.4 10 28,889,092 - 28,946,889 (-) RGD Celera 10 27,744,674 - 27,802,198 (-) RGD
Sequence:
CGATCGCTGGGCGGAGAAGGCACCGCGGTCCGCAGACCCGCTGCGGGCCGGGCACAGCCGGGCACCCCCGGCCCCGCGCCTGCTCCTCCCAGCGCTCCCGCGCCAGCCGGGCCAGGCGCGCCTGACGT
hide sequence
RefSeq Acc Id:
XM_039085165 ⟹ XP_038941093
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 28,756,461 - 28,874,831 (-) NCBI mRatBN7.2 10 28,255,025 - 28,373,418 (-) NCBI
RefSeq Acc Id:
XM_063268387 ⟹ XP_063124457
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 28,757,484 - 28,874,831 (-) NCBI
RefSeq Acc Id:
XM_063268388 ⟹ XP_063124458
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 28,795,424 - 28,874,831 (-) NCBI
RefSeq Acc Id:
NP_058687 ⟸ NM_016991
- UniProtKB:
Q63215 (UniProtKB/Swiss-Prot), P15823 (UniProtKB/Swiss-Prot), Q6IRH4 (UniProtKB/TrEMBL), A0A0G2K564 (UniProtKB/TrEMBL)
- Sequence:
MNPDLDTGHNTSAPAHWGELKDDNFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDIWAAVDVLC
hide sequence
Ensembl Acc Id:
ENSRNOP00000073309 ⟸ ENSRNOT00000087937
RefSeq Acc Id:
XP_038941093 ⟸ XM_039085165
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063124457 ⟸ XM_063268387
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063124458 ⟸ XM_063268388
- Peptide Label:
isoform X2
RGD ID: 13697119 Promoter ID: EPDNEW_R7643 Type: single initiation site Name: Adra1b_1 Description: adrenoceptor alpha 1B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 29,450,685 - 29,450,745 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-07-13
Adra1b
adrenoceptor alpha 1B
Adra1b
adrenergic, alpha-1B-, receptor
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-18
Adra1b
adrenergic, alpha-1B-, receptor
Adra1b
adrenergic receptor, alpha 1b
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2003-04-09
Adra1b
adrenergic receptor, alpha 1b
adrenergic, alpha 1B, receptor
Name updated
629478 APPROVED
2002-06-10
Adra1b
adrenergic, alpha 1B, receptor
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_physical_interaction
associates with G proteins that activate a phosphatidylinositol- calcium second messenger system
61489
gene_process
mediates blood pressure and aorta contractile responses induced by alpha-1 agonists
