Advanced Search (OLGA)

Gene: Ascc2 (activating signal cointegrator 1 complex subunit 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ascc2

Name:

activating signal cointegrator 1 complex subunit 2

RGD ID:

1561422

Description:

Predicted to enable K63-linked polyubiquitin modification-dependent protein binding activity and ubiquitin binding activity. Predicted to be involved in regulation of DNA-templated transcription; rescue of stalled ribosome; and ribosome-associated ubiquitin-dependent protein catabolic process. Predicted to be located in nucleus. Predicted to be part of DNA repair complex and RQC-trigger complex. Predicted to be active in cytosolic ribosome. Orthologous to human ASCC2 (activating signal cointegrator 1 complex subunit 2); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC498402; RGD1561422; similar to ASC-1 complex subunit P100

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	83,726,975 - 83,771,312 (+)	NCBI		GRCr8
mRatBN7.2	14	79,503,449 - 79,547,801 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	79,503,517 - 79,545,494 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	83,934,172 - 83,976,128 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	85,174,233 - 85,216,197 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	81,623,865 - 81,665,862 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	84,873,507 - 84,913,923 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	84,876,781 - 84,913,617 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	85,550,450 - 85,592,750 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	85,277,839 - 85,320,029 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	14	78,409,997 - 78,452,215 (+)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ascc2	Rat	Breast Cancer, Familial		ISO	ASCC2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial cancer of breast	ClinVar	PMID:21876083 more ...
Ascc2	Rat	vestibular schwannomatosis		ISO	ASCC2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurofibromatosis and type 2	ClinVar	PMID:10220142 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ascc2	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ASCC2 mRNA]	CTD	PMID:31150632
Ascc2	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Ascc2 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of ASCC2 mRNA]	CTD	PMID:22206623
Ascc2	Rat	1,2-dimethylhydrazine	increases expression	ISO	Ascc2 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of ASCC2 mRNA	CTD	PMID:22206623
Ascc2	Rat	17alpha-ethynylestradiol	affects expression	ISO	Ascc2 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of ASCC2 mRNA	CTD	PMID:17555576
Ascc2	Rat	17alpha-ethynylestradiol	increases expression	ISO	Ascc2 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of ASCC2 mRNA	CTD	PMID:17942748
Ascc2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ascc2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of ASCC2 mRNA	CTD	PMID:21570461
Ascc2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of ASCC2 mRNA	CTD	PMID:33387578
Ascc2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	ASCC2 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin affects the expression of ASCC2 mRNA	CTD	PMID:22574217
Ascc2	Rat	3,3',5,5'-tetrabromobisphenol A	increases expression	ISO	Ascc2 (Mus musculus)	6480464	tetrabromobisphenol A results in increased expression of ASCC2 mRNA	CTD	PMID:25172293
Ascc2	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	Ascc2 (Mus musculus)	6480464	bisphenol S results in increased methylation of ASCC2 exon	CTD	PMID:33297965
Ascc2	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	Ascc2 (Mus musculus)	6480464	Fenretinide results in decreased expression of ASCC2 mRNA	CTD	PMID:28973697
Ascc2	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of ASCC2 mRNA	CTD	PMID:24780913
Ascc2	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of ASCC2 mRNA	CTD	PMID:28959563
Ascc2	Rat	aristolochic acid A	increases expression	ISO	ASCC2 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of ASCC2 mRNA	CTD	PMID:33212167
Ascc2	Rat	arsane	multiple interactions	ISO	ASCC2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ASCC2 mRNA	CTD	PMID:39836092
Ascc2	Rat	arsenic atom	multiple interactions	ISO	ASCC2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ASCC2 mRNA	CTD	PMID:39836092
Ascc2	Rat	atrazine	decreases expression	ISO	ASCC2 (Homo sapiens)	6480464	Atrazine results in decreased expression of ASCC2 mRNA	CTD	PMID:22378314
Ascc2	Rat	benzo[a]pyrene	decreases expression	ISO	Ascc2 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of ASCC2 mRNA	CTD	PMID:22228805
Ascc2	Rat	benzo[a]pyrene	increases methylation	ISO	Ascc2 (Mus musculus)	6480464	Benzo(a)pyrene results in increased methylation of ASCC2 3' UTR more ...	CTD	PMID:27901495
Ascc2	Rat	benzo[a]pyrene	decreases methylation	ISO	ASCC2 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of ASCC2 5' UTR and Benzo(a)pyrene results in decreased methylation of ASCC2 promoter	CTD	PMID:27901495
Ascc2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of ASCC2 mRNA	CTD	PMID:25181051 and PMID:32145629
Ascc2	Rat	bisphenol A	multiple interactions	ISO	ASCC2 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of ASCC2 gene	CTD	PMID:31601247
Ascc2	Rat	bisphenol A	decreases methylation	ISO	ASCC2 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of ASCC2 gene	CTD	PMID:31601247
Ascc2	Rat	bisphenol A	increases expression	ISO	ASCC2 (Homo sapiens)	6480464	bisphenol A results in increased expression of ASCC2 protein	CTD	PMID:33376534
Ascc2	Rat	CGP 52608	multiple interactions	ISO	ASCC2 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to ASCC2 gene]	CTD	PMID:28238834
Ascc2	Rat	chlordecone	decreases expression	ISO	Ascc2 (Mus musculus)	6480464	Chlordecone results in decreased expression of ASCC2 mRNA	CTD	PMID:33711761
Ascc2	Rat	chlorpyrifos	decreases expression	ISO	Ascc2 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of ASCC2 mRNA	CTD	PMID:37019170
Ascc2	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of ASCC2 mRNA	CTD	PMID:27523638
Ascc2	Rat	cyclosporin A	increases expression	ISO	ASCC2 (Homo sapiens)	6480464	Cyclosporine results in increased expression of ASCC2 mRNA	CTD	PMID:25562108
Ascc2	Rat	Dibutyl phosphate	affects expression	ISO	ASCC2 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of ASCC2 mRNA	CTD	PMID:37042841
Ascc2	Rat	dicrotophos	increases expression	ISO	ASCC2 (Homo sapiens)	6480464	dicrotophos results in increased expression of ASCC2 mRNA	CTD	PMID:28302478
Ascc2	Rat	doxorubicin	decreases expression	ISO	ASCC2 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of ASCC2 mRNA	CTD	PMID:29803840
Ascc2	Rat	elemental selenium	increases expression	ISO	ASCC2 (Homo sapiens)	6480464	Selenium results in increased expression of ASCC2 mRNA	CTD	PMID:19244175
Ascc2	Rat	folic acid	multiple interactions	ISO	Ascc2 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of ASCC2 mRNA]	CTD	PMID:22206623
Ascc2	Rat	folic acid	increases expression	ISO	Ascc2 (Mus musculus)	6480464	Folic Acid results in increased expression of ASCC2 mRNA	CTD	PMID:25629700
Ascc2	Rat	fulvestrant	multiple interactions	ISO	ASCC2 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of ASCC2 gene	CTD	PMID:31601247
Ascc2	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of ASCC2 mRNA	CTD	PMID:33387578
Ascc2	Rat	glycidol	decreases expression	EXP		6480464	glycidol results in decreased expression of ASCC2 mRNA	CTD	PMID:24915197
Ascc2	Rat	ivermectin	decreases expression	ISO	ASCC2 (Homo sapiens)	6480464	Ivermectin results in decreased expression of ASCC2 protein	CTD	PMID:32959892
Ascc2	Rat	lead(0)	affects expression	ISO	ASCC2 (Homo sapiens)	6480464	Lead affects the expression of ASCC2 mRNA	CTD	PMID:28903495
Ascc2	Rat	leflunomide	increases expression	ISO	ASCC2 (Homo sapiens)	6480464	leflunomide results in increased expression of ASCC2 mRNA	CTD	PMID:28988120
Ascc2	Rat	methidathion	increases expression	ISO	Ascc2 (Mus musculus)	6480464	methidathion results in increased expression of ASCC2 mRNA	CTD	PMID:34813904
Ascc2	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of ASCC2 gene	CTD	PMID:35440735
Ascc2	Rat	methyl methanesulfonate	increases expression	ISO	ASCC2 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of ASCC2 mRNA	CTD	PMID:23649840
Ascc2	Rat	paracetamol	affects expression	ISO	Ascc2 (Mus musculus)	6480464	Acetaminophen affects the expression of ASCC2 mRNA	CTD	PMID:17562736
Ascc2	Rat	selenium atom	increases expression	ISO	ASCC2 (Homo sapiens)	6480464	Selenium results in increased expression of ASCC2 mRNA	CTD	PMID:19244175
Ascc2	Rat	sodium arsenite	increases expression	ISO	ASCC2 (Homo sapiens)	6480464	sodium arsenite results in increased expression of ASCC2 mRNA	CTD	PMID:38568856
Ascc2	Rat	sodium arsenite	decreases expression	ISO	ASCC2 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of ASCC2 protein	CTD	PMID:30528433
Ascc2	Rat	sodium arsenite	multiple interactions	ISO	ASCC2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ASCC2 mRNA	CTD	PMID:39836092
Ascc2	Rat	Soman	increases expression	EXP		6480464	Soman results in increased expression of ASCC2 mRNA	CTD	PMID:19281266
Ascc2	Rat	tamoxifen	affects expression	ISO	Ascc2 (Mus musculus)	6480464	Tamoxifen affects the expression of ASCC2 mRNA	CTD	PMID:17555576
Ascc2	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of ASCC2 mRNA	CTD	PMID:31150632
Ascc2	Rat	tetrachloromethane	increases expression	ISO	Ascc2 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of ASCC2 mRNA	CTD	PMID:31919559
Ascc2	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ASCC2 mRNA]	CTD	PMID:31150632
Ascc2	Rat	titanium dioxide	increases methylation	ISO	Ascc2 (Mus musculus)	6480464	titanium dioxide results in increased methylation of ASCC2 gene and titanium dioxide results in increased methylation of ASCC2 promoter alternative form	CTD	PMID:35295148
Ascc2	Rat	trimellitic anhydride	increases expression	ISO	Ascc2 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of ASCC2 mRNA	CTD	PMID:19042947
Ascc2	Rat	triphenyl phosphate	affects expression	ISO	ASCC2 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of ASCC2 mRNA	CTD	PMID:37042841
Ascc2	Rat	triptonide	decreases expression	ISO	Ascc2 (Mus musculus)	6480464	triptonide results in decreased expression of ASCC2 mRNA	CTD	PMID:33045310
Ascc2	Rat	tunicamycin	increases expression	ISO	Ascc2 (Mus musculus)	6480464	Tunicamycin results in increased expression of ASCC2 mRNA	CTD	PMID:17127020
Ascc2	Rat	valproic acid	affects expression	ISO	Ascc2 (Mus musculus)	6480464	Valproic Acid affects the expression of ASCC2 mRNA	CTD	PMID:17292431
Ascc2	Rat	valproic acid	increases expression	ISO	ASCC2 (Homo sapiens)	6480464	Valproic Acid results in increased expression of ASCC2 mRNA	CTD	PMID:23179753 and PMID:29154799
Ascc2	Rat	valproic acid	affects expression	ISO	ASCC2 (Homo sapiens)	6480464	Valproic Acid affects the expression of ASCC2 mRNA	CTD	PMID:25979313

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ascc2	Rat	regulation of DNA-templated transcription	involved_in	ISO	ASCC2 (Homo sapiens)	1624291	PMID:12077347	RGD	PMID:12077347
Ascc2	Rat	regulation of DNA-templated transcription	involved_in	IEA	UniProtKB:Q9H1I8 and ensembl:ENSP00000305502	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ascc2	Rat	regulation of DNA-templated transcription	involved_in	IBA	PANTHER:PTN001088105 and UniProtKB:Q9H1I8	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ascc2	Rat	rescue of stalled ribosome	involved_in	ISO	ASCC2 (Homo sapiens)	1624291	PMID:32099016 more ...	RGD	PMID:32099016 more ...
Ascc2	Rat	rescue of stalled ribosome	involved_in	IEA	UniProtKB:Q9H1I8 and ensembl:ENSP00000305502	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ascc2	Rat	ribosome disassembly	involved_in	ISO	ASCC2 (Homo sapiens)	1624291	PMID:32579943 and PMID:36302773	RGD	PMID:32579943 and PMID:36302773
Ascc2	Rat	ribosome disassembly	involved_in	IEA	UniProtKB:Q9H1I8 and ensembl:ENSP00000305502	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ascc2	Rat	ribosome-associated ubiquitin-dependent protein catabolic process	involved_in	ISO	ASCC2 (Homo sapiens)	1624291	PMID:32099016	RGD	PMID:32099016
Ascc2	Rat	ribosome-associated ubiquitin-dependent protein catabolic process	involved_in	IEA	UniProtKB:Q9H1I8 and ensembl:ENSP00000305502	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ascc2	Rat	cytosolic ribosome	is_active_in	ISO	ASCC2 (Homo sapiens)	1624291	PMID:36302773	RGD	PMID:36302773
Ascc2	Rat	cytosolic ribosome	is_active_in	IEA	UniProtKB:Q9H1I8 and ensembl:ENSP00000305502	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ascc2	Rat	DNA repair complex	part_of	ISO	ASCC2 (Homo sapiens)	1624291	PMID:29997253	RGD	PMID:29997253
Ascc2	Rat	DNA repair complex	part_of	IEA	UniProtKB:Q9H1I8 and ensembl:ENSP00000305502	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ascc2	Rat	nucleus	located_in	IEA	UniProtKB:Q9H1I8 and ensembl:ENSP00000305502	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ascc2	Rat	nucleus	located_in	ISO	ASCC2 (Homo sapiens)	1624291	PMID:12077347 more ...	RGD	PMID:12077347 more ...
Ascc2	Rat	RQC-trigger complex	part_of	IEA	UniProtKB:Q9H1I8 and ensembl:ENSP00000305502	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ascc2	Rat	RQC-trigger complex	part_of	ISO	ASCC2 (Homo sapiens)	1624291	PMID:12077347	RGD	PMID:12077347

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ascc2	Rat	K63-linked polyubiquitin modification-dependent protein binding	enables	IEA	UniProtKB:Q9H1I8 and ensembl:ENSP00000305502	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ascc2	Rat	K63-linked polyubiquitin modification-dependent protein binding	enables	ISO	ASCC2 (Homo sapiens)	1624291	PMID:36302773	RGD	PMID:36302773
Ascc2	Rat	protein binding	enables	ISO	ASCC2 (Homo sapiens)	1624291	UniProtKB:Q8N3C0 more ...	RGD	PMID:28514442 more ...
Ascc2	Rat	ubiquitin binding	enables	IBA	PANTHER:PTN000486646 and SGD:S000003078	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ascc2	Rat	ubiquitin binding	enables	IEA	InterPro:IPR003892	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12077347	PMID:26924529

Ascc2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	83,726,975 - 83,771,312 (+)	NCBI		GRCr8
mRatBN7.2	14	79,503,449 - 79,547,801 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	79,503,517 - 79,545,494 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	83,934,172 - 83,976,128 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	85,174,233 - 85,216,197 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	81,623,865 - 81,665,862 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	84,873,507 - 84,913,923 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	84,876,781 - 84,913,617 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	85,550,450 - 85,592,750 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	85,277,839 - 85,320,029 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	14	78,409,997 - 78,452,215 (+)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

ASCC2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	29,788,611 - 29,838,274 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	29,788,609 - 29,838,304 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	30,184,600 - 30,234,263 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	28,514,600 - 28,564,254 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	28,509,155 - 28,558,808	NCBI
Celera	22	13,984,318 - 14,033,974 (-)	NCBI		Celera
Cytogenetic Map	22	q12.2	NCBI
HuRef	22	13,146,838 - 13,196,327 (-)	NCBI		HuRef
CHM1_1	22	30,143,775 - 30,193,418 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	22	30,251,982 - 30,301,644 (-)	NCBI		T2T-CHM13v2.0

Ascc2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	4,587,698 - 4,635,699 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	4,587,747 - 4,635,699 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	4,637,696 - 4,685,699 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	4,637,747 - 4,685,699 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	4,537,796 - 4,583,388 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	4,537,796 - 4,583,388 (+)	NCBI		MGSCv36	mm8
Celera	11	5,138,813 - 5,181,677 (+)	NCBI		Celera
Cytogenetic Map	11	A1	NCBI
cM Map	11	2.94	NCBI

Ascc2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	4,032,194 - 4,077,953 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955455	4,032,357 - 4,077,900 (-)	NCBI	ChiLan1.0	ChiLan1.0

ASCC2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	39,760,257 - 39,810,219 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	42,461,579 - 42,511,511 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	10,832,102 - 10,881,987 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	28,637,041 - 28,686,019 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	28,637,041 - 28,686,003 (-)	Ensembl	panpan1.1		panPan2

ASCC2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	22,967,880 - 23,009,600 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	22,970,222 - 23,004,731 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	22,838,835 - 22,880,563 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	23,341,402 - 23,383,094 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	23,341,404 - 23,383,009 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	23,051,584 - 23,093,413 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	23,314,145 - 23,355,874 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	23,373,924 - 23,415,658 (-)	NCBI		UU_Cfam_GSD_1.0

Ascc2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	112,118,251 - 112,161,111 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936657	3,707,721 - 3,752,499 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936657	3,709,578 - 3,752,377 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ASCC2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	46,797,317 - 46,842,459 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	46,797,307 - 46,842,479 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	49,832,165 - 49,879,613 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ASCC2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	12,673,642 - 12,725,268 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	12,673,064 - 12,725,233 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	113,421,058 - 113,472,673 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ascc2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	6,105,753 - 6,149,987 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	6,103,219 - 6,150,011 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ascc2
229 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	61
Count of miRNA genes:	54
Interacting mature miRNAs:	58
Transcripts:	ENSRNOT00000065188
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313089	Bss81	Bone structure and strength QTL 81	3.4	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	14	37669719	82669719	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	55624247	100624247	Rat
1582236	Gluco22	Glucose level QTL 22	3.3	0.0164	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	92554092	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	55147478	100147478	Rat
70153	Bp59	Blood pressure QTL 59	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	14	68757796	83368335	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30320092	80829842	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	40793460	98037301	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	70053989	104886043	Rat
1582197	Gluco27	Glucose level QTL 27	3.4	0.0006	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	73415323	92554092	Rat
2313100	Bss82	Bone structure and strength QTL 82	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	14	37669719	82669719	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	58184885	103184885	Rat
1582250	Gluco26	Glucose level QTL 26	3.3	0.0009	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	95876975	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	56631369	101631369	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	70053989	104886043	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
1582255	Gluco29	Glucose level QTL 29	3.1	0.0025	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	14	73415323	92554092	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	55624247	100624247	Rat
1582209	Gluco20	Glucose level QTL 20	3.8	0.0005	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	92554092	Rat
2313048	Bss84	Bone structure and strength QTL 84	3.1	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	14	37669719	82669719	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42262529	95023211	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	50023211	95023211	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39057237	83368335	Rat
2313084	Bss83	Bone structure and strength QTL 83	2.9	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	14	37669719	82669719	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001109091	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092295	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092296	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063273478	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000065188 ⟹ ENSRNOP00000060720

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	79,503,536 - 79,545,494 (+)	Ensembl
Rnor_6.0 Ensembl	14	84,876,781 - 84,913,617 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109658 ⟹ ENSRNOP00000090694

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	79,503,536 - 79,545,494 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115226 ⟹ ENSRNOP00000077053

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	79,503,536 - 79,545,494 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117747 ⟹ ENSRNOP00000083909

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	79,503,517 - 79,545,494 (+)	Ensembl

RefSeq Acc Id:

NM_001109091 ⟹ NP_001102561

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	83,727,057 - 83,769,005 (+)	NCBI
mRatBN7.2	14	79,503,536 - 79,545,494 (+)	NCBI
Rnor_6.0	14	84,873,507 - 84,913,923 (+)	NCBI
Rnor_5.0	14	85,550,450 - 85,592,750 (+)	NCBI
RGSC_v3.4	14	85,277,839 - 85,320,029 (+)	RGD
Celera	14	78,409,997 - 78,452,215 (+)	RGD

Sequence:

show sequence

GGAAGCTGTCGCGGTGAATTGCGGCTGAACATCACGGGTGTGGAGCCGGGGAGGAGGGTCACGCAGCACAATGCCAGCTCTGCCCCTGGACCAACTCCAGATCACCCACAAAGACCCGAAGACAGGCA
AGCTGAGGACTTCAGCAGCGCTGCACCCTGAGCAGAAGGCAGACCGGTATTTTGTGTTGTACAAACCACCCCCTAAAGACAACATTCCTGCCCTGGTGGAGGAGTACCTGGAGCGTGCCAACTTCGTA
GCCAATGACCTCGACTGGCTCCTGGCCTTGCCTCACGATAAATTCTGGTGCCAGGTCATCTTTGATGAGAGCCTGCAGAAGTGCCTGGACTCCTACCTGCACTATGTGCCCCGAAAATTTGATGAGTG
GGTGGCCCCAACCCCTGAGGTTGCTGACATGCAGAAGCACCTGCACCGAAGTGTTTTCCTCACCTTCCTTCGAATGTCCACTCACAAGGAATCCAAAGACCACTTCATTTCTCCATCCGCATTTGGAG
AAATCCTCTACAATAACTTCCTCTTTGACATCCCAAAGATCCTGGACCTCTGTGTGCTCTTTGGGAAAGGCAACTCACCACTGCTCCAGAAAATGATAGGAAACATATTTACCCAGCAGCCAAGTTAC
TATAATGACCTGGACGAAACCATTCCCACCATACTTCAGGTCTTCAGCAATATCCTCCAGCACTGTGGTTTGCAAGGGGATGGAATAAACACCATACCCCAGAAACTCGGGGAGAGGCCTCGGTTGAC
GCCCAGTGACATGCCTCTCTTGGAATTAAAGGACATTGTTCTCTACCTGTGTGACACCTCCACCACACTCTGGGCCTTTCTGGACATCTTCCCTTTGGCCTGCCAAACCTTCCAGAAACATGACTTTT
GTTACAGACTAGCTTCCTTTTATGAGATGGCGATTCCGGAAATAGAGTCTGCAATTAAGAAGAGGAGGCTTGAAGACAGCAAGCTCCTGGGTGACATGTGGCAGAGGCTCTCCCATTCCAAGAAGAAG
CTAATGGAGGTGTTTCACACCATCCTGAACCAGATCTGCCTCCTTCCCATTCTAGAGAGCAGCTGTGACAACATTCAAGGCTTCATTGAAGAATTCCTTCAAATCTTTAGCTCTTTGCTGCAGGAGAA
GAGATTCCTCCGAGACTATGACTCATTCTTCCCTGTAGCTGAAGACATCAGCTTGCTGCAGCAGGCTTCATCAGCATTGGATGAAACCCGGACTACCTACATCCTACAGGCTGTGGAAGGTGCATGGG
AAGGGGTGGACAGACAGAAAATCAAGGACATTAAAGACCCATCAAGAGCCAAGGATTCTAATAACGGAGTCACAATGACAGCAGAGCCAGTCAGTGAAATGCCATCACAGCTGGAGAATTCGGAAGAC
GATGAGGAGTGCATGGGTGCAGCAGCTGCCGTGGGCCCCGCCGTGAGCGGTGTGGAACTGGACTCACTCATCTCCCAAGTGAAGGACCTGCTGCCAGACCTCGGGGAGGGCTTTATTCTGGCCTGCCT
GGAGCACTACAGCTATGATTCAGAGCGGGTTATCAACAACATCCTGGAGGATCGGCTGGCCCCTGAGCTCAGTCAGCTGGACCGAAGCCTAGAAAGACAAGTAAAGCCGGACCCCACACCCCTGTTGT
CATCGCGTCACAACGTCTTCCAGAACGATGAGTTCGATGTGTTCAGCAGGGACTCAGTAGACCTGAGCCGAGTGCACAAGGGCAGGAGGAAGGAGGAGACCGTGAGGAGCCTGGTGAATGACAAGCAG
GCTGTGGTGGCACAGTGGCAGCGCTACCAGAAGTACAGTGTGATAGTGGAGGAGGTCCCACTGCAGCCAGGAGAATACCAGGCTGATGACTATGAGGACGAGTATGATGACACATACGATGGCAACCA
GGTGGGCGCCAATGATGCTGACTCTGATGACGAGCTCATCAGCCGCAGGCCCTTCACCATCCCTCAGGTGCTGAGAACCAAAATGCCTGTGGAAGGGCAGGAGGAGGAGTGTGATGAAGAGGATGAGG
TTGAAGAGGAGGCCCCCAAGCCAGACCATTTCATTCAGGATCCTGCAGTGCTGAGGGAAAAGGCTGAAGCTAGGCGCATAGCCTTCCTCGCCAGGAAAGGGTATCGACCTGAGAACTCCACTGCAGTG
ACAGGTGGACCCCGGGGCCATGGGCAAAGCCGAGAAACAACCCAGGAGCGCAGGAAGAAAGAGGCCAACAAGGCAGCCAGAGCCAACCACAGCCGTAGAACCATGGCTGACCGAAAGAGAAACAAAGG
CATGATCCCATCCTGAGGCCACAAGCTGCCTGGACCAGGGAGGCCCCTCAAGACCACCATCACACCTCACCTACCAGCCAGCCGTGAGCGCCTTCTTGTCAAACACACAGTGCCTTATCCCTTGGTGC
GGGAACCCAGTGCCATCGAGCAGGCTCTCTCCCAGCTGTGCTGGTGGGAAGGATGGGGCTGCAGAACCAAAGTGTCTCTCATCTCGGGCAGCAAGGCACCACCTCCAGAAGTCCTGGATGGCAGGAGA
CCTGTATATTCAGAAGCAACGAAAGGCCCATGAATAAAGTTTCTGACCTTCCAACAGTGCTCCCTG

hide sequence

RefSeq Acc Id:

XM_039092295 ⟹ XP_038948223

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	83,730,377 - 83,771,312 (+)	NCBI
mRatBN7.2	14	79,503,563 - 79,547,801 (+)	NCBI

RefSeq Acc Id:

XM_039092296 ⟹ XP_038948224

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	83,726,975 - 83,771,312 (+)	NCBI
mRatBN7.2	14	79,503,449 - 79,547,801 (+)	NCBI

RefSeq Acc Id:

XM_063273478 ⟹ XP_063129548

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	83,744,932 - 83,771,312 (+)	NCBI


Protein RefSeqs	NP_001102561	(Get FASTA)	NCBI Sequence Viewer
	XP_038948223	(Get FASTA)	NCBI Sequence Viewer
	XP_038948224	(Get FASTA)	NCBI Sequence Viewer
	XP_063129548	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM00235	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000060720.4
	ENSRNOP00000077053.1
	ENSRNOP00000083909
	ENSRNOP00000083909.1
	ENSRNOP00000090694
	ENSRNOP00000090694.1

RefSeq Acc Id:

NP_001102561 ⟸ NM_001109091

- UniProtKB:

A0A8I6ANY1 (UniProtKB/TrEMBL), A6IKH1 (UniProtKB/TrEMBL), D3ZPJ9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPALPLDQLQITHKDPKTGKLRTSAALHPEQKADRYFVLYKPPPKDNIPALVEEYLERANFVANDLDWLLALPHDKFWCQVIFDESLQKCLDSYLHYVPRKFDEWVAPTPEVADMQKHLHRSVFLTFL
RMSTHKESKDHFISPSAFGEILYNNFLFDIPKILDLCVLFGKGNSPLLQKMIGNIFTQQPSYYNDLDETIPTILQVFSNILQHCGLQGDGINTIPQKLGERPRLTPSDMPLLELKDIVLYLCDTSTTL
WAFLDIFPLACQTFQKHDFCYRLASFYEMAIPEIESAIKKRRLEDSKLLGDMWQRLSHSKKKLMEVFHTILNQICLLPILESSCDNIQGFIEEFLQIFSSLLQEKRFLRDYDSFFPVAEDISLLQQAS
SALDETRTTYILQAVEGAWEGVDRQKIKDIKDPSRAKDSNNGVTMTAEPVSEMPSQLENSEDDEECMGAAAAVGPAVSGVELDSLISQVKDLLPDLGEGFILACLEHYSYDSERVINNILEDRLAPEL
SQLDRSLERQVKPDPTPLLSSRHNVFQNDEFDVFSRDSVDLSRVHKGRRKEETVRSLVNDKQAVVAQWQRYQKYSVIVEEVPLQPGEYQADDYEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQV
LRTKMPVEGQEEECDEEDEVEEEAPKPDHFIQDPAVLREKAEARRIAFLARKGYRPENSTAVTGGPRGHGQSRETTQERRKKEANKAARANHSRRTMADRKRNKGMIPS

hide sequence

Ensembl Acc Id:

ENSRNOP00000060720 ⟸ ENSRNOT00000065188

RefSeq Acc Id:	XP_038948224 ⟸ XM_039092296
- Peptide Label:	isoform X2
- UniProtKB:	D3ZPJ9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038948223 ⟸ XM_039092295
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A067 (UniProtKB/TrEMBL), D3ZPJ9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000083909 ⟸ ENSRNOT00000117747

Protein Domains

CUE

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZPJ9-F1-model_v2	AlphaFold	D3ZPJ9	1-749	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-15173	BioCyc
Ensembl Genes	ENSRNOG00000007349	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000065188.4	UniProtKB/TrEMBL
	ENSRNOT00000109658	ENTREZGENE
	ENSRNOT00000109658.1	UniProtKB/TrEMBL
	ENSRNOT00000115226.1	UniProtKB/TrEMBL
	ENSRNOT00000117747	ENTREZGENE
	ENSRNOT00000117747.1	UniProtKB/TrEMBL
Gene3D-CATH	DNA helicase RuvA subunit, C-terminal domain	UniProtKB/TrEMBL
InterPro	ASCC2	UniProtKB/TrEMBL
	ASCC2_CUE	UniProtKB/TrEMBL
	CUE	UniProtKB/TrEMBL
	UBA-like	UniProtKB/TrEMBL
KEGG Report	rno:498402	UniProtKB/TrEMBL
NCBI Gene	498402	ENTREZGENE
PANTHER	ACTIVATING SIGNAL COINTEGRATOR 1 COMPLEX SUBUNIT 2	UniProtKB/TrEMBL
	ACTIVATING SIGNAL COINTEGRATOR 1 COMPLEX SUBUNIT 2 ASC-1 COMPLEX SUBUNIT P100	UniProtKB/TrEMBL
Pfam	CUE	UniProtKB/TrEMBL
PhenoGen	Ascc2	PhenoGen
PROSITE	CUE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000007349	RatGTEx
SMART	CUE	UniProtKB/TrEMBL
Superfamily-SCOP	UBA_like	UniProtKB/TrEMBL
UniProt	A0A8I5ZK78_RAT	UniProtKB/TrEMBL
	A0A8I6A067	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ANY1	ENTREZGENE, UniProtKB/TrEMBL
	A6IKH1	ENTREZGENE, UniProtKB/TrEMBL
	D3ZPJ9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-29	Ascc2	activating signal cointegrator 1 complex subunit 2	RGD1561422_predicted	similar to ASC-1 complex subunit P100 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1561422_predicted	similar to ASC-1 complex subunit P100 (predicted)	LOC498402	similar to ASC-1 complex subunit P100	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC498402	similar to ASC-1 complex subunit P100			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar