Symbol:
Insc
Name:
INSC, spindle orientation adaptor protein
RGD ID:
1311379
Description:
Predicted to enable cytoskeletal anchor activity and protein domain specific binding activity. Predicted to be involved in apical protein localization; regulation of asymmetric cell division; and regulation of protein stability. Predicted to be located in cell cortex and plasma membrane. Predicted to be part of protein-containing complex. Predicted to be active in apical cortex. Orthologous to human INSC (INSC spindle orientation adaptor protein); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
hypothetical LOC293166; inscuteable homolog; inscuteable homolog (Drosophila); LOC293166; RGD1311379
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 178,427,360 - 178,534,827 (+) NCBI GRCr8 mRatBN7.2 1 168,993,032 - 169,100,438 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 168,993,032 - 169,100,433 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 177,313,540 - 177,420,920 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 184,499,609 - 184,606,997 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 177,206,376 - 177,313,740 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 184,299,200 - 184,407,487 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 184,299,250 - 184,407,480 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 191,272,625 - 191,380,862 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 172,804,412 - 172,913,667 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 172,938,861 - 173,045,793 (+) NCBI Celera 1 166,826,157 - 166,933,448 (+) NCBI Celera Cytogenetic Map 1 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Insc Rat (2,4,5-trichlorophenoxy)acetic acid increases expression ISO Insc (Mus musculus) 6480464 2 more ... CTD PMID:18579281 Insc Rat 1,2-dimethylhydrazine decreases expression ISO Insc (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of INSC mRNA CTD PMID:22206623 Insc Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of INSC mRNA CTD PMID:32145629 Insc Rat 17beta-estradiol increases expression ISO Insc (Mus musculus) 6480464 Estradiol results in increased expression of INSC mRNA CTD PMID:39298647 Insc Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Insc (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to INSC promoter] CTD PMID:19654925 Insc Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of INSC mRNA CTD PMID:32109520 and PMID:33387578 Insc Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Insc (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of INSC mRNA CTD PMID:28922406 Insc Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Insc Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Insc (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Insc Rat 4,4'-sulfonyldiphenol decreases methylation ISO Insc (Mus musculus) 6480464 bisphenol S results in decreased methylation of INSC exon CTD PMID:33297965 Insc Rat 4,4'-sulfonyldiphenol affects methylation ISO Insc (Mus musculus) 6480464 bisphenol S affects the methylation of INSC gene CTD PMID:31683443 Insc Rat 4,4'-sulfonyldiphenol increases expression ISO Insc (Mus musculus) 6480464 bisphenol S results in increased expression of INSC mRNA CTD PMID:33297965 and PMID:39298647 Insc Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of INSC mRNA CTD PMID:24780913 and PMID:25825206 Insc Rat aldrin increases expression ISO Insc (Mus musculus) 6480464 Aldrin results in increased expression of INSC mRNA CTD PMID:18579281 Insc Rat all-trans-retinoic acid multiple interactions ISO Insc (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of INSC mRNA CTD PMID:36189433 Insc Rat arsane affects methylation ISO INSC (Homo sapiens) 6480464 Arsenic affects the methylation of INSC gene CTD PMID:25304211 Insc Rat arsenic atom affects methylation ISO INSC (Homo sapiens) 6480464 Arsenic affects the methylation of INSC gene CTD PMID:25304211 Insc Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of INSC mRNA CTD PMID:36841081 Insc Rat benzo[a]pyrene decreases methylation ISO INSC (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of INSC 3' UTR CTD PMID:27901495 Insc Rat benzo[a]pyrene increases expression ISO INSC (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of INSC mRNA CTD PMID:32234424 Insc Rat benzo[a]pyrene increases methylation ISO INSC (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of INSC exon and Benzo(a)pyrene results in increased methylation of INSC promoter CTD PMID:27901495 Insc Rat benzo[a]pyrene diol epoxide I affects expression ISO INSC (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Insc Rat bisphenol A increases expression ISO Insc (Mus musculus) 6480464 bisphenol A results in increased expression of INSC mRNA CTD PMID:21932408 and PMID:32156529 Insc Rat bisphenol A multiple interactions ISO INSC (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of INSC gene CTD PMID:31601247 Insc Rat bisphenol A decreases methylation ISO INSC (Homo sapiens) 6480464 bisphenol A results in decreased methylation of INSC gene CTD PMID:31601247 Insc Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of INSC mRNA CTD PMID:25181051 more ... Insc Rat bisphenol F increases expression ISO Insc (Mus musculus) 6480464 bisphenol F results in increased expression of INSC mRNA CTD PMID:36706583 and PMID:38685157 Insc Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of INSC mRNA CTD PMID:32479839 Insc Rat cantharidin increases expression ISO Insc (Mus musculus) 6480464 Cantharidin results in increased expression of INSC mRNA CTD PMID:36907384 Insc Rat carbon nanotube decreases expression ISO Insc (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of INSC mRNA CTD PMID:25620056 Insc Rat carbon nanotube increases expression ISO Insc (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of INSC mRNA CTD PMID:25620056 Insc Rat chlorpyrifos increases expression ISO Insc (Mus musculus) 6480464 Chlorpyrifos results in increased expression of INSC mRNA CTD PMID:37019170 Insc Rat clofibrate increases expression ISO Insc (Mus musculus) 6480464 Clofibrate results in increased expression of INSC mRNA CTD PMID:23811191 Insc Rat copper(II) chloride increases expression ISO INSC (Homo sapiens) 6480464 cupric chloride results in increased expression of INSC mRNA CTD PMID:38568856 Insc Rat copper(II) sulfate increases expression ISO Insc (Mus musculus) 6480464 Copper Sulfate results in increased expression of INSC mRNA CTD PMID:18579281 Insc Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of INSC mRNA CTD PMID:27523638 Insc Rat cyclosporin A increases expression ISO INSC (Homo sapiens) 6480464 Cyclosporine results in increased expression of INSC mRNA CTD PMID:27989131 Insc Rat dexamethasone decreases expression ISO Insc (Mus musculus) 6480464 Dexamethasone results in decreased expression of INSC mRNA CTD PMID:22733784 Insc Rat dibutyl phthalate increases expression ISO Insc (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of INSC mRNA CTD PMID:21266533 Insc Rat dorsomorphin multiple interactions ISO INSC (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Insc Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of INSC mRNA CTD PMID:29391264 Insc Rat epoxiconazole decreases expression ISO Insc (Mus musculus) 6480464 epoxiconazole results in decreased expression of INSC mRNA CTD PMID:35436446 Insc Rat fulvestrant multiple interactions ISO INSC (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of INSC gene CTD PMID:31601247 Insc Rat fulvestrant increases methylation ISO INSC (Homo sapiens) 6480464 Fulvestrant results in increased methylation of INSC gene CTD PMID:31601247 Insc Rat furan increases expression ISO Insc (Mus musculus) 6480464 furan results in increased expression of INSC mRNA CTD PMID:24183702 Insc Rat genistein increases expression ISO Insc (Mus musculus) 6480464 Genistein results in increased expression of INSC mRNA CTD PMID:32186404 Insc Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Insc (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of INSC mRNA CTD PMID:36189433 Insc Rat ozone multiple interactions ISO Insc (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of INSC mRNA CTD PMID:27106289 Insc Rat panobinostat increases expression ISO INSC (Homo sapiens) 6480464 panobinostat results in increased expression of INSC mRNA CTD PMID:26272509 Insc Rat panobinostat multiple interactions ISO INSC (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INSC mRNA CTD PMID:27188386 Insc Rat paracetamol affects expression ISO Insc (Mus musculus) 6480464 Acetaminophen affects the expression of INSC mRNA CTD PMID:17562736 Insc Rat phenobarbital decreases expression ISO Insc (Mus musculus) 6480464 Phenobarbital results in decreased expression of INSC mRNA CTD PMID:19270015 Insc Rat phenobarbital affects expression ISO Insc (Mus musculus) 6480464 Phenobarbital affects the expression of INSC mRNA CTD PMID:23091169 Insc Rat pirinixic acid increases expression ISO Insc (Mus musculus) 6480464 pirinixic acid results in increased expression of INSC mRNA CTD PMID:23811191 Insc Rat pregnenolone 16alpha-carbonitrile increases expression ISO Insc (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of INSC mRNA CTD PMID:28903501 Insc Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of INSC mRNA CTD PMID:28374803 Insc Rat SB 431542 multiple interactions ISO INSC (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Insc Rat sodium arsenite increases expression ISO INSC (Homo sapiens) 6480464 sodium arsenite results in increased expression of INSC mRNA CTD PMID:38568856 Insc Rat sodium arsenite increases expression ISO Insc (Mus musculus) 6480464 sodium arsenite results in increased expression of INSC mRNA CTD PMID:37682722 Insc Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of INSC mRNA CTD PMID:34492290 Insc Rat thiram increases expression ISO INSC (Homo sapiens) 6480464 Thiram results in increased expression of INSC mRNA CTD PMID:38568856 Insc Rat titanium dioxide decreases expression ISO Insc (Mus musculus) 6480464 titanium dioxide results in decreased expression of INSC mRNA CTD PMID:29264374 Insc Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of INSC mRNA CTD PMID:33387578 Insc Rat trichostatin A increases expression ISO INSC (Homo sapiens) 6480464 trichostatin A results in increased expression of INSC mRNA CTD PMID:24935251 and PMID:26272509 Insc Rat trichostatin A multiple interactions ISO INSC (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INSC mRNA CTD PMID:27188386 Insc Rat Triptolide affects expression ISO Insc (Mus musculus) 6480464 triptolide affects the expression of INSC mRNA CTD PMID:32835833 Insc Rat triptonide decreases expression ISO Insc (Mus musculus) 6480464 triptonide results in decreased expression of INSC mRNA CTD PMID:33045310 Insc Rat troglitazone increases expression ISO Insc (Mus musculus) 6480464 troglitazone results in increased expression of INSC mRNA CTD PMID:28973697 Insc Rat valproic acid decreases methylation ISO INSC (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of INSC gene CTD PMID:29154799 Insc Rat valproic acid affects expression ISO Insc (Mus musculus) 6480464 Valproic Acid affects the expression of INSC mRNA CTD PMID:17292431 and PMID:17963808 Insc Rat valproic acid increases expression ISO INSC (Homo sapiens) 6480464 Valproic Acid results in increased expression of INSC mRNA CTD PMID:23179753 more ... Insc Rat valproic acid multiple interactions ISO INSC (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INSC mRNA CTD PMID:27188386 Insc Rat vorinostat increases expression ISO INSC (Homo sapiens) 6480464 vorinostat results in increased expression of INSC mRNA CTD PMID:26272509 Insc Rat vorinostat multiple interactions ISO INSC (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of INSC mRNA CTD PMID:27188386
(2,4,5-trichlorophenoxy)acetic acid (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aldrin (ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromobenzene (EXP) cantharidin (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) clofibrate (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) dibutyl phthalate (ISO) dorsomorphin (ISO) endosulfan (EXP) epoxiconazole (ISO) fulvestrant (ISO) furan (ISO) genistein (ISO) mono(2-ethylhexyl) phthalate (ISO) ozone (ISO) panobinostat (ISO) paracetamol (ISO) phenobarbital (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) rotenone (EXP) SB 431542 (ISO) sodium arsenite (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) Triptolide (ISO) triptonide (ISO) troglitazone (ISO) valproic acid (ISO) vorinostat (ISO)
Insc Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 178,427,360 - 178,534,827 (+) NCBI GRCr8 mRatBN7.2 1 168,993,032 - 169,100,438 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 168,993,032 - 169,100,433 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 177,313,540 - 177,420,920 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 184,499,609 - 184,606,997 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 177,206,376 - 177,313,740 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 184,299,200 - 184,407,487 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 184,299,250 - 184,407,480 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 191,272,625 - 191,380,862 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 172,804,412 - 172,913,667 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 172,938,861 - 173,045,793 (+) NCBI Celera 1 166,826,157 - 166,933,448 (+) NCBI Celera Cytogenetic Map 1 q34 NCBI
INSC Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 15,111,416 - 15,269,676 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 15,112,424 - 15,247,208 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 15,133,970 - 15,268,754 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 15,090,546 - 15,225,330 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 11 15,261,213 - 15,395,928 (+) NCBI Celera Cytogenetic Map 11 p15.2 NCBI HuRef 11 14,817,520 - 14,952,207 (+) NCBI HuRef CHM1_1 11 15,132,981 - 15,268,351 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 15,207,776 - 15,366,083 (+) NCBI T2T-CHM13v2.0
Insc Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 114,342,931 - 114,449,615 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 114,342,929 - 114,449,618 (+) Ensembl GRCm39 Ensembl GRCm38 7 114,743,688 - 114,850,380 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 114,743,694 - 114,850,383 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 121,889,280 - 121,993,894 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 114,583,211 - 114,641,363 (+) NCBI MGSCv36 mm8 Celera 7 114,699,353 - 114,804,111 (+) NCBI Celera Cytogenetic Map 7 F1 NCBI cM Map 7 60.23 NCBI
Insc Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 30,156,327 - 30,283,146 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 30,181,402 - 30,282,279 (+) NCBI ChiLan1.0 ChiLan1.0
INSC Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 17,481,904 - 17,613,908 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 17,407,636 - 17,574,975 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 15,203,357 - 15,335,341 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 14,892,357 - 15,024,344 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 14,892,357 - 15,024,344 (+) Ensembl panpan1.1 panPan2
INSC Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 37,942,334 - 38,063,690 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 37,942,294 - 38,063,146 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 37,447,110 - 37,565,970 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 39,072,642 - 39,160,340 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 39,039,305 - 39,160,039 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 38,058,728 - 38,177,862 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 38,263,829 - 38,382,671 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 38,551,635 - 38,670,419 (+) NCBI UU_Cfam_GSD_1.0
Insc Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 47,528,402 - 47,647,823 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936528 3,562,854 - 3,681,669 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936528 3,562,426 - 3,681,733 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
INSC Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 43,843,568 - 44,015,191 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 43,843,539 - 44,015,266 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 47,050,716 - 47,221,492 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
INSC Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 49,674,580 - 49,807,746 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 49,675,737 - 49,807,208 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 147,170,322 - 147,302,423 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Insc
.
Predicted Target Of
Count of predictions: 41 Count of miRNA genes: 34 Interacting mature miRNAs: 40 Transcripts: ENSRNOT00000030540 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 737974 Bp161 Blood pressure QTL 161 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 164747558 181133855 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634315 Niddm45 Non-insulin dependent diabetes mellitus QTL 45 7.16 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 144267916 172949660 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 61379 Bp44 Blood pressure QTL 44 19.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144267916 174133260 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 2312558 Glom17 Glomerulus QTL 17 3.9 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 166532971 191278129 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1582204 Livw1 Liver weight QTL 1 3.6 0.0003 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 1 155422851 172949803 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 631548 Bp88 Blood pressure QTL 88 5 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 156677124 176484451 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
D9S290
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 1 191,375,224 - 191,375,503 NCBI Rnor5.0 Rnor_5.0 4 37,850,046 - 37,850,387 NCBI Rnor5.0 RGSC_v3.4 4 36,926,808 - 36,927,148 UniSTS RGSC3.4 RGSC_v3.4 1 172,908,037 - 172,908,315 UniSTS RGSC3.4 Celera 4 35,260,183 - 35,260,523 UniSTS Celera 1 166,927,818 - 166,928,096 UniSTS Cytogenetic Map 1 q34 UniSTS
RH137050
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 169,100,148 - 169,100,311 (+) MAPPER mRatBN7.2 Rnor_6.0 1 184,407,196 - 184,407,358 NCBI Rnor6.0 Rnor_5.0 1 191,380,571 - 191,380,733 UniSTS Rnor5.0 RGSC_v3.4 1 172,913,383 - 172,913,545 UniSTS RGSC3.4 Celera 1 166,933,164 - 166,933,326 UniSTS RH 3.4 Map 1 1316.9 UniSTS Cytogenetic Map 1 q34 UniSTS
AU048457
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 169,019,462 - 169,019,683 (+) MAPPER mRatBN7.2 Rnor_6.0 1 184,325,679 - 184,325,899 NCBI Rnor6.0 Rnor_5.0 1 191,299,054 - 191,299,274 UniSTS Rnor5.0 RGSC_v3.4 1 172,830,842 - 172,831,062 UniSTS RGSC3.4 Celera 1 166,852,593 - 166,852,813 UniSTS Cytogenetic Map 1 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
36
113
90
89
59
23
59
6
198
82
93
40
60
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000030540 ⟹ ENSRNOP00000031361
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 168,993,032 - 169,100,433 (+) Ensembl Rnor_6.0 Ensembl 1 184,299,250 - 184,407,480 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000078096 ⟹ ENSRNOP00000074463
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 168,993,032 - 169,099,585 (+) Ensembl Rnor_6.0 Ensembl 1 184,301,493 - 184,407,478 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107702 ⟹ ENSRNOP00000084803
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 168,993,032 - 169,097,701 (+) Ensembl
RefSeq Acc Id:
NM_001106285 ⟹ NP_001099755
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 178,427,423 - 178,534,822 (+) NCBI mRatBN7.2 1 168,993,032 - 169,100,433 (+) NCBI Rnor_6.0 1 184,299,250 - 184,407,480 (+) NCBI Rnor_5.0 1 191,272,625 - 191,380,862 (+) NCBI RGSC_v3.4 1 172,804,412 - 172,913,667 (+) RGD Celera 1 166,826,157 - 166,933,448 (+) RGD
Sequence:
GCAGCCTTAGTCCTGAGCAGCCTTGAGAGTCTGCCCATTGGCCTTTGCTTTGAATCTCAGGCCTTCTCAGGTCCATGGCCCAGAAGGATGGGTGGAGAGAATGAAGCTGCTCACAGGGGCCTCCGTAA
hide sequence
RefSeq Acc Id:
XM_017588972 ⟹ XP_017444461
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 178,429,302 - 178,534,827 (+) NCBI mRatBN7.2 1 168,994,886 - 169,100,438 (+) NCBI Rnor_6.0 1 184,300,867 - 184,407,487 (+) NCBI
Sequence:
CAGAGCTTTTGGGCCTGGACCAGACTTCTGTGGACTTAGCCATCTGACACGGAGCCCAGGGTGA
hide sequence
RefSeq Acc Id:
XM_039106438 ⟹ XP_038962366
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 178,429,301 - 178,534,827 (+) NCBI mRatBN7.2 1 168,994,886 - 169,100,438 (+) NCBI
RefSeq Acc Id:
XM_039106440 ⟹ XP_038962368
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 178,429,300 - 178,534,827 (+) NCBI mRatBN7.2 1 168,994,884 - 169,100,438 (+) NCBI
RefSeq Acc Id:
XM_039106441 ⟹ XP_038962369
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 178,429,811 - 178,514,579 (+) NCBI mRatBN7.2 1 169,012,455 - 169,080,185 (+) NCBI
RefSeq Acc Id:
XM_063285287 ⟹ XP_063141357
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 178,427,360 - 178,534,827 (+) NCBI
RefSeq Acc Id:
XM_063285288 ⟹ XP_063141358
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 178,442,741 - 178,534,827 (+) NCBI
RefSeq Acc Id:
NP_001099755 ⟸ NM_001106285
- UniProtKB:
D3ZFP7 (UniProtKB/TrEMBL), A6I8C1 (UniProtKB/TrEMBL), A6I8C2 (UniProtKB/TrEMBL)
- Sequence:
MRRPPGDGDSTGEGPGNWGLWGAQESRRLCCVGPDRCGQALLQIGMNMMALPGGRHLGSIPLQEQRLHFMQVDSVQRWMEDLKLMTECECMCVLQAKPISLEEDTQSDLILAGGPGPGDPLQLLLKRG
hide sequence
RefSeq Acc Id:
XP_017444461 ⟸ XM_017588972
- Peptide Label:
isoform X2
- UniProtKB:
A6I8C2 (UniProtKB/TrEMBL)
- Sequence:
MNMMALPGGRHLGSIPLQEQRLHFMQVDSVQRWMEDLKLMTECECMCVLQAKPISLEEDTQSDLILAGGPGPGDPLQLLLKRGWVISTELRRIGQKLAQDRWARVHSMSVRLTCHARSMVSEYSTISR
hide sequence
Ensembl Acc Id:
ENSRNOP00000074463 ⟸ ENSRNOT00000078096
Ensembl Acc Id:
ENSRNOP00000031361 ⟸ ENSRNOT00000030540
RefSeq Acc Id:
XP_038962368 ⟸ XM_039106440
- Peptide Label:
isoform X4
- UniProtKB:
A6I8C2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038962366 ⟸ XM_039106438
- Peptide Label:
isoform X3
- UniProtKB:
A6I8C2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038962369 ⟸ XM_039106441
- Peptide Label:
isoform X5
Ensembl Acc Id:
ENSRNOP00000084803 ⟸ ENSRNOT00000107702
RefSeq Acc Id:
XP_063141357 ⟸ XM_063285287
- Peptide Label:
isoform X1
- UniProtKB:
A6I8C2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141358 ⟸ XM_063285288
- Peptide Label:
isoform X2
- UniProtKB:
A6I8C2 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-06-21
Insc
INSC, spindle orientation adaptor protein
Insc
inscuteable homolog (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-27
Insc
inscuteable homolog (Drosophila)
RGD1311379_predicted
hypothetical LOC293166 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
RGD1311379_predicted
hypothetical LOC293166 (predicted)
LOC293166_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC293166_predicted
hypothetical LOC293166 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
