Symbol:
Trpm1
Name:
transient receptor potential cation channel, subfamily M, member 1
RGD ID:
1597140
Description:
Predicted to enable calcium channel activity. Predicted to be involved in G protein-coupled glutamate receptor signaling pathway; calcium ion import across plasma membrane; and visual perception. Predicted to act upstream of or within several processes, including cellular response to light stimulus; protein localization; and retinal rod cell development. Predicted to be located in endoplasmic reticulum and new growing cell tip. Predicted to be active in cell tip; dendrite; and plasma membrane. Human ortholog(s) of this gene implicated in congenital stationary night blindness and congenital stationary night blindness 1C. Orthologous to human TRPM1 (transient receptor potential cation channel subfamily M member 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; amphetamine; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
melastatin; melastatin-1; transient receptor potential cation channel subfamily M member 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TRPM1 (transient receptor potential cation channel subfamily M member 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Trpm1 (transient receptor potential cation channel, subfamily M, member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Trpm1 (transient receptor potential cation channel subfamily M member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TRPM1 (transient receptor potential cation channel subfamily M member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TRPM1 (transient receptor potential cation channel subfamily M member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Trpm1 (transient receptor potential cation channel subfamily M member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TRPM1 (transient receptor potential cation channel subfamily M member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TRPM1 (transient receptor potential cation channel subfamily M member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Trpm1 (transient receptor potential cation channel subfamily M member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TRPM1 (transient receptor potential cation channel subfamily M member 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Trpm1 (transient receptor potential cation channel, subfamily M, member 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
trpm1a (transient receptor potential cation channel, subfamily M, member 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
trpm1b (transient receptor potential cation channel, subfamily M, member 1b)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
gon-2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Trpm
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
trpm1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 127,130,686 - 127,247,219 (+) NCBI GRCr8 mRatBN7.2 1 117,718,896 - 117,835,434 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 117,718,896 - 117,834,605 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 125,693,996 - 125,809,613 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 132,876,553 - 132,992,162 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 125,707,003 - 125,822,518 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 124,983,391 - 125,101,759 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 124,983,452 - 125,099,573 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 126,092,991 - 126,210,809 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 118,583,516 - 118,700,653 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 109,974,992 - 110,090,741 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Trpm1 Rat autism spectrum disorder ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Autism spectrum disorder ClinVar PMID:19050728|PMID:19289393|PMID:21844811|PMID:23044707|PMID:25255310|PMID:25741868|PMID:27569545 Trpm1 Rat autistic disorder ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Autism ClinVar PMID:21681106|PMID:30208311 Trpm1 Rat chromosome 15q13.3 microdeletion syndrome ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Chromosome 15q13.3 microdeletion syndrome ClinVar PMID:31690835 Trpm1 Rat colorectal cancer ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Familial colorectal cancer ClinVar PMID:22561515|PMID:25992589|PMID:26493165|PMID:28492532 Trpm1 Rat congenital stationary night blindness ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Congenital Stationary Night Blindness, Recessive | ClinVar Annotator: match by more ... ClinVar PMID:17576681|PMID:19878917|PMID:19896113|PMID:19966281|PMID:20300565|PMID:25741868|PMID:27803854|PMID:28041643|PMID:28492532|PMID:29074561|PMID:33691579|PMID:35633130|PMID:9536098 Trpm1 Rat congenital stationary night blindness 1C ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Congenital stationary night blindness 1C | ClinVar Annotator: match by more ... ClinVar PMID:16199547|PMID:17576681|PMID:19436059|PMID:19878917|PMID:19896109|PMID:19896113|PMID:19966281|PMID:20300565|PMID:22277662|PMID:25307992|PMID:25741868|PMID:25999674|PMID:26493165|PMID:26872967|PMID:27803854|PMID:28492532|PMID:28559085|PMID:28838317|PMID:29522070|PMID:30487145|PMID:30718709|PMID:31589614|PMID:31908403|PMID:33691579|PMID:35456422|PMID:35457050|PMID:35633130|PMID:9536098 Trpm1 Rat Ependymomas ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Ependymoma ClinVar Trpm1 Rat fundus dystrophy ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Retinal dystrophy ClinVar PMID:16199547|PMID:17576681|PMID:19896109|PMID:19896113|PMID:19966281|PMID:20300565|PMID:23714322|PMID:24715752|PMID:25307992|PMID:25741868|PMID:26633542|PMID:28341476|PMID:28492532|PMID:28559085|PMID:28726569|PMID:29522070|PMID:30487145|PMID:31427709|PMID:31589614|PMID:31645983|PMID:31725702|PMID:32141364|PMID:3378126|PMID:33781268|PMID:34426522|PMID:35119454|PMID:35456422|PMID:35457050|PMID:35567543|PMID:35633130|PMID:9536098 Trpm1 Rat genetic disease ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:25741868|PMID:28492532 Trpm1 Rat intellectual disability ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Intellectual disability ClinVar PMID:25741868 Trpm1 Rat Neurodevelopmental Disorders ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Neurodevelopmental disorder ClinVar PMID:25741868 Trpm1 Rat night blindness ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Night blindness ClinVar PMID:19896113|PMID:25741868|PMID:33691579 Trpm1 Rat optic atrophy ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Optic atrophy ClinVar PMID:25741868|PMID:28492532 Trpm1 Rat retinitis pigmentosa ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Retinitis pigmentosa | ClinVar Annotator: match by term: Tapetoretinal degeneration ClinVar PMID:25741868|PMID:28492532|PMID:30718709 Trpm1 Rat schizophrenia ISO RGD:1312607 8554872 ClinVar Annotator: match by term: Schizophrenia ClinVar PMID:21681106|PMID:30208311
Only show annotations with direct experimental evidence (0 objects hidden)
Trpm1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1312608 6480464 Tetrachlorodibenzodioxin affects the expression of TRPM1 mRNA CTD PMID:21570461 Trpm1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TRPM1 mRNA CTD PMID:33387578 Trpm1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1312607 6480464 bisphenol S results in decreased methylation of TRPM1 gene CTD PMID:31601247 Trpm1 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:1312608 6480464 bisphenol S affects the methylation of TRPM1 gene CTD PMID:31683443 Trpm1 Rat aflatoxin B1 increases methylation ISO RGD:1312607 6480464 Aflatoxin B1 results in increased methylation of TRPM1 gene; Aflatoxin B1 results in increased methylation more ... CTD PMID:27153756|PMID:30157460 Trpm1 Rat Aflatoxin B2 alpha increases methylation ISO RGD:1312607 6480464 aflatoxin B2 results in increased methylation of TRPM1 intron CTD PMID:30157460 Trpm1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of TRPM1 mRNA CTD PMID:30779732 Trpm1 Rat Azoxymethane multiple interactions ISO RGD:1312608 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] affects the expression of TRPM1 mRNA CTD PMID:29950665 Trpm1 Rat benzo[a]pyrene affects methylation ISO RGD:1312607 6480464 Benzo(a)pyrene affects the methylation of TRPM1 5' UTR CTD PMID:27901495 Trpm1 Rat benzo[a]pyrene increases methylation ISO RGD:1312607 6480464 Benzo(a)pyrene results in increased methylation of TRPM1 promoter CTD PMID:27901495 Trpm1 Rat benzo[e]pyrene increases methylation ISO RGD:1312607 6480464 benzo(e)pyrene results in increased methylation of TRPM1 intron CTD PMID:30157460 Trpm1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TRPM1 mRNA CTD PMID:25181051 Trpm1 Rat bisphenol A multiple interactions ISO RGD:1312607 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of TRPM1 gene CTD PMID:31601247 Trpm1 Rat bisphenol A decreases methylation ISO RGD:1312607 6480464 bisphenol A results in decreased methylation of TRPM1 gene CTD PMID:31601247 Trpm1 Rat cadmium atom multiple interactions ISO RGD:1312607 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TRPM1 more ... CTD PMID:35301059 Trpm1 Rat cadmium dichloride multiple interactions ISO RGD:1312607 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TRPM1 more ... CTD PMID:35301059 Trpm1 Rat carbon nanotube decreases expression ISO RGD:1312608 6480464 Nanotubes, Carbon analog results in decreased expression of TRPM1 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Trpm1 Rat CGP 52608 multiple interactions ISO RGD:1312607 6480464 CGP 52608 promotes the reaction [RORA protein binds to TRPM1 gene] CTD PMID:28238834 Trpm1 Rat chlorpyrifos increases expression ISO RGD:1312608 6480464 Chlorpyrifos results in increased expression of TRPM1 mRNA CTD PMID:37019170 Trpm1 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of TRPM1 mRNA CTD PMID:26033743 Trpm1 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of TRPM1 mRNA CTD PMID:26033743 Trpm1 Rat crocidolite asbestos increases expression ISO RGD:1312608 6480464 Asbestos, Crocidolite results in increased expression of TRPM1 mRNA CTD PMID:29279043 Trpm1 Rat dextran sulfate multiple interactions ISO RGD:1312608 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] affects the expression of TRPM1 mRNA CTD PMID:29950665 Trpm1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of TRPM1 mRNA CTD PMID:29391264 Trpm1 Rat folic acid decreases expression ISO RGD:1312608 6480464 Folic Acid results in decreased expression of TRPM1 mRNA CTD PMID:25629700 Trpm1 Rat fulvestrant multiple interactions ISO RGD:1312607 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of TRPM1 gene CTD PMID:31601247 Trpm1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of TRPM1 mRNA CTD PMID:25539665 Trpm1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TRPM1 mRNA CTD PMID:33387578 Trpm1 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of TRPM1 mRNA CTD PMID:22641619 Trpm1 Rat linsidomine increases oxidation EXP 6480464 linsidomine results in increased oxidation of TRPM1 protein CTD PMID:28086193 Trpm1 Rat lipopolysaccharide multiple interactions ISO RGD:1312607 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TRPM1 mRNA CTD PMID:35811015 Trpm1 Rat manganese atom increases expression ISO RGD:1312607 6480464 Manganese results in increased expression of TRPM1 mRNA CTD PMID:17175027 Trpm1 Rat manganese(0) increases expression ISO RGD:1312607 6480464 Manganese results in increased expression of TRPM1 mRNA CTD PMID:17175027 Trpm1 Rat manganese(II) chloride increases expression ISO RGD:1312607 6480464 manganese chloride results in increased expression of TRPM1 mRNA CTD PMID:17175027 Trpm1 Rat methapyrilene increases methylation ISO RGD:1312607 6480464 Methapyrilene results in increased methylation of TRPM1 intron CTD PMID:30157460 Trpm1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of TRPM1 gene CTD PMID:35440735 Trpm1 Rat N-nitrosodiethylamine increases expression ISO RGD:1312608 6480464 Diethylnitrosamine results in increased expression of TRPM1 mRNA CTD PMID:17942915 Trpm1 Rat N-nitrosodiethylamine multiple interactions ISO RGD:1312608 6480464 MET protein inhibits the reaction [Diethylnitrosamine results in increased expression of TRPM1 mRNA] CTD PMID:17942915 Trpm1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TRPM1 mRNA CTD PMID:33387578 Trpm1 Rat resveratrol multiple interactions ISO RGD:1312607 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of TRPM1 mRNA CTD PMID:23557933 Trpm1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1312607 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TRPM1 mRNA CTD PMID:35811015 Trpm1 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO RGD:1312607 6480464 S-(1,2-dichlorovinyl)cysteine results in increased expression of TRPM1 mRNA CTD PMID:35811015 Trpm1 Rat titanium dioxide decreases expression ISO RGD:1312608 6480464 titanium dioxide results in decreased expression of TRPM1 mRNA CTD PMID:29264374 Trpm1 Rat titanium dioxide multiple interactions ISO RGD:1312608 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] affects the expression of TRPM1 mRNA CTD PMID:29950665 Trpm1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of TRPM1 mRNA CTD PMID:33387578 Trpm1 Rat triptonide increases expression ISO RGD:1312608 6480464 triptonide results in increased expression of TRPM1 mRNA CTD PMID:33045310 Trpm1 Rat valproic acid decreases methylation ISO RGD:1312607 6480464 Valproic Acid results in decreased methylation of TRPM1 gene CTD PMID:29154799 Trpm1 Rat VX nerve agent increases expression ISO RGD:1312607 6480464 VX-agent results in increased expression of TRPM1 mRNA CTD PMID:38555327
1.
TRPM1 is mutated in patients with autosomal-recessive complete congenital stationary night blindness.
Audo I, etal., Am J Hum Genet. 2009 Nov;85(5):720-9. doi: 10.1016/j.ajhg.2009.10.013. Epub 2009 Nov 5.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Recessive mutations of the gene TRPM1 abrogate ON bipolar cell function and cause complete congenital stationary night blindness in humans.
Li Z, etal., Am J Hum Genet. 2009 Nov;85(5):711-9. doi: 10.1016/j.ajhg.2009.10.003. Epub 2009 Oct 29.
4.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
5.
GOA pipeline
RGD automated data pipeline
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Genetic variants in transient receptor potential cation channel, subfamily M 1 (TRPM1) and their risk of albuminuria-related traits in Mexican Americans.
Thameem F, etal., Clin Chim Acta. 2011 Nov 20;412(23-24):2058-62. doi: 10.1016/j.cca.2011.03.024. Epub 2011 Apr 1.
9.
Mutations in TRPM1 are a common cause of complete congenital stationary night blindness.
van Genderen MM, etal., Am J Hum Genet. 2009 Nov;85(5):730-6. doi: 10.1016/j.ajhg.2009.10.012. Epub 2009 Nov 5.
Trpm1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 127,130,686 - 127,247,219 (+) NCBI GRCr8 mRatBN7.2 1 117,718,896 - 117,835,434 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 117,718,896 - 117,834,605 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 125,693,996 - 125,809,613 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 132,876,553 - 132,992,162 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 125,707,003 - 125,822,518 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 124,983,391 - 125,101,759 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 124,983,452 - 125,099,573 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 126,092,991 - 126,210,809 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 118,583,516 - 118,700,653 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 109,974,992 - 110,090,741 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
TRPM1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 31,001,065 - 31,161,160 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 31,001,065 - 31,161,160 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 31,293,268 - 31,453,363 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 29,080,829 - 29,181,216 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 29,080,844 - 29,181,216 NCBI Celera 15 9,019,006 - 9,119,394 (-) NCBI Celera Cytogenetic Map 15 q13.3 NCBI HuRef 15 8,470,226 - 8,630,487 (-) NCBI HuRef CHM1_1 15 31,284,115 - 31,444,331 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 28,795,157 - 28,955,270 (-) NCBI T2T-CHM13v2.0
Trpm1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 63,803,583 - 63,923,630 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 63,803,583 - 63,919,523 (+) Ensembl GRCm39 Ensembl GRCm38 7 64,153,835 - 64,269,772 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 64,153,835 - 64,269,775 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 71,298,721 - 71,414,658 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 64,032,878 - 64,148,722 (+) NCBI MGSCv36 mm8 Celera 7 61,596,535 - 61,712,952 (+) NCBI Celera Cytogenetic Map 7 C NCBI cM Map 7 34.61 NCBI
Trpm1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 29,814,077 - 29,939,344 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 29,846,374 - 29,880,922 (-) NCBI ChiLan1.0 ChiLan1.0
TRPM1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 19,808,237 - 19,886,134 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 24,532,668 - 24,693,365 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 9,492,500 - 9,653,644 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 28,530,878 - 28,690,947 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 28,530,878 - 28,690,947 (-) Ensembl panpan1.1 panPan2
TRPM1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 37,860,730 - 37,949,108 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 37,817,339 - 37,949,108 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 40,503,547 - 40,626,849 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 38,199,294 - 38,329,018 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 38,191,370 - 38,329,018 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 37,731,034 - 37,854,661 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 37,984,595 - 38,114,581 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 38,194,873 - 38,318,556 (+) NCBI UU_Cfam_GSD_1.0
Trpm1
TRPM1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 143,709,864 - 143,855,984 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 143,718,295 - 143,856,968 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 159,663,385 - 159,801,269 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TRPM1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 51,560,992 - 51,660,857 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 51,586,041 - 51,660,171 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 89,165,059 - 89,239,923 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Trpm1
.
Predicted Target Of
Count of predictions: 38 Count of miRNA genes: 16 Interacting mature miRNAs: 19 Transcripts: ENSRNOT00000021262, ENSRNOT00000065343 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 631569 Bp93 Blood pressure QTL 93 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 121834139 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514) 1 83547917 128547917 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
BF410273
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 117,806,492 - 117,806,661 (+) MAPPER mRatBN7.2 Rnor_6.0 1 125,071,071 - 125,071,239 NCBI Rnor6.0 Rnor_5.0 1 126,180,121 - 126,180,289 UniSTS Rnor5.0 RGSC_v3.4 1 118,671,352 - 118,671,520 UniSTS RGSC3.4 Celera 1 110,062,683 - 110,062,851 UniSTS RH 3.4 Map 1 1563.11 UniSTS Cytogenetic Map 1 q22 UniSTS
BI279791
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 117,782,705 - 117,782,862 (+) MAPPER mRatBN7.2 Rnor_6.0 1 125,047,286 - 125,047,442 NCBI Rnor6.0 Rnor_5.0 1 126,156,336 - 126,156,492 UniSTS Rnor5.0 RGSC_v3.4 1 118,647,566 - 118,647,722 UniSTS RGSC3.4 Celera 1 110,038,888 - 110,039,044 UniSTS RH 3.4 Map 2 1657.71 UniSTS Cytogenetic Map 1 q22 UniSTS
Mlsn1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 117,792,495 - 117,792,625 (+) MAPPER mRatBN7.2 Rnor_6.0 1 125,057,074 - 125,057,203 NCBI Rnor6.0 Rnor_5.0 1 126,166,124 - 126,166,253 UniSTS Rnor5.0 RGSC_v3.4 1 118,657,355 - 118,657,484 UniSTS RGSC3.4 Celera 1 110,048,677 - 110,048,806 UniSTS Cytogenetic Map 1 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
11
9
76
41
47
17
24
17
6
123
49
63
41
50
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021262 ⟹ ENSRNOP00000021262
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 117,718,896 - 117,834,605 (+) Ensembl Rnor_6.0 Ensembl 1 124,983,452 - 125,099,573 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107676 ⟹ ENSRNOP00000091126
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 117,718,896 - 117,834,605 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117805 ⟹ ENSRNOP00000089212
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 117,718,896 - 117,792,697 (+) Ensembl
RefSeq Acc Id:
NM_001037733 ⟹ NP_001032822
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 127,130,686 - 127,246,390 (+) NCBI mRatBN7.2 1 117,718,896 - 117,834,605 (+) NCBI Rnor_6.0 1 124,983,452 - 125,099,573 (+) NCBI Rnor_5.0 1 126,092,991 - 126,210,809 (+) NCBI RGSC_v3.4 1 118,583,516 - 118,700,653 (+) RGD Celera 1 109,974,992 - 110,090,741 (+) RGD
Sequence:
TCCTTCTGAGCTGACTGAGCCACCAATATCACCCCCGAACTCTGAGCCCTGCTGTCCAGCCTGGTAAAGAGAACTCTCTTGCCTCAGCCTATTGGAGACTCCCATGCAGCAGGCTGGGCCTCACAGGG
hide sequence
RefSeq Acc Id:
NM_001037734 ⟹ NP_001032823
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 127,130,686 - 127,246,390 (+) NCBI mRatBN7.2 1 117,718,896 - 117,834,605 (+) NCBI Rnor_6.0 1 124,983,452 - 125,099,573 (+) NCBI Rnor_5.0 1 126,092,991 - 126,210,809 (+) NCBI RGSC_v3.4 1 118,583,516 - 118,700,653 (+) RGD Celera 1 109,974,992 - 110,090,741 (+) RGD
Sequence:
TCCTTCTGAGCTGACTGAGCCACCAATATCACCCCCGAACTCTGAGCCCTGCTGTCCAGCCTGG
hide sequence
RefSeq Acc Id:
XM_039082296 ⟹ XP_038938224
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 127,207,891 - 127,247,219 (+) NCBI mRatBN7.2 1 117,796,103 - 117,835,434 (+) NCBI
RefSeq Acc Id:
XM_063266876 ⟹ XP_063122946
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 127,172,044 - 127,247,219 (+) NCBI
RefSeq Acc Id:
NP_001032822 ⟸ NM_001037733
- Peptide Label:
isoform 2
- UniProtKB:
Q2WEA5 (UniProtKB/Swiss-Prot), Q2WEA4 (UniProtKB/Swiss-Prot), F1M9X0 (UniProtKB/TrEMBL)
- Sequence:
MGSMRKMSSSFKRGSIKSSTSGSQKGQKAWIEKTFCKRECIFVIPSTKDPNRCCCGQLTNQHIPPLPSVTPSSTAEDTKQGDAQSGKWSVSKHTQSYPTDSYGILEFQGGGYSNKAMYIRVSYDTKPD
hide sequence
RefSeq Acc Id:
NP_001032823 ⟸ NM_001037734
- Peptide Label:
isoform 1
- UniProtKB:
Q2WEA4 (UniProtKB/Swiss-Prot), Q2WEA5 (UniProtKB/Swiss-Prot), F1M9X0 (UniProtKB/TrEMBL)
- Sequence:
MGSMRKMSSSFKRGSIKSSTSGSQKGQKAWIEKTFCKRECIFVIPSTKDPNRCCCGQLTNQHIPPLPSVTPSSTAEDTKQGDAQSGKWSVSKHTQSYPTDSYGILEFQGGGYSNKAMYIRVSYDTKPD
hide sequence
Ensembl Acc Id:
ENSRNOP00000021262 ⟸ ENSRNOT00000021262
RefSeq Acc Id:
XP_038938224 ⟸ XM_039082296
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000091126 ⟸ ENSRNOT00000107676
Ensembl Acc Id:
ENSRNOP00000089212 ⟸ ENSRNOT00000117805
RefSeq Acc Id:
XP_063122946 ⟸ XM_063266876
- Peptide Label:
isoform X1
- UniProtKB:
Q2WEA5 (UniProtKB/Swiss-Prot), Q2WEA4 (UniProtKB/Swiss-Prot), F1M9X0 (UniProtKB/Swiss-Prot)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-11-20
Trpm1
transient receptor potential cation channel, subfamily M, member 1
Symbol and Name status set to provisional
70820 PROVISIONAL
