Symbol:
Fxr1
Name:
FMR1 autosomal homolog 1
RGD ID:
1311733
Description:
Predicted to enable several functions, including RNA binding activity; molecular condensate scaffold activity; and protein dimerization activity. Predicted to be involved in several processes, including modulation of chemical synaptic transmission; nucleus organization; and regulation of gene expression. Predicted to be located in several cellular components, including costamere; dendritic spine; and ribosome. Predicted to be active in several cellular components, including cytoplasmic stress granule; glutamatergic synapse; and nuclear envelope. Human ortholog(s) of this gene implicated in congenital myopathy 9A and congenital myopathy 9B. Orthologous to human FXR1 (FMR1 autosomal homolog 1); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 2,6-dinitrotoluene; acrylamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
fragile X mental retardation gene 1, autosomal homolog; fragile X mental retardation syndrome-related protein 1; fragile X mental retardation, autosomal homolog 1; Fxr1h; LOC100366044; LOC361927; rCG41429-like; RNA-binding protein FXR1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Fxr1-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 118,812,287 - 118,865,813 (+) NCBI GRCr8 mRatBN7.2 2 116,884,167 - 116,937,590 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 116,884,248 - 116,937,590 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 123,473,867 - 123,526,115 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 121,586,534 - 121,638,784 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 116,215,601 - 116,266,541 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 120,529,716 - 120,570,356 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 120,512,899 - 120,570,355 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 140,165,289 - 140,213,149 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 120,330,045 - 120,378,482 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 120,275,008 - 120,323,418 (+) NCBI Celera 2 111,923,546 - 111,975,799 (+) NCBI Celera Cytogenetic Map 2 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fxr1 Rat 1,2-dichloroethane decreases expression ISO Fxr1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of FXR1 mRNA CTD PMID:28960355 Fxr1 Rat 1,2-dimethylhydrazine multiple interactions ISO Fxr1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of FXR1 mRNA CTD PMID:22206623 Fxr1 Rat 1,2-dimethylhydrazine decreases expression ISO Fxr1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of FXR1 mRNA CTD PMID:22206623 Fxr1 Rat 17alpha-ethynylestradiol increases expression ISO Fxr1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of FXR1 mRNA CTD PMID:17942748 Fxr1 Rat 17alpha-ethynylestradiol multiple interactions ISO Fxr1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FXR1 mRNA CTD PMID:17942748 Fxr1 Rat 17beta-estradiol increases expression ISO Fxr1 (Mus musculus) 6480464 Estradiol results in increased expression of FXR1 mRNA CTD PMID:39298647 Fxr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO FXR1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FXR1 mRNA CTD PMID:17101203 Fxr1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Fxr1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FXR1 mRNA CTD PMID:17942748 Fxr1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Fxr1 Rat 2,4,6-tribromophenol decreases expression ISO FXR1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Fxr1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of FXR1 mRNA CTD PMID:21346803 Fxr1 Rat 2-hydroxypropanoic acid increases expression ISO FXR1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of FXR1 mRNA CTD PMID:30851411 Fxr1 Rat 2-methylcholine affects expression ISO FXR1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of FXR1 mRNA CTD PMID:21179406 Fxr1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO FXR1 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of FXR1 protein CTD PMID:31675489 Fxr1 Rat 4,4'-sulfonyldiphenol increases expression ISO Fxr1 (Mus musculus) 6480464 bisphenol S results in increased expression of FXR1 mRNA CTD PMID:39298647 Fxr1 Rat 4,4'-sulfonyldiphenol increases methylation ISO FXR1 (Homo sapiens) 6480464 bisphenol S results in increased methylation of FXR1 gene CTD PMID:31601247 Fxr1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of FXR1 mRNA CTD PMID:28959563 Fxr1 Rat acrylamide increases expression ISO FXR1 (Homo sapiens) 6480464 Acrylamide results in increased expression of FXR1 mRNA CTD PMID:32763439 Fxr1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of FXR1 mRNA CTD PMID:35163327 Fxr1 Rat amphotericin B decreases expression ISO FXR1 (Homo sapiens) 6480464 Amphotericin B analog results in decreased expression of FXR1 mRNA CTD PMID:28534445 Fxr1 Rat aristolochic acid A decreases expression ISO FXR1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of FXR1 mRNA CTD PMID:33212167 Fxr1 Rat Aroclor 1254 decreases expression ISO Fxr1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of FXR1 mRNA CTD PMID:23650126 Fxr1 Rat arsane affects methylation ISO FXR1 (Homo sapiens) 6480464 Arsenic affects the methylation of FXR1 gene CTD PMID:25304211 Fxr1 Rat arsenic atom affects methylation ISO FXR1 (Homo sapiens) 6480464 Arsenic affects the methylation of FXR1 gene CTD PMID:25304211 Fxr1 Rat benzo[a]pyrene multiple interactions ISO Fxr1 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to FXR1 promoter] CTD PMID:19654925 Fxr1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO FXR1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Fxr1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Fxr1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of FXR1 mRNA CTD PMID:33754040 Fxr1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FXR1 mRNA CTD PMID:25181051 Fxr1 Rat bisphenol A increases expression ISO FXR1 (Homo sapiens) 6480464 bisphenol A results in increased expression of FXR1 mRNA CTD PMID:33670352 Fxr1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of FXR1 protein CTD PMID:28903499 Fxr1 Rat caffeine increases phosphorylation ISO FXR1 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of FXR1 protein CTD PMID:35688186 Fxr1 Rat carbon nanotube increases expression ISO Fxr1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Fxr1 Rat cisplatin increases expression ISO Fxr1 (Mus musculus) 6480464 Cisplatin results in increased expression of FXR1 mRNA CTD PMID:21151649 Fxr1 Rat cobalt dichloride increases expression ISO FXR1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of FXR1 mRNA CTD PMID:19320972 and PMID:19376846 Fxr1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of FXR1 mRNA CTD PMID:24386269 Fxr1 Rat copper(II) sulfate increases expression ISO FXR1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of FXR1 mRNA CTD PMID:19549813 Fxr1 Rat coumarin increases phosphorylation ISO FXR1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of FXR1 protein CTD PMID:35688186 Fxr1 Rat decabromodiphenyl ether decreases expression ISO FXR1 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of FXR1 protein CTD PMID:31675489 Fxr1 Rat Dibutyl phosphate affects expression ISO FXR1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of FXR1 mRNA CTD PMID:37042841 Fxr1 Rat dicrotophos decreases expression ISO FXR1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of FXR1 mRNA CTD PMID:28302478 Fxr1 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of FXR1 mRNA CTD PMID:22546817 Fxr1 Rat dioxygen affects methylation ISO Fxr1 (Mus musculus) 6480464 Oxygen deficiency affects the methylation of FXR1 promoter CTD PMID:24205000 Fxr1 Rat dioxygen increases expression ISO Fxr1 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of FXR1 mRNA CTD PMID:24205000 Fxr1 Rat dorsomorphin multiple interactions ISO FXR1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fxr1 Rat doxorubicin increases expression ISO FXR1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of FXR1 mRNA CTD PMID:29803840 Fxr1 Rat elemental selenium decreases expression ISO FXR1 (Homo sapiens) 6480464 Selenium results in decreased expression of FXR1 mRNA CTD PMID:19244175 Fxr1 Rat entinostat multiple interactions ISO FXR1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of FXR1 mRNA CTD PMID:27188386 Fxr1 Rat entinostat decreases expression ISO FXR1 (Homo sapiens) 6480464 entinostat results in decreased expression of FXR1 mRNA CTD PMID:26272509 Fxr1 Rat enzyme inhibitor multiple interactions ISO FXR1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of FXR1 protein CTD PMID:23301498 Fxr1 Rat ethanol multiple interactions ISO FXR1 (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of FXR1 mRNA CTD PMID:29432896 Fxr1 Rat ethanol affects expression ISO Fxr1 (Mus musculus) 6480464 Ethanol affects the expression of FXR1 mRNA CTD PMID:30319688 Fxr1 Rat ethanol affects splicing ISO Fxr1 (Mus musculus) 6480464 Ethanol affects the splicing of FXR1 mRNA CTD PMID:30319688 Fxr1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of FXR1 mRNA CTD PMID:24136188 Fxr1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of FXR1 mRNA CTD PMID:24136188 Fxr1 Rat folic acid multiple interactions ISO Fxr1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of FXR1 mRNA CTD PMID:22206623 Fxr1 Rat FR900359 affects phosphorylation ISO FXR1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of FXR1 protein CTD PMID:37730182 Fxr1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of FXR1 gene CTD PMID:22079235 Fxr1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of FXR1 mRNA CTD PMID:24136188 Fxr1 Rat glufosinate increases expression ISO Fxr1 (Mus musculus) 6480464 phosphinothricin results in increased expression of FXR1 mRNA CTD PMID:34597628 Fxr1 Rat hydrogen peroxide affects expression ISO FXR1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of FXR1 mRNA CTD PMID:20044591 Fxr1 Rat hydrogen peroxide multiple interactions ISO Fxr1 (Mus musculus) 6480464 [Hydrogen Peroxide co-treated with N-(oxo-5 more ... CTD PMID:31494107 Fxr1 Rat ivermectin decreases expression ISO FXR1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of FXR1 protein CTD PMID:32959892 Fxr1 Rat methylmercury chloride decreases expression ISO FXR1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of FXR1 mRNA CTD PMID:28001369 Fxr1 Rat Monobutylphthalate increases expression EXP 6480464 monobutyl phthalate results in increased expression of FXR1 mRNA CTD PMID:29162477 Fxr1 Rat N-methyl-4-phenylpyridinium decreases expression ISO Fxr1 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of FXR1 protein CTD PMID:26558463 Fxr1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of FXR1 mRNA CTD PMID:24136188 Fxr1 Rat paracetamol increases expression ISO FXR1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of FXR1 mRNA CTD PMID:21420995 Fxr1 Rat paracetamol affects expression ISO Fxr1 (Mus musculus) 6480464 Acetaminophen affects the expression of FXR1 mRNA CTD PMID:17562736 Fxr1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of FXR1 mRNA CTD PMID:35163327 Fxr1 Rat phenethyl isothiocyanate decreases expression EXP 6480464 phenethyl isothiocyanate results in decreased expression of FXR1 mRNA CTD PMID:17616710 Fxr1 Rat pirinixic acid increases expression ISO Fxr1 (Mus musculus) 6480464 pirinixic acid results in increased expression of FXR1 mRNA CTD PMID:23811191 Fxr1 Rat potassium dichromate decreases expression ISO FXR1 (Homo sapiens) 6480464 Potassium Dichromate results in decreased expression of FXR1 protein CTD PMID:23718831 Fxr1 Rat quercetin increases phosphorylation ISO FXR1 (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of FXR1 protein CTD PMID:35688186 Fxr1 Rat rac-lactic acid increases expression ISO FXR1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of FXR1 mRNA CTD PMID:30851411 Fxr1 Rat resveratrol multiple interactions ISO FXR1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of FXR1 mRNA CTD PMID:23557933 Fxr1 Rat SB 431542 multiple interactions ISO FXR1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Fxr1 Rat selenium atom decreases expression ISO FXR1 (Homo sapiens) 6480464 Selenium results in decreased expression of FXR1 mRNA CTD PMID:19244175 Fxr1 Rat silver atom increases expression ISO FXR1 (Homo sapiens) 6480464 Silver results in increased expression of FXR1 mRNA CTD PMID:26014281 Fxr1 Rat silver(0) increases expression ISO FXR1 (Homo sapiens) 6480464 Silver results in increased expression of FXR1 mRNA CTD PMID:26014281 Fxr1 Rat sodium arsenate decreases expression ISO Fxr1 (Mus musculus) 6480464 sodium arsenate results in decreased expression of FXR1 mRNA CTD PMID:30953684 Fxr1 Rat sodium arsenite affects localization ISO FXR1 (Homo sapiens) 6480464 sodium arsenite affects the localization of FXR1 protein CTD PMID:16951406 Fxr1 Rat sodium arsenite increases expression ISO FXR1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of FXR1 mRNA CTD PMID:38568856 Fxr1 Rat testosterone enanthate affects expression ISO FXR1 (Homo sapiens) 6480464 testosterone enanthate affects the expression of FXR1 mRNA CTD PMID:17440010 Fxr1 Rat tetrachloromethane affects expression ISO Fxr1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of FXR1 mRNA CTD PMID:17484886 Fxr1 Rat tetrachloromethane increases expression ISO Fxr1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of FXR1 mRNA CTD PMID:27339419 and PMID:31919559 Fxr1 Rat thiram increases expression ISO FXR1 (Homo sapiens) 6480464 Thiram results in increased expression of FXR1 mRNA CTD PMID:38568856 Fxr1 Rat titanium dioxide affects expression ISO Fxr1 (Mus musculus) 6480464 titanium dioxide affects the expression of FXR1 mRNA CTD PMID:17656681 Fxr1 Rat titanium dioxide increases methylation ISO Fxr1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of FXR1 gene CTD PMID:35295148 Fxr1 Rat triptonide increases expression ISO Fxr1 (Mus musculus) 6480464 triptonide results in increased expression of FXR1 mRNA CTD PMID:33045310 Fxr1 Rat troglitazone decreases expression ISO Fxr1 (Mus musculus) 6480464 troglitazone results in decreased expression of FXR1 mRNA CTD PMID:28973697 Fxr1 Rat urethane increases expression ISO FXR1 (Homo sapiens) 6480464 Urethane results in increased expression of FXR1 mRNA CTD PMID:28818685 Fxr1 Rat valproic acid affects expression ISO FXR1 (Homo sapiens) 6480464 Valproic Acid affects the expression of FXR1 mRNA CTD PMID:25979313 Fxr1 Rat valproic acid decreases expression ISO FXR1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of FXR1 mRNA CTD PMID:23179753 more ... Fxr1 Rat valproic acid multiple interactions ISO FXR1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of FXR1 mRNA CTD PMID:27188386 Fxr1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of FXR1 mRNA CTD PMID:23034163 Fxr1 Rat vitamin E decreases expression ISO FXR1 (Homo sapiens) 6480464 Vitamin E results in decreased expression of FXR1 mRNA CTD PMID:19244175 Fxr1 Rat zinc atom multiple interactions ISO FXR1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of FXR1 mRNA CTD PMID:18593933 Fxr1 Rat zinc(0) multiple interactions ISO FXR1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of FXR1 mRNA CTD PMID:18593933
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,6-tribromophenol (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) acrylamide (EXP,ISO) alpha-Zearalanol (EXP) amphotericin B (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Brodifacoum (EXP) caffeine (ISO) carbon nanotube (ISO) cisplatin (ISO) cobalt dichloride (EXP,ISO) copper(II) sulfate (ISO) coumarin (ISO) decabromodiphenyl ether (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dieldrin (EXP) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) entinostat (ISO) enzyme inhibitor (ISO) ethanol (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) furan (EXP) glafenine (EXP) glufosinate (ISO) hydrogen peroxide (ISO) ivermectin (ISO) methylmercury chloride (ISO) Monobutylphthalate (EXP) N-methyl-4-phenylpyridinium (ISO) nefazodone (EXP) paracetamol (ISO) perfluorooctanoic acid (EXP) phenethyl isothiocyanate (EXP) pirinixic acid (ISO) potassium dichromate (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) SB 431542 (ISO) selenium atom (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) testosterone enanthate (ISO) tetrachloromethane (ISO) thiram (ISO) titanium dioxide (ISO) triptonide (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
animal organ development (IBA) cell differentiation (IEA) dentate gyrus development (ISO,ISS) membraneless organelle assembly (ISO,ISS) mRNA destabilization (ISO,ISS) mRNA transport (IBA) muscle organ development (IEA,ISO,ISS) muscle structure development (IEA) negative regulation of inflammatory response (ISO,ISS) negative regulation of long-term synaptic potentiation (ISO,ISS) negative regulation of mRNA catabolic process (ISO) negative regulation of translation (ISO,ISS) negative regulation of tumor necrosis factor production (ISO,ISS) nuclear pore complex assembly (ISO,ISS) nuclear pore localization (ISO,ISS) positive regulation of long-term neuronal synaptic plasticity (IBA) positive regulation of miRNA-mediated gene silencing (ISO,ISS) positive regulation of Rho protein signal transduction (ISO) positive regulation of translation (IBA,ISO,ISS) post-transcriptional regulation of gene expression (ISO,ISS) regulation of circadian sleep/wake cycle, sleep (ISO,ISS) regulation of mRNA stability (IBA) regulation of neurogenesis (ISO,ISS) regulation of synaptic transmission, glutamatergic (ISO,ISS) regulation of translation (IEA) regulation of translation at presynapse, modulating synaptic transmission (IBA) skeletal muscle organ development (ISO) spermatid development (ISO,ISS) spermatogenesis (IEA)
Cellular Component
axon (IEA,ISO) cell projection (IEA) costamere (ISO) cytoplasm (IEA,ISO,ISS) cytoplasmic ribonucleoprotein granule (IEA,ISO,ISS) cytoplasmic stress granule (IBA,IEA,ISO) cytosol (ISO) dendrite (IEA,ISO) dendritic spine (IEA,ISO) glutamatergic synapse (ISO) intracellular membraneless organelle (ISO,ISS) neuron projection (IBA) nuclear envelope (IEA,ISO,ISS) nucleus (IBA,IEA,ISO) perinuclear region of cytoplasm (ISO) postsynapse (IEA,ISO) presynapse (IEA) ribonucleoprotein granule (ISO) ribosome (ISO) synapse (IEA)
Fxr1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 118,812,287 - 118,865,813 (+) NCBI GRCr8 mRatBN7.2 2 116,884,167 - 116,937,590 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 116,884,248 - 116,937,590 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 123,473,867 - 123,526,115 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 121,586,534 - 121,638,784 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 116,215,601 - 116,266,541 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 120,529,716 - 120,570,356 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 120,512,899 - 120,570,355 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 140,165,289 - 140,213,149 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 120,330,045 - 120,378,482 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 120,275,008 - 120,323,418 (+) NCBI Celera 2 111,923,546 - 111,975,799 (+) NCBI Celera Cytogenetic Map 2 q24 NCBI
FXR1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 180,912,670 - 180,982,753 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 180,868,141 - 180,982,753 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 180,630,458 - 180,700,541 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 182,113,146 - 182,177,644 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 182,113,163 - 182,177,036 NCBI Celera 3 179,062,664 - 179,132,978 (+) NCBI Celera Cytogenetic Map 3 q26.33 NCBI HuRef 3 178,034,321 - 178,104,537 (+) NCBI HuRef CHM1_1 3 180,593,505 - 180,663,825 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 183,714,436 - 183,784,535 (+) NCBI T2T-CHM13v2.0
Fxr1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 34,074,133 - 34,124,129 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 34,074,092 - 34,124,471 (+) Ensembl GRCm39 Ensembl GRCm38 3 34,020,058 - 34,069,980 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 34,019,943 - 34,070,322 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 33,919,001 - 33,968,267 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 34,211,657 - 34,260,887 (+) NCBI MGSCv36 mm8 Celera 3 33,916,172 - 33,965,473 (+) NCBI Celera Cytogenetic Map 3 A3 NCBI cM Map 3 16.41 NCBI
Fxr1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955420 9,903,736 - 9,966,100 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955420 9,903,736 - 9,966,100 (+) NCBI ChiLan1.0 ChiLan1.0
FXR1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 178,783,206 - 178,848,482 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 178,787,916 - 178,853,817 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 177,948,040 - 178,012,705 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 186,119,331 - 186,187,126 (+) NCBI panpan1.1 PanPan1.1 panPan2
FXR1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 34 14,129,978 - 14,192,016 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 34 14,130,017 - 14,191,370 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 34 18,212,277 - 18,274,019 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 34 14,031,339 - 14,093,392 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 34 14,031,378 - 14,093,391 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 34 14,077,460 - 14,139,011 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 34 14,059,493 - 14,121,524 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 34 14,303,530 - 14,365,583 (+) NCBI UU_Cfam_GSD_1.0
Fxr1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 110,795,745 - 110,866,441 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936566 2,354,441 - 2,425,176 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936566 2,354,301 - 2,425,140 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FXR1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 118,839,338 - 118,900,136 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 118,839,314 - 118,899,804 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 128,089,495 - 128,175,102 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FXR1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 8,420,789 - 8,486,681 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 8,421,654 - 8,486,384 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666063 17,252,536 - 17,318,234 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fxr1
.
Predicted Target Of
Count of predictions: 13 Count of miRNA genes: 13 Interacting mature miRNAs: 13 Transcripts: ENSRNOT00000074060 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 631566 Bp90 Blood pressure QTL 90 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 102803808 147803808 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1598865 Bp296 Blood pressure QTL 296 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 81018907 126018907 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1578772 Stresp14 Stress response QTL 14 5 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 2 82345893 130923501 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 1598862 Glom9 Glomerulus QTL 9 3.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 2 92337601 137337601 Rat 631198 Cm22 Cardiac mass QTL 22 4.3 0.0008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 76539322 150540526 Rat 1598863 Cm65 Cardiac mass QTL 65 2.3 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 92337601 137337601 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 2300165 Bmd49 Bone mineral density QTL 49 4.8 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 2 88862519 133862519 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 2300170 Bmd45 Bone mineral density QTL 45 12.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 2 88862519 133862519 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1359035 Bp276 Blood pressure QTL 276 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 143657569 Rat 8662836 Vetf8 Vascular elastic tissue fragility QTL 8 0.66 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 104559726 149559726 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 2299162 Iddm32 Insulin dependent diabetes mellitus QTL 32 2.36 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 78665616 143657569 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 2300185 Bmd46 Bone mineral density QTL 46 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 88862519 133862519 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 61392 Bp6 Blood pressure QTL 6 7 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 2 80270434 125270434 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1581552 Pur12 Proteinuria QTL 12 5.19 0.0009 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 2 112103657 148076632 Rat 1558653 Prcr1 Prostate cancer resistance QTL 1 5 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 2 72532993 157142209 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 7207808 Bmd89 Bone mineral density QTL 89 4.1 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 2 88862519 133862519 Rat 1558648 Smcn1 Smooth muscle cell number QTL 1 0.039 blood vessel smooth muscle cell quantity (VT:0010525) aorta smooth muscle cell count per unit vessel length (CMO:0001646) 2 59134147 127460910 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1354594 Despr10 Despair related QTL 10 2e-06 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 2 114654253 159654253 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 61438 Cia7 Collagen induced arthritis QTL 7 4.6 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 2 59324377 141596857 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
RH123299
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 2 140,184,741 - 140,185,213 NCBI Rnor5.0 RGSC_v3.4 2 120,358,866 - 120,359,337 UniSTS RGSC3.4 Celera 2 111,952,036 - 111,952,507 UniSTS Cytogenetic Map 2 q25 UniSTS
RH132222
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 116,932,491 - 116,932,685 (-) MAPPER mRatBN7.2 Rnor_6.0 2 120,516,718 - 120,516,911 NCBI Rnor6.0 Rnor_5.0 2 140,162,560 - 140,162,753 UniSTS Rnor5.0 RGSC_v3.4 2 120,379,472 - 120,379,665 UniSTS RGSC3.4 Celera 2 111,971,786 - 111,971,979 UniSTS RH 3.4 Map 2 683.6 UniSTS Cytogenetic Map 2 q25 UniSTS
X90875
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 2 140,158,874 - 140,159,032 UniSTS Rnor5.0 Rnor_5.0 2 140,165,423 - 140,165,581 UniSTS Rnor5.0 Celera 2 111,975,507 - 111,975,665 UniSTS Cytogenetic Map 2 q25 UniSTS
RH139070
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 116,924,570 - 116,924,704 (-) MAPPER mRatBN7.2 Rnor_6.0 2 120,530,350 - 120,530,483 NCBI Rnor6.0 Rnor_5.0 2 140,173,143 - 140,173,276 UniSTS Rnor5.0 Celera 2 111,963,863 - 111,963,996 UniSTS RH 3.4 Map 2 684.9 UniSTS Cytogenetic Map 2 q25 UniSTS
BI274570
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 116,935,372 - 116,936,240 (-) MAPPER mRatBN7.2 Rnor_6.0 2 120,519,947 - 120,520,151 NCBI Rnor6.0 Rnor_6.0 2 120,513,163 - 120,514,030 NCBI Rnor6.0 Rnor_5.0 2 140,159,005 - 140,159,872 UniSTS Rnor5.0 Rnor_5.0 2 140,165,554 - 140,165,758 UniSTS Rnor5.0 Celera 2 111,974,667 - 111,975,534 UniSTS RH 3.4 Map 1 16.7 UniSTS Cytogenetic Map 2 q25 UniSTS
BI281166
Rat Assembly Chr Position (strand) Source JBrowse Rnor_6.0 2 120,520,007 - 120,520,204 NCBI Rnor6.0 Rnor_5.0 2 140,165,614 - 140,165,811 UniSTS Rnor5.0 RH 3.4 Map 1 16.7 UniSTS Cytogenetic Map 2 q25 UniSTS
UniSTS:479111
Rat Assembly Chr Position (strand) Source JBrowse Rnor_6.0 2 120,520,193 - 120,520,822 NCBI Rnor6.0 Rnor_5.0 2 140,165,800 - 140,166,429 UniSTS Rnor5.0 Cytogenetic Map 2 q25 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000088442 ⟹ ENSRNOP00000069834
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 116,884,257 - 116,936,504 (+) Ensembl Rnor_6.0 Ensembl 2 120,512,899 - 120,570,355 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101775 ⟹ ENSRNOP00000084548
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 116,884,248 - 116,937,590 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102612 ⟹ ENSRNOP00000095711
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 116,884,251 - 116,936,347 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103508 ⟹ ENSRNOP00000081168
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 116,884,248 - 116,937,590 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117973 ⟹ ENSRNOP00000084892
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 116,905,868 - 116,932,847 (+) Ensembl
RefSeq Acc Id:
NM_001012179 ⟹ NP_001012179
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 118,812,479 - 118,865,813 (+) NCBI mRatBN7.2 2 116,884,250 - 116,937,590 (+) NCBI Rnor_6.0 2 120,529,716 - 120,570,356 (-) NCBI Rnor_5.0 2 140,165,289 - 140,213,149 (-) NCBI RGSC_v3.4 2 120,330,045 - 120,378,482 (+) RGD Celera 2 111,923,546 - 111,975,799 (+) NCBI
Sequence:
TTCCAACATGGCGGAGCTGACGGTGGAGGTTCGCGGCTCCAACGGGGCTTTCTACAAGGTATTTATCAAAGATGTCCACGAAGACTCCCTCACAGTTGTTTTTGAAAATAATTGGCAACCAGAACGCC
hide sequence
RefSeq Acc Id:
NM_001415068 ⟹ NP_001401997
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 118,812,479 - 118,865,813 (+) NCBI mRatBN7.2 2 116,884,250 - 116,937,590 (+) NCBI
RefSeq Acc Id:
NM_001415069 ⟹ NP_001401998
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 118,812,479 - 118,865,813 (+) NCBI mRatBN7.2 2 116,884,250 - 116,937,590 (+) NCBI
RefSeq Acc Id:
NM_001415070 ⟹ NP_001401999
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 118,812,479 - 118,865,813 (+) NCBI mRatBN7.2 2 116,884,250 - 116,937,590 (+) NCBI
RefSeq Acc Id:
NM_001415071 ⟹ NP_001402000
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 118,812,479 - 118,865,813 (+) NCBI mRatBN7.2 2 116,884,250 - 116,937,590 (+) NCBI
RefSeq Acc Id:
XM_039102584 ⟹ XP_038958512
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 118,812,320 - 118,865,353 (+) NCBI mRatBN7.2 2 116,884,167 - 116,937,586 (+) NCBI
RefSeq Acc Id:
XM_063282053 ⟹ XP_063138123
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 118,813,263 - 118,865,353 (+) NCBI
RefSeq Acc Id:
XM_063282054 ⟹ XP_063138124
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 118,812,287 - 118,865,353 (+) NCBI
RefSeq Acc Id:
XM_063282055 ⟹ XP_063138125
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 118,813,263 - 118,865,353 (+) NCBI
RefSeq Acc Id:
XM_063282057 ⟹ XP_063138127
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 118,842,850 - 118,865,353 (+) NCBI
RefSeq Acc Id:
XM_063282058 ⟹ XP_063138128
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 118,812,320 - 118,848,436 (+) NCBI
RefSeq Acc Id:
XM_063282059 ⟹ XP_063138129
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 118,812,320 - 118,848,492 (+) NCBI
RefSeq Acc Id:
NP_001012179 ⟸ NM_001012179
- Peptide Label:
isoform 4
- UniProtKB:
Q5XI81 (UniProtKB/Swiss-Prot), A0A3G2LW22 (UniProtKB/TrEMBL), A0A0G2JWD2 (UniProtKB/TrEMBL)
- Sequence:
MAELTVEVRGSNGAFYKVFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFK
hide sequence
Ensembl Acc Id:
ENSRNOP00000069834 ⟸ ENSRNOT00000088442
RefSeq Acc Id:
XP_038958512 ⟸ XM_039102584
- Peptide Label:
isoform X2
- UniProtKB:
Q5XI81 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSRNOP00000084892 ⟸ ENSRNOT00000117973
Ensembl Acc Id:
ENSRNOP00000081168 ⟸ ENSRNOT00000103508
Ensembl Acc Id:
ENSRNOP00000084548 ⟸ ENSRNOT00000101775
Ensembl Acc Id:
ENSRNOP00000095711 ⟸ ENSRNOT00000102612
RefSeq Acc Id:
NP_001401997 ⟸ NM_001415068
- Peptide Label:
isoform 1
- UniProtKB:
Q5XI81 (UniProtKB/Swiss-Prot), A0A8I6AM03 (UniProtKB/TrEMBL), A6IHT2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001401998 ⟸ NM_001415069
- Peptide Label:
isoform 2
- UniProtKB:
Q5XI81 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001401999 ⟸ NM_001415070
- Peptide Label:
isoform 3
- UniProtKB:
Q5XI81 (UniProtKB/Swiss-Prot), A0A8I5ZRV6 (UniProtKB/TrEMBL), A6IHT3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001402000 ⟸ NM_001415071
- Peptide Label:
isoform 5
- UniProtKB:
Q5XI81 (UniProtKB/Swiss-Prot), A6IHT4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063138124 ⟸ XM_063282054
- Peptide Label:
isoform X3
- UniProtKB:
Q5XI81 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063138129 ⟸ XM_063282059
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063138128 ⟸ XM_063282058
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063138123 ⟸ XM_063282053
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063138125 ⟸ XM_063282055
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063138127 ⟸ XM_063282057
- Peptide Label:
isoform X5
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Fxr1
FMR1 autosomal homolog 1
LOC100366044
rCG41429-like
Data merged from RGD:2324412
737654 PROVISIONAL
2016-02-24
Fxr1
FMR1 autosomal homolog 1
Fxr1
fragile X mental retardation, autosomal homolog 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-07-09
Fxr1
fragile X mental retardation, autosomal homolog 1
Fxr1
fragile X mental retardation gene 1, autosomal homolog
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-01-17
Fxr1
fragile X mental retardation gene 1, autosomal homolog
Fxr1
fragile X mental retardation, autosomal homolog 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-05-06
LOC100366044
rCG41429-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-03-04
Fxr1
fragile X mental retardation, autosomal homolog 1
Fxr1h
fragile X mental retardation gene 1, autosomal homolog
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Fxr1h
fragile X mental retardation gene 1, autosomal homolog
Fxr1h_predicted
fragile X mental retardation gene 1, autosomal homolog (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Fxr1h_predicted
fragile X mental retardation gene 1, autosomal homolog (predicted)
Symbol and Name status set to approved
70820 APPROVED
