Symbol:
Rnf216
Name:
ring finger protein 216
RGD ID:
1565135
Description:
Predicted to enable ubiquitin protein ligase activity. Involved in protein catabolic process, modulating synaptic transmission and regulation of postsynaptic neurotransmitter receptor internalization. Is active in several cellular components, including Schaffer collateral - CA1 synapse; glutamatergic synapse; and postsynaptic endocytic zone. Human ortholog(s) of this gene implicated in Gordon Holmes syndrome. Orthologous to human RNF216 (ring finger protein 216); INTERACTS WITH acrylamide; bisphenol A; cyclophosphamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
E3 ubiquitin-protein ligase RNF216; LOC304294; RGD1565135; similar to E3 ubiquitin ligase TRIAD3B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 16,568,327 - 16,689,868 (+) NCBI GRCr8 mRatBN7.2 12 11,454,752 - 11,576,305 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 11,454,797 - 11,576,304 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 12,263,009 - 12,386,275 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 12,886,286 - 13,009,554 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 11,912,387 - 12,035,725 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 13,508,429 - 13,631,689 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 13,508,429 - 13,632,304 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 15,547,724 - 15,668,304 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 11,850,549 - 11,968,127 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 13,249,412 - 13,370,214 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rnf216 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RNF216 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RNF216 mRNA CTD PMID:22079256 Rnf216 Rat (1->4)-beta-D-glucan multiple interactions ISO Rnf216 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RNF216 mRNA CTD PMID:36331819 Rnf216 Rat 1,2-dimethylhydrazine decreases expression ISO Rnf216 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of RNF216 mRNA CTD PMID:22206623 Rnf216 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Rnf216 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Rnf216 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Rnf216 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of RNF216 mRNA CTD PMID:19465110 Rnf216 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rnf216 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RNF216 mRNA CTD PMID:21570461 Rnf216 Rat 4,4'-sulfonyldiphenol decreases expression ISO Rnf216 (Mus musculus) 6480464 bisphenol S results in decreased expression of RNF216 mRNA CTD PMID:39298647 Rnf216 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RNF216 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of RNF216 gene CTD PMID:31601247 Rnf216 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of RNF216 mRNA CTD PMID:28959563 Rnf216 Rat arsane affects expression ISO RNF216 (Homo sapiens) 6480464 Arsenic affects the expression of RNF216 mRNA CTD PMID:18414638 Rnf216 Rat arsane affects methylation ISO RNF216 (Homo sapiens) 6480464 Arsenic affects the methylation of RNF216 gene CTD PMID:25304211 Rnf216 Rat arsenic atom affects expression ISO RNF216 (Homo sapiens) 6480464 Arsenic affects the expression of RNF216 mRNA CTD PMID:18414638 Rnf216 Rat arsenic atom affects methylation ISO RNF216 (Homo sapiens) 6480464 Arsenic affects the methylation of RNF216 gene CTD PMID:25304211 Rnf216 Rat atrazine decreases expression ISO RNF216 (Homo sapiens) 6480464 Atrazine results in decreased expression of RNF216 mRNA CTD PMID:22378314 Rnf216 Rat benzo[a]pyrene decreases expression ISO Rnf216 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of RNF216 mRNA CTD PMID:22228805 Rnf216 Rat benzo[a]pyrene increases methylation ISO RNF216 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of RNF216 5' UTR and Benzo(a)pyrene results in increased methylation of RNF216 promoter CTD PMID:27901495 Rnf216 Rat benzo[a]pyrene multiple interactions ISO Rnf216 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of RNF216 mRNA] CTD PMID:22228805 Rnf216 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Rnf216 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of RNF216 mRNA CTD PMID:21318169 Rnf216 Rat bisphenol A increases expression ISO Rnf216 (Mus musculus) 6480464 bisphenol A results in increased expression of RNF216 mRNA CTD PMID:26063408 Rnf216 Rat bisphenol A increases methylation ISO Rnf216 (Mus musculus) 6480464 bisphenol A results in increased methylation of RNF216 promoter CTD PMID:27312807 Rnf216 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RNF216 mRNA CTD PMID:25181051 Rnf216 Rat butanal increases expression ISO RNF216 (Homo sapiens) 6480464 butyraldehyde results in increased expression of RNF216 mRNA CTD PMID:26079696 Rnf216 Rat cadmium dichloride decreases expression ISO Rnf216 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of RNF216 mRNA CTD PMID:34666113 Rnf216 Rat CGP 52608 multiple interactions ISO RNF216 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to RNF216 gene] CTD PMID:28238834 Rnf216 Rat chromium(6+) multiple interactions ISO RNF216 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of RNF216 mRNA CTD PMID:38479592 Rnf216 Rat cyclophosphamide decreases expression EXP 6480464 Cyclophosphamide results in decreased expression of RNF216 mRNA CTD PMID:27281708 Rnf216 Rat dioxygen increases expression ISO Rnf216 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of RNF216 mRNA CTD PMID:24205000 Rnf216 Rat doxorubicin decreases expression ISO RNF216 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of RNF216 mRNA CTD PMID:29803840 Rnf216 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of RNF216 mRNA CTD PMID:23962444 Rnf216 Rat fulvestrant multiple interactions ISO RNF216 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of RNF216 gene CTD PMID:31601247 Rnf216 Rat levonorgestrel multiple interactions ISO RNF216 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in increased expression of RNF216 mRNA CTD PMID:19074003 Rnf216 Rat perfluorohexanesulfonic acid decreases expression ISO Rnf216 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of RNF216 mRNA CTD PMID:37995155 Rnf216 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Rnf216 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RNF216 mRNA CTD PMID:36331819 Rnf216 Rat pinostrobin increases expression ISO RNF216 (Homo sapiens) 6480464 pinostrobin results in increased expression of RNF216 mRNA CTD PMID:37777166 Rnf216 Rat pirinixic acid multiple interactions ISO Rnf216 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of RNF216 mRNA CTD PMID:19710929 Rnf216 Rat potassium chromate decreases expression ISO RNF216 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of RNF216 mRNA CTD PMID:22079256 Rnf216 Rat potassium chromate multiple interactions ISO RNF216 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RNF216 mRNA CTD PMID:22079256 Rnf216 Rat silver atom decreases expression ISO Rnf216 (Mus musculus) 6480464 Silver results in decreased expression of RNF216 mRNA CTD PMID:27131904 Rnf216 Rat silver(0) decreases expression ISO Rnf216 (Mus musculus) 6480464 Silver results in decreased expression of RNF216 mRNA CTD PMID:27131904 Rnf216 Rat sodium arsenite increases expression ISO RNF216 (Homo sapiens) 6480464 sodium arsenite results in increased expression of RNF216 mRNA CTD PMID:38568856 Rnf216 Rat sunitinib increases expression ISO RNF216 (Homo sapiens) 6480464 Sunitinib results in increased expression of RNF216 mRNA CTD PMID:31533062 Rnf216 Rat temozolomide increases expression ISO RNF216 (Homo sapiens) 6480464 Temozolomide results in increased expression of RNF216 mRNA CTD PMID:31758290 Rnf216 Rat testosterone undecanoate increases expression ISO RNF216 (Homo sapiens) 6480464 testosterone undecanoate results in increased expression of RNF216 mRNA CTD PMID:19074003 Rnf216 Rat testosterone undecanoate multiple interactions ISO RNF216 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in increased expression of RNF216 mRNA CTD PMID:19074003 Rnf216 Rat titanium dioxide decreases methylation ISO Rnf216 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of RNF216 gene CTD PMID:35295148 Rnf216 Rat triphenyl phosphate affects expression ISO RNF216 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RNF216 mRNA CTD PMID:37042841 Rnf216 Rat troglitazone decreases expression ISO Rnf216 (Mus musculus) 6480464 troglitazone results in decreased expression of RNF216 mRNA CTD PMID:28973697 Rnf216 Rat tungsten decreases expression ISO Rnf216 (Mus musculus) 6480464 Tungsten results in decreased expression of RNF216 mRNA CTD PMID:30912803 Rnf216 Rat vinclozolin increases expression ISO Rnf216 (Mus musculus) 6480464 vinclozolin results in increased expression of RNF216 mRNA CTD PMID:18940246 Rnf216 Rat zinc atom multiple interactions ISO RNF216 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of RNF216 mRNA CTD PMID:18593933 Rnf216 Rat zinc(0) multiple interactions ISO RNF216 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of RNF216 mRNA CTD PMID:18593933
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 4,4'-sulfonyldiphenol (ISO) acrylamide (EXP) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butanal (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) chromium(6+) (ISO) cyclophosphamide (EXP) dioxygen (ISO) doxorubicin (ISO) fipronil (EXP) fulvestrant (ISO) levonorgestrel (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) pinostrobin (ISO) pirinixic acid (ISO) potassium chromate (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sunitinib (ISO) temozolomide (ISO) testosterone undecanoate (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) troglitazone (ISO) tungsten (ISO) vinclozolin (ISO) zinc atom (ISO) zinc(0) (ISO)
Rnf216 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 16,568,327 - 16,689,868 (+) NCBI GRCr8 mRatBN7.2 12 11,454,752 - 11,576,305 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 11,454,797 - 11,576,304 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 12,263,009 - 12,386,275 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 12,886,286 - 13,009,554 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 11,912,387 - 12,035,725 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 13,508,429 - 13,631,689 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 13,508,429 - 13,632,304 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 15,547,724 - 15,668,304 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 11,850,549 - 11,968,127 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 13,249,412 - 13,370,214 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
RNF216 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 5,620,047 - 5,781,663 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 5,620,047 - 5,781,696 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 5,659,678 - 5,821,294 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 5,626,204 - 5,787,818 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 7 5,619,295 - 5,780,893 (-) NCBI Celera Cytogenetic Map 7 p22.1 NCBI HuRef 7 5,571,731 - 5,733,450 (-) NCBI HuRef CHM1_1 7 5,659,283 - 5,820,961 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 5,737,579 - 5,899,098 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 5,706,017 - 5,867,706 (-) NCBI
Rnf216 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 142,976,648 - 143,098,793 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 142,976,648 - 143,098,749 (-) Ensembl GRCm39 Ensembl GRCm38 5 142,990,893 - 143,113,041 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 142,990,893 - 143,112,994 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 143,752,572 - 143,874,673 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 143,256,033 - 143,378,134 (-) NCBI MGSCv36 mm8 Celera 5 140,039,423 - 140,158,416 (-) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 81.86 NCBI
Rnf216 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955460 10,425,885 - 10,551,295 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955460 10,423,736 - 10,578,421 (-) NCBI ChiLan1.0 ChiLan1.0
RNF216 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 10,579,755 - 10,746,674 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 58,904,460 - 59,071,382 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 5,872,118 - 6,037,073 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 5,891,909 - 6,051,979 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 5,891,909 - 6,051,979 (-) Ensembl panpan1.1 panPan2
RNF216 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 12,185,870 - 12,347,461 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 12,185,846 - 12,361,869 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 13,690,975 - 13,819,412 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 12,279,451 - 12,440,387 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 12,279,466 - 12,483,247 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 12,133,461 - 12,294,697 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 12,067,337 - 12,228,144 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 12,343,974 - 12,505,522 (+) NCBI UU_Cfam_GSD_1.0
Rnf216
RNF216 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 4,158,450 - 4,329,378 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 4,158,447 - 4,329,458 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 4,800,772 - 4,820,346 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RNF216 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 15,955,499 - 16,114,307 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 15,954,803 - 16,117,759 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666090 5,879,677 - 6,041,644 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rnf216
.
Predicted Target Of
Count of predictions: 287 Count of miRNA genes: 169 Interacting mature miRNAs: 205 Transcripts: ENSRNOT00000001458 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 1331739 Hrtrt14 Heart rate QTL 14 3.56232 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 12 9318216 12829686 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1600391 Edcs2 Endometrial carcinoma susceptibility QTL2 3.5 0.01 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 12 6833190 17870186 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat
BE117877
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,504,190 - 11,504,383 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,557,812 - 13,558,004 NCBI Rnor6.0 Rnor_5.0 12 15,596,773 - 15,596,965 UniSTS Rnor5.0 RGSC_v3.4 12 11,903,466 - 11,903,658 UniSTS RGSC3.4 Celera 12 13,298,552 - 13,298,744 UniSTS RH 3.4 Map 12 154.3 UniSTS Cytogenetic Map 12 p11 UniSTS
RH128286
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,575,887 - 11,576,068 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,631,273 - 13,631,453 NCBI Rnor6.0 Rnor_5.0 12 15,667,888 - 15,668,068 UniSTS Rnor5.0 Celera 12 13,369,798 - 13,369,978 UniSTS RH 3.4 Map 12 156.3 UniSTS Cytogenetic Map 12 p11 UniSTS
RH137434
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,550,021 - 11,550,219 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,605,249 - 13,605,446 NCBI Rnor6.0 Rnor_5.0 12 15,641,864 - 15,642,061 UniSTS Rnor5.0 RGSC_v3.4 12 11,949,352 - 11,949,549 UniSTS RGSC3.4 Celera 12 13,343,917 - 13,344,114 UniSTS Cytogenetic Map 12 p11 UniSTS
RH137509
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,470,103 - 11,470,644 (+) MAPPER mRatBN7.2 mRatBN7.2 12 34,761,961 - 34,762,178 (+) MAPPER mRatBN7.2 Rnor_6.0 12 40,274,101 - 40,274,317 NCBI Rnor6.0 Rnor_6.0 12 13,523,743 - 13,524,283 NCBI Rnor6.0 Rnor_5.0 12 42,145,058 - 42,145,274 UniSTS Rnor5.0 Rnor_5.0 12 15,562,742 - 15,563,282 UniSTS Rnor5.0 RGSC_v3.4 12 35,966,790 - 35,967,006 UniSTS RGSC3.4 RGSC_v3.4 12 11,865,825 - 11,866,365 UniSTS RGSC3.4 Celera 12 13,264,657 - 13,265,197 UniSTS Celera 12 36,426,782 - 36,426,998 UniSTS RH 3.4 Map 12 616.2 UniSTS Cytogenetic Map 12 q16 UniSTS Cytogenetic Map 12 p11 UniSTS
RH140401
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 11,459,101 - 11,459,318 (+) MAPPER mRatBN7.2 Rnor_6.0 12 13,512,742 - 13,512,958 NCBI Rnor6.0 Rnor_5.0 12 15,551,741 - 15,551,957 UniSTS Rnor5.0 RGSC_v3.4 12 11,854,823 - 11,855,039 UniSTS RGSC3.4 Celera 12 13,253,666 - 13,253,882 UniSTS RH 3.4 Map 12 154.5 UniSTS Cytogenetic Map 12 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001458 ⟹ ENSRNOP00000001458
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 11,454,797 - 11,576,304 (+) Ensembl Rnor_6.0 Ensembl 12 13,508,429 - 13,631,689 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000083976 ⟹ ENSRNOP00000074315
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 12 13,508,933 - 13,632,304 (+) Ensembl
RefSeq Acc Id:
NM_001107122 ⟹ NP_001100592
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 16,568,373 - 16,689,867 (+) NCBI mRatBN7.2 12 11,454,797 - 11,576,304 (+) NCBI Rnor_6.0 12 13,508,429 - 13,631,689 (+) NCBI Rnor_5.0 12 15,547,724 - 15,668,304 (+) NCBI RGSC_v3.4 12 11,850,549 - 11,968,127 (+) RGD Celera 12 13,249,412 - 13,370,214 (+) RGD
Sequence:
CGCAGTAGCGGCCTCGGCGGCAGCGGCGGCGGCGACGACAGCATTGGCAGTGGCGGCTGTAGCAGCGGGGAAGCTTTTCGAGCGGATGCTTCAGAACAGATGATCACCATGTCTGGGTTCTAGCAATC
hide sequence
RefSeq Acc Id:
XM_039089363 ⟹ XP_038945291
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 16,568,391 - 16,689,868 (+) NCBI mRatBN7.2 12 11,454,816 - 11,576,305 (+) NCBI
RefSeq Acc Id:
XM_039089364 ⟹ XP_038945292
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 16,568,327 - 16,689,868 (+) NCBI mRatBN7.2 12 11,454,752 - 11,576,305 (+) NCBI
RefSeq Acc Id:
XM_039089366 ⟹ XP_038945294
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 16,568,887 - 16,689,868 (+) NCBI mRatBN7.2 12 11,455,312 - 11,576,305 (+) NCBI
RefSeq Acc Id:
XM_039089367 ⟹ XP_038945295
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 16,568,391 - 16,689,868 (+) NCBI mRatBN7.2 12 11,454,816 - 11,576,305 (+) NCBI
RefSeq Acc Id:
XM_063271261 ⟹ XP_063127331
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 16,568,327 - 16,689,868 (+) NCBI
RefSeq Acc Id:
XM_063271262 ⟹ XP_063127332
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 16,568,887 - 16,689,868 (+) NCBI
RefSeq Acc Id:
NP_001100592 ⟸ NM_001107122
- UniProtKB:
D3ZU60 (UniProtKB/TrEMBL), A6K1N1 (UniProtKB/TrEMBL)
- Sequence:
MAEGNNQEEVIHLNNFHCHRGKEWMAVREGPITISDSSDEEGIPMLVTPATEQQEDDLDDDVILTETHKPQTSRPNLIKPAAEWQDLNRLGEERPRKSRADFEADTHSYFSFCNNSLFDSGAQDDSED
hide sequence
Ensembl Acc Id:
ENSRNOP00000074315 ⟸ ENSRNOT00000083976
Ensembl Acc Id:
ENSRNOP00000001458 ⟸ ENSRNOT00000001458
RefSeq Acc Id:
XP_038945292 ⟸ XM_039089364
- Peptide Label:
isoform X1
- UniProtKB:
D3ZU60 (UniProtKB/TrEMBL), A6K1N1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945291 ⟸ XM_039089363
- Peptide Label:
isoform X1
- UniProtKB:
D3ZU60 (UniProtKB/TrEMBL), A6K1N1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945295 ⟸ XM_039089367
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038945294 ⟸ XM_039089366
- Peptide Label:
isoform X1
- UniProtKB:
D3ZU60 (UniProtKB/TrEMBL), A6K1N1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063127331 ⟸ XM_063271261
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063127332 ⟸ XM_063271262
- Peptide Label:
isoform X2
RGD ID: 13698444 Promoter ID: EPDNEW_R8969 Type: initiation region Name: Rnf216_1 Description: ring finger protein 216 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 13,508,432 - 13,508,492 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-06
Rnf216
ring finger protein 216
RGD1565135_predicted
similar to E3 ubiquitin ligase TRIAD3B (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1565135_predicted
similar to E3 ubiquitin ligase TRIAD3B (predicted)
LOC304294
similar to E3 ubiquitin ligase TRIAD3B
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC304294
similar to E3 ubiquitin ligase TRIAD3B
Symbol and Name status set to provisional
70820 PROVISIONAL
