Symbol:
Rapsn
Name:
receptor-associated protein of the synapse
RGD ID:
1311592
Description:
Enables ionotropic glutamate receptor binding activity. Involved in establishment of protein localization to postsynaptic membrane; positive regulation of neuromuscular synaptic transmission; and regulation of postsynaptic membrane organization. Located in neuromuscular junction. Human ortholog(s) of this gene implicated in congenital myasthenic syndrome 11 and fetal akinesia deformation sequence syndrome 2. Orthologous to human RAPSN (receptor associated protein of the synapse); PARTICIPATES IN acetylcholine signaling pathway via nicotinic acetylcholine receptor; INTERACTS WITH atrazine; bisphenol A; cadmium dichloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
43 kDa receptor-associated protein of the synapse; LOC362161; rapsyn; receptor-associated protein of the synapse, 43 kDa
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 97,470,891 - 97,480,196 (+) NCBI GRCr8 mRatBN7.2 3 77,015,073 - 77,024,378 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 76,983,471 - 77,024,373 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 80,493,612 - 80,502,907 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 89,092,627 - 89,101,922 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 86,943,726 - 86,953,069 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 79,859,815 - 79,869,486 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 79,860,179 - 79,869,524 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 86,568,568 - 86,578,239 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 75,396,836 - 75,406,115 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 75,293,208 - 75,302,485 (+) NCBI Celera 3 76,223,882 - 76,233,161 (+) NCBI Celera Cytogenetic Map 3 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Rapsn Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 97,470,891 - 97,480,196 (+) NCBI GRCr8 mRatBN7.2 3 77,015,073 - 77,024,378 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 76,983,471 - 77,024,373 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 80,493,612 - 80,502,907 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 89,092,627 - 89,101,922 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 86,943,726 - 86,953,069 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 79,859,815 - 79,869,486 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 79,860,179 - 79,869,524 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 86,568,568 - 86,578,239 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 75,396,836 - 75,406,115 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 75,293,208 - 75,302,485 (+) NCBI Celera 3 76,223,882 - 76,233,161 (+) NCBI Celera Cytogenetic Map 3 q24 NCBI
RAPSN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 47,437,764 - 47,449,136 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 47,437,764 - 47,449,143 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 47,459,315 - 47,470,688 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 47,415,891 - 47,427,306 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 47,415,890 - 47,427,306 NCBI Celera 11 47,601,051 - 47,612,463 (-) NCBI Celera Cytogenetic Map 11 p11.2 NCBI HuRef 11 47,159,075 - 47,170,494 (-) NCBI HuRef CHM1_1 11 47,458,570 - 47,469,991 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 47,597,603 - 47,608,976 (-) NCBI T2T-CHM13v2.0
Rapsn Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 90,864,594 - 90,876,074 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 90,865,965 - 90,876,074 (+) Ensembl GRCm39 Ensembl GRCm38 2 91,035,472 - 91,045,729 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 91,035,620 - 91,045,729 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 90,875,784 - 90,885,886 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 90,836,478 - 90,846,568 (+) NCBI MGSCv36 mm8 Celera 2 92,420,152 - 92,430,248 (+) NCBI Celera Cytogenetic Map 2 E1 NCBI cM Map 2 50.44 NCBI
Rapsn Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 826,727 - 834,289 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 826,556 - 834,483 (+) NCBI ChiLan1.0 ChiLan1.0
RAPSN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 49,642,069 - 49,656,586 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 49,661,853 - 49,676,291 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 47,387,324 - 47,398,579 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 47,940,530 - 47,951,667 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 47,940,530 - 47,951,667 (-) Ensembl panpan1.1 panPan2
RAPSN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 42,199,160 - 42,210,668 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 42,199,412 - 42,210,673 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 40,930,029 - 40,941,208 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 42,855,197 - 42,866,378 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 42,855,420 - 42,866,216 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 42,341,801 - 42,352,980 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 41,896,689 - 41,907,866 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 42,626,215 - 42,637,394 (+) NCBI UU_Cfam_GSD_1.0
Rapsn Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 19,680,416 - 19,692,511 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936562 1,795,905 - 1,804,181 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936562 1,796,087 - 1,804,153 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RAPSN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 15,166,306 - 15,193,047 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 15,166,968 - 15,181,011 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 16,382,739 - 16,387,663 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RAPSN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 17,867,721 - 17,887,162 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 17,868,888 - 17,887,164 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 115,165,684 - 115,176,850 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rapsn
.
Predicted Target Of
Count of predictions: 76 Count of miRNA genes: 65 Interacting mature miRNAs: 72 Transcripts: ENSRNOT00000068444 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 61377 Edpm3 Estrogen-dependent pituitary mass QTL 3 7.05 0.038 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 53184692 89878207 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 1582221 Kidm30 Kidney mass QTL 30 3.5 0.0008 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 3 64655305 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1582210 Bw71 Body weight QTL 71 3.3 0.0012 body mass (VT:0001259) body weight (CMO:0000012) 3 64655305 115665732 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 731180 Bp152 Blood pressure QTL 152 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 53781112 91609953 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 631200 Cm25 Cardiac mass QTL 25 4.8 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 3 61134348 89115068 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
88
87
56
25
56
6
215
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000068444 ⟹ ENSRNOP00000060958
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 77,015,094 - 77,024,373 (+) Ensembl Rnor_6.0 Ensembl 3 79,860,207 - 79,869,486 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000081160 ⟹ ENSRNOP00000075166
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 76,983,471 - 77,024,369 (+) Ensembl Rnor_6.0 Ensembl 3 79,860,179 - 79,869,524 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103028 ⟹ ENSRNOP00000092830
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 76,983,471 - 77,024,369 (+) Ensembl
RefSeq Acc Id:
NM_001108584 ⟹ NP_001102054
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 97,470,891 - 97,480,196 (+) NCBI mRatBN7.2 3 77,015,073 - 77,024,378 (+) NCBI Rnor_6.0 3 79,860,207 - 79,869,486 (+) NCBI Rnor_5.0 3 86,568,568 - 86,578,239 (+) NCBI RGSC_v3.4 3 75,396,836 - 75,406,115 (+) RGD Celera 3 76,223,882 - 76,233,161 (+) RGD
Sequence:
TGTTCCCAGGGTGGCGCCCGTTGTCCATCCAGGCCCTGCTTAGCTTTTGCCTGGTGTTGCTTTTCCCTCCCAGAGATCAGCTGGCACTGTGGGTCCAACACCATGAAGGTCTAAAGACACCTAGCCAA
hide sequence
RefSeq Acc Id:
NM_001399728 ⟹ NP_001386657
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 97,470,891 - 97,480,196 (+) NCBI mRatBN7.2 3 77,015,073 - 77,024,378 (+) NCBI
RefSeq Acc Id:
XM_039105428 ⟹ XP_038961356
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 97,471,248 - 97,480,189 (+) NCBI mRatBN7.2 3 77,015,427 - 77,024,371 (+) NCBI
RefSeq Acc Id:
NP_001102054 ⟸ NM_001108584
- Peptide Label:
isoform 2
- UniProtKB:
D3ZPG2 (UniProtKB/TrEMBL), A6HN99 (UniProtKB/TrEMBL), A0A8I6AIQ1 (UniProtKB/TrEMBL)
- Sequence:
MGQDQTKQQIEKGLQLYQSNQTEKALQVWMKVLEKGSDLVGRFRVLGCLVTAHSEMGRYKEMLKFAVVQIDTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQLGGQVSLS
hide sequence
Ensembl Acc Id:
ENSRNOP00000060958 ⟸ ENSRNOT00000068444
Ensembl Acc Id:
ENSRNOP00000075166 ⟸ ENSRNOT00000081160
RefSeq Acc Id:
XP_038961356 ⟸ XM_039105428
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000092830 ⟸ ENSRNOT00000103028
RefSeq Acc Id:
NP_001386657 ⟸ NM_001399728
- Peptide Label:
isoform 1
- UniProtKB:
A0A0G2K9X2 (UniProtKB/TrEMBL), A6HN98 (UniProtKB/TrEMBL), A0A8I6AIQ1 (UniProtKB/TrEMBL)
RGD ID: 13692203 Promoter ID: EPDNEW_R2728 Type: single initiation site Name: Rapsn_1 Description: receptor-associated protein of the synapse SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 79,860,208 - 79,860,268 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Rapsn
receptor-associated protein of the synapse
Rapsn_predicted
receptor-associated protein of the synapse (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Rapsn_predicted
receptor-associated protein of the synapse (predicted)
Symbol and Name status set to approved
70820 APPROVED
