Advanced Search (OLGA)

Gene: TNFAIP1 (TNF alpha induced protein 1) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

TNFAIP1

Name:

TNF alpha induced protein 1

RGD ID:

1346510

HGNC Page

HGNC:11894

Description:

Enables identical protein binding activity and small GTPase binding activity. Contributes to ubiquitin-protein transferase activity. Involved in several processes, including negative regulation of Rho protein signal transduction; proteasome-mediated ubiquitin-dependent protein catabolic process; and stress fiber assembly. Located in endosome. Part of Cul3-RING ubiquitin ligase complex.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

B12; B61; BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2; BTB/POZ domain-containing protein TNFAIP1; BTBD34; EDP1; hBACURD2; MGC2317; tumor necrosis factor, alpha induced protein 1; tumor necrosis factor, alpha-induced protein 1 (endothelial)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Tnfaip1 (tumor necrosis factor, alpha-induced protein 1 (endothelial))	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Tnfaip1 (TNF alpha induced protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Tnfaip1 (TNF alpha induced protein 1)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	TNFAIP1 (TNF alpha induced protein 1)	NCBI	Ortholog
Canis lupus familiaris (dog):	TNFAIP1 (TNF alpha induced protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tnfaip1 (TNF alpha induced protein 1)	NCBI	Ortholog
Sus scrofa (pig):	TNFAIP1 (TNF alpha induced protein 1)	HGNC	EggNOG, Ensembl, Inparanoid, NCBI, OMA, Panther, Treefam
Chlorocebus sabaeus (green monkey):	TNFAIP1 (TNF alpha induced protein 1)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Tnfaip1 (TNF alpha induced protein 1)	NCBI	Ortholog
Other homologs ²
Sus scrofa (pig):	KCTD10 (potassium channel tetramerization domain containing 10)	HGNC	OrthoDB
Rattus norvegicus (Norway rat):	Insc (INSC, spindle orientation adaptor protein)	HGNC	OMA
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Tnfaip1 (TNF alpha induced protein 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tnfaip1 (tumor necrosis factor, alpha-induced protein 1 (endothelial))	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tnfaip1 (tumor necrosis factor, alpha-induced protein 1 (endothelial))	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10465	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	B0281.4	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	B0281.5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	B0281.6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	C17F4.8	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	C40A11.2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	C40A11.3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	C40A11.4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	C40A11.6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	C40A11.7	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	D2045.8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F22E5.11	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	F22E5.6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	F22E5.8	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	K02F6.5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	K02F6.8	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	T05E12.3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	T08G3.13	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	ZC239.14	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	ZC239.15	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ZC239.16	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ZC239.3	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ZC239.4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	ZC239.5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	sdz-35	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ZC239.17	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	K02E7.4	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	tnfaip1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus laevis (African clawed frog):	tnfaip1.L	Alliance	DIOPT (Xenbase)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	28,335,761 - 28,347,009 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	28,335,602 - 28,347,009 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	26,662,787 - 26,674,035 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	23,686,913 - 23,698,160 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	23,686,912 - 23,698,160	NCBI
Celera	17	23,524,290 - 23,535,780 (+)	NCBI		Celera
Cytogenetic Map	17	q11.2	NCBI
HuRef	17	22,870,942 - 22,882,432 (+)	NCBI		HuRef
CHM1_1	17	26,725,440 - 26,736,930 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	29,277,609 - 29,288,860 (+)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TNFAIP1	Human	Diabetic Nephropathies		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:20665664

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TNFAIP1	Human	(+)-schisandrin B	multiple interactions	ISO	Tnfaip1 (Rattus norvegicus)	6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of TNFAIP1 mRNA]	CTD	PMID:31150632
TNFAIP1	Human	(-)-citrinin	increases expression	EXP		6480464	Citrinin results in increased expression of TNFAIP1 mRNA	CTD	PMID:30428381
TNFAIP1	Human	(-)-citrinin	multiple interactions	EXP		6480464	[Citrinin co-treated with ochratoxin A] results in decreased expression of TNFAIP1 mRNA	CTD	PMID:30428381
TNFAIP1	Human	(1->4)-beta-D-glucan	multiple interactions	ISO	Tnfaip1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TNFAIP1 mRNA	CTD	PMID:36331819
TNFAIP1	Human	1,2-dimethylhydrazine	multiple interactions	ISO	Tnfaip1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of TNFAIP1 mRNA	CTD	PMID:22206623
TNFAIP1	Human	17beta-estradiol	multiple interactions	EXP		6480464	[Estradiol co-treated with TGFB1 protein] results in increased expression of TNFAIP1 mRNA	CTD	PMID:30165855
TNFAIP1	Human	1H-pyrazole	increases expression	ISO	Tnfaip1 (Mus musculus)	6480464	pyrazole results in increased expression of TNFAIP1 mRNA	CTD	PMID:17945193
TNFAIP1	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Tnfaip1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of TNFAIP1 mRNA	CTD	PMID:21570461
TNFAIP1	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of TNFAIP1 mRNA	CTD	PMID:33387578
TNFAIP1	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in increased expression of TNFAIP1 mRNA	CTD	PMID:34747641
TNFAIP1	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Tnfaip1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of TNFAIP1 mRNA	CTD	PMID:15034205
TNFAIP1	Human	2,4-dinitrotoluene	affects expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	2 and 4-dinitrotoluene affects the expression of TNFAIP1 mRNA	CTD	PMID:21346803
TNFAIP1	Human	2-methylcholine	affects expression	EXP		6480464	beta-methylcholine affects the expression of TNFAIP1 mRNA	CTD	PMID:21179406
TNFAIP1	Human	4-amino-2,6-dinitrotoluene	affects expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	4-amino-2 and 6-dinitrotoluene affects the expression of TNFAIP1 mRNA	CTD	PMID:21346803
TNFAIP1	Human	4-hydroxyphenyl retinamide	increases expression	ISO	Tnfaip1 (Mus musculus)	6480464	Fenretinide results in increased expression of TNFAIP1 mRNA	CTD	PMID:28973697
TNFAIP1	Human	6-propyl-2-thiouracil	increases expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	Propylthiouracil results in increased expression of TNFAIP1 mRNA	CTD	PMID:30047161
TNFAIP1	Human	acrolein	multiple interactions	EXP		6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TNFAIP1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of TNFAIP1 mRNA	CTD	PMID:32699268
TNFAIP1	Human	all-trans-retinoic acid	increases expression	EXP		6480464	Tretinoin results in increased expression of TNFAIP1 mRNA	CTD	PMID:23724009
TNFAIP1	Human	alpha-pinene	multiple interactions	EXP		6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TNFAIP1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of TNFAIP1 mRNA	CTD	PMID:32699268
TNFAIP1	Human	amitrole	increases expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	Amitrole results in increased expression of TNFAIP1 mRNA	CTD	PMID:30047161
TNFAIP1	Human	benzo[a]pyrene	decreases expression	ISO	Tnfaip1 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of TNFAIP1 mRNA	CTD	PMID:15034205 and PMID:21715664
TNFAIP1	Human	benzo[a]pyrene	decreases methylation	EXP		6480464	Benzo(a)pyrene results in decreased methylation of TNFAIP1 3' UTR	CTD	PMID:27901495
TNFAIP1	Human	beta-lapachone	increases expression	EXP		6480464	beta-lapachone results in increased expression of TNFAIP1 mRNA	CTD	PMID:38218311
TNFAIP1	Human	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	Tnfaip1 (Mus musculus)	6480464	MIR93 inhibits the reaction [Diethylhexyl Phthalate results in increased expression of TNFAIP1 protein] and TNFAIP1 protein affects the reaction [Diethylhexyl Phthalate results in increased ubiquitination of CSNK2B protein]	CTD	PMID:37302538
TNFAIP1	Human	bis(2-ethylhexyl) phthalate	increases expression	ISO	Tnfaip1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of TNFAIP1 mRNA and Diethylhexyl Phthalate results in increased expression of TNFAIP1 protein	CTD	PMID:34319233 and PMID:37302538
TNFAIP1	Human	bisphenol A	increases expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of TNFAIP1 mRNA	CTD	PMID:25181051
TNFAIP1	Human	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TNFAIP1 mRNA	CTD	PMID:29275510
TNFAIP1	Human	cadmium dichloride	increases methylation	ISO	Tnfaip1 (Rattus norvegicus)	6480464	Cadmium Chloride results in increased methylation of TNFAIP1 promoter	CTD	PMID:22457795
TNFAIP1	Human	chlorpyrifos	increases expression	ISO	Tnfaip1 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of TNFAIP1 mRNA	CTD	PMID:37019170
TNFAIP1	Human	clofibric acid	multiple interactions	ISO	Tnfaip1 (Rattus norvegicus)	6480464	[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TNFAIP1 mRNA	CTD	PMID:17602206
TNFAIP1	Human	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of TNFAIP1 mRNA	CTD	PMID:19320972
TNFAIP1	Human	coumestrol	multiple interactions	EXP		6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of TNFAIP1 mRNA	CTD	PMID:19167446
TNFAIP1	Human	cycloheximide	multiple interactions	ISO	Tnfaip1 (Mus musculus)	6480464	TNFAIP1 protein inhibits the reaction [Cycloheximide results in decreased degradation of CSNK2B protein]	CTD	PMID:37302538
TNFAIP1	Human	diazinon	increases methylation	EXP		6480464	Diazinon results in increased methylation of TNFAIP1 gene	CTD	PMID:22964155
TNFAIP1	Human	dibutyl phthalate	increases expression	ISO	Tnfaip1 (Mus musculus)	6480464	Dibutyl Phthalate results in increased expression of TNFAIP1 mRNA	CTD	PMID:21266533
TNFAIP1	Human	Enterolactone	multiple interactions	EXP		6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of TNFAIP1 mRNA	CTD	PMID:19167446
TNFAIP1	Human	fenthion	decreases expression	ISO	Tnfaip1 (Mus musculus)	6480464	Fenthion results in decreased expression of TNFAIP1 mRNA	CTD	PMID:34813904
TNFAIP1	Human	folic acid	multiple interactions	ISO	Tnfaip1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of TNFAIP1 mRNA	CTD	PMID:22206623
TNFAIP1	Human	ketamine	decreases expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	Ketamine results in decreased expression of TNFAIP1 mRNA	CTD	PMID:20080153
TNFAIP1	Human	lipopolysaccharide	increases expression	EXP		6480464	Lipopolysaccharides results in increased expression of TNFAIP1 mRNA	CTD	PMID:31059760
TNFAIP1	Human	lipopolysaccharide	multiple interactions	EXP		6480464	[Acetaminophen co-treated with Lipopolysaccharides] results in increased expression of TNFAIP1 mRNA	CTD	PMID:31059760
TNFAIP1	Human	methimazole	increases expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	Methimazole results in increased expression of TNFAIP1 mRNA	CTD	PMID:30047161
TNFAIP1	Human	N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal	multiple interactions	ISO	Tnfaip1 (Mus musculus)	6480464	benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [TNFAIP1 protein results in increased degradation of CSNK2B protein]	CTD	PMID:37302538
TNFAIP1	Human	N-nitrosodiethylamine	multiple interactions	ISO	Tnfaip1 (Rattus norvegicus)	6480464	[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TNFAIP1 mRNA	CTD	PMID:17602206
TNFAIP1	Human	nickel atom	decreases expression	EXP		6480464	Nickel results in decreased expression of TNFAIP1 mRNA	CTD	PMID:23195993
TNFAIP1	Human	ochratoxin A	multiple interactions	EXP		6480464	[Citrinin co-treated with ochratoxin A] results in decreased expression of TNFAIP1 mRNA	CTD	PMID:30428381
TNFAIP1	Human	ochratoxin A	decreases expression	EXP		6480464	ochratoxin A results in decreased expression of TNFAIP1 mRNA	CTD	PMID:30428381
TNFAIP1	Human	oxaliplatin	multiple interactions	ISO	Tnfaip1 (Rattus norvegicus)	6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of TNFAIP1 mRNA	CTD	PMID:25729387
TNFAIP1	Human	ozone	multiple interactions	EXP		6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TNFAIP1 mRNA more ...	CTD	PMID:32699268
TNFAIP1	Human	p-menthan-3-ol	decreases expression	EXP		6480464	Menthol results in decreased expression of TNFAIP1 mRNA	CTD	PMID:26760959
TNFAIP1	Human	paracetamol	affects expression	ISO	Tnfaip1 (Mus musculus)	6480464	Acetaminophen affects the expression of TNFAIP1 mRNA	CTD	PMID:17562736
TNFAIP1	Human	paracetamol	decreases expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	Acetaminophen results in decreased expression of TNFAIP1 mRNA	CTD	PMID:33387578
TNFAIP1	Human	paracetamol	multiple interactions	EXP		6480464	[Acetaminophen co-treated with Lipopolysaccharides] results in increased expression of TNFAIP1 mRNA	CTD	PMID:31059760
TNFAIP1	Human	paracetamol	affects expression	EXP		6480464	Acetaminophen affects the expression of TNFAIP1 mRNA	CTD	PMID:31059760
TNFAIP1	Human	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of TNFAIP1 mRNA	CTD	PMID:21420995
TNFAIP1	Human	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Tnfaip1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TNFAIP1 mRNA	CTD	PMID:36331819
TNFAIP1	Human	pirinixic acid	decreases expression	ISO	Tnfaip1 (Mus musculus)	6480464	pirinixic acid results in decreased expression of TNFAIP1 mRNA	CTD	PMID:17426115
TNFAIP1	Human	rotenone	decreases expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	Rotenone results in decreased expression of TNFAIP1 mRNA	CTD	PMID:19013527
TNFAIP1	Human	streptozocin	multiple interactions	ISO	Tnfaip1 (Rattus norvegicus)	6480464	[Streptozocin co-treated with Dietary Fats] results in increased expression of TNFAIP1 mRNA	CTD	PMID:20665664
TNFAIP1	Human	sulfadimethoxine	increases expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	Sulfadimethoxine results in increased expression of TNFAIP1 mRNA	CTD	PMID:30047161
TNFAIP1	Human	tetrachloromethane	increases expression	ISO	Tnfaip1 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of TNFAIP1 mRNA	CTD	PMID:27339419 and PMID:31919559
TNFAIP1	Human	tetrachloromethane	multiple interactions	ISO	Tnfaip1 (Rattus norvegicus)	6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of TNFAIP1 mRNA]	CTD	PMID:31150632
TNFAIP1	Human	tetrachloromethane	increases expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	Carbon Tetrachloride results in increased expression of TNFAIP1 mRNA	CTD	PMID:31150632
TNFAIP1	Human	thioacetamide	increases expression	ISO	Tnfaip1 (Rattus norvegicus)	6480464	Thioacetamide results in increased expression of TNFAIP1 mRNA	CTD	PMID:34492290
TNFAIP1	Human	titanium dioxide	decreases methylation	ISO	Tnfaip1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of TNFAIP1 promoter alternative form	CTD	PMID:35295148
TNFAIP1	Human	topotecan	multiple interactions	ISO	Tnfaip1 (Rattus norvegicus)	6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of TNFAIP1 mRNA	CTD	PMID:25729387
TNFAIP1	Human	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of TNFAIP1 mRNA	CTD	PMID:23179753
TNFAIP1	Human	valproic acid	decreases methylation	EXP		6480464	Valproic Acid results in decreased methylation of TNFAIP1 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TNFAIP1	Human	apoptotic process	involved_in	TAS		150520179	PMID:19637314	UniProt	PMID:19637314
TNFAIP1	Human	cell migration	involved_in	IMP		150520179	PMID:19782033	UniProt	PMID:19782033
TNFAIP1	Human	immune response	involved_in	IEP		150520179	PMID:1370465	UniProt	PMID:1370465
TNFAIP1	Human	negative regulation of Rho protein signal transduction	involved_in	IMP		150520179	PMID:19782033	UniProt	PMID:19782033
TNFAIP1	Human	negative regulation of Rho protein signal transduction	involved_in	IBA	MGI:1923739 more ...	150520179		GO_Central	GO_REF:0000033
TNFAIP1	Human	positive regulation of DNA replication		ISO	Tnfaip1 (Rattus norvegicus)	9068941		RGD	PMID:15726626 and REF_RGD_ID:1357162
TNFAIP1	Human	positive regulation of DNA replication	involved_in	IEA	UniProtKB:Q7TNY1 and ensembl:ENSRNOP00000012245	150520179		Ensembl	GO_REF:0000107
TNFAIP1	Human	proteasome-mediated ubiquitin-dependent protein catabolic process	involved_in	IDA		150520179	PMID:19782033	UniProt	PMID:19782033
TNFAIP1	Human	proteasome-mediated ubiquitin-dependent protein catabolic process	involved_in	IBA	PANTHER:PTN000125051 more ...	150520179		GO_Central	GO_REF:0000033
TNFAIP1	Human	protein homooligomerization	involved_in	IEA	InterPro:IPR003131	150520179		InterPro	GO_REF:0000002
TNFAIP1	Human	protein ubiquitination	involved_in	IDA		150520179	PMID:19782033	UniProt	PMID:19782033
TNFAIP1	Human	protein ubiquitination	involved_in	IBA	PANTHER:PTN000125051 more ...	150520179		GO_Central	GO_REF:0000033
TNFAIP1	Human	protein ubiquitination	involved_in	IEA	UniPathway:UPA00143	150520179		UniProt	GO_REF:0000041
TNFAIP1	Human	stress fiber assembly	involved_in	IMP		150520179	PMID:19782033	UniProt	PMID:19782033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TNFAIP1	Human	Cul3-RING ubiquitin ligase complex	part_of	IDA		150520179	PMID:19782033	UniProt	PMID:19782033
TNFAIP1	Human	Cul3-RING ubiquitin ligase complex	part_of	IBA	PANTHER:PTN000125051 more ...	150520179		GO_Central	GO_REF:0000033
TNFAIP1	Human	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	150520179		UniProt	GO_REF:0000044
TNFAIP1	Human	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	150520179		UniProt	GO_REF:0000043
TNFAIP1	Human	cytoplasm	located_in	IDA		150520179	PMID:19637314	UniProt	PMID:19637314
TNFAIP1	Human	cytosol	located_in	TAS		150520179		Reactome	Reactome:R-HSA-9696266 and Reactome:R-HSA-9696268
TNFAIP1	Human	endosome	located_in	IEA	UniProtKB-SubCell:SL-0101	150520179		UniProt	GO_REF:0000044
TNFAIP1	Human	endosome	located_in	IDA		150520179	PMID:19637314	UniProt	PMID:19637314
TNFAIP1	Human	endosome	located_in	IEA	UniProtKB-KW:KW-0967	150520179		UniProt	GO_REF:0000043
TNFAIP1	Human	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	150520179		UniProt	GO_REF:0000043
TNFAIP1	Human	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	150520179		UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TNFAIP1	Human	cyclin binding		ISO	Pcna (Rattus norvegicus)	9068941		RGD	PMID:15726626 and REF_RGD_ID:1357162
TNFAIP1	Human	cyclin binding	enables	IEA	UniProtKB:Q7TNY1 and ensembl:ENSRNOP00000012245	150520179		Ensembl	GO_REF:0000107
TNFAIP1	Human	identical protein binding	enables	IPI	UniProtKB:Q13829	150520179	PMID:25416956 and PMID:32296183	IntAct	PMID:25416956 and PMID:32296183
TNFAIP1	Human	protein binding	enables	IPI	UniProtKB:Q13618 more ...	150520179	PMID:33961781	IntAct	PMID:33961781
TNFAIP1	Human	protein binding	enables	IPI	UniProtKB:Q13618	150520179	PMID:21145461 and PMID:34591642	IntAct	PMID:21145461 and PMID:34591642
TNFAIP1	Human	protein binding	enables	IPI	UniProtKB:P62745	150520179	PMID:19637314	IntAct	PMID:19637314
TNFAIP1	Human	protein binding	enables	IPI	UniProtKB:O15160	150520179	PMID:21988832	IntAct	PMID:21988832
TNFAIP1	Human	protein binding	enables	IPI	UniProtKB:Q8WZ19	150520179	PMID:19615732 and PMID:28514442	IntAct	PMID:19615732 and PMID:28514442
TNFAIP1	Human	protein binding	enables	IPI	UniProtKB:P00441 more ...	150520179	PMID:32814053	IntAct	PMID:32814053
TNFAIP1	Human	protein binding	enables	IPI	UniProtKB:O14929 more ...	150520179	PMID:25416956	IntAct	PMID:25416956
TNFAIP1	Human	protein binding	enables	IPI	UniProtKB:O15160 more ...	150520179	PMID:32296183	IntAct	PMID:32296183
TNFAIP1	Human	small GTPase binding	enables	IDA		150520179	PMID:19637314 and PMID:19782033	UniProt	PMID:19637314 and PMID:19782033
TNFAIP1	Human	ubiquitin-protein transferase activity	contributes_to	IDA		150520179	PMID:19782033	UniProt	PMID:19782033
TNFAIP1	Human	ubiquitin-protein transferase activity	contributes_to	IBA	PANTHER:PTN000125051 more ...	150520179		GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:1370465	PMID:2233719	PMID:2406243	PMID:7536959	PMID:11591653	PMID:11702059	PMID:11704801	PMID:11791643	PMID:11849463	PMID:11929592	PMID:12039524	PMID:12477932
PMID:12600716	PMID:15489334	PMID:16344560	PMID:16565220	PMID:16870576	PMID:18029348	PMID:19196817	PMID:19593659	PMID:19615732	PMID:19637314	PMID:19782033	PMID:19851886
PMID:20158880	PMID:20309963	PMID:21145461	PMID:21516116	PMID:21653829	PMID:21873635	PMID:21988832	PMID:22658674	PMID:22810651	PMID:23455924	PMID:23912453	PMID:24705354
PMID:24969828	PMID:25080503	PMID:25416956	PMID:25814554	PMID:26152285	PMID:26186194	PMID:26261520	PMID:26389662	PMID:26398148	PMID:26496610	PMID:26673895	PMID:27107014
PMID:27229929	PMID:27565346	PMID:28443643	PMID:28514442	PMID:28581483	PMID:28786561	PMID:29228324	PMID:29676528	PMID:30595535	PMID:31391242	PMID:31586073	PMID:31901862
PMID:32296183	PMID:32327643	PMID:32814053	PMID:33128699	PMID:33130828	PMID:33159672	PMID:33909263	PMID:33961781	PMID:34048709	PMID:34591642	PMID:34857952	PMID:35271311
PMID:35563538	PMID:36880596	PMID:37495603	PMID:37788672	PMID:38102610	PMID:38688591

TNFAIP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	28,335,761 - 28,347,009 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	28,335,602 - 28,347,009 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	26,662,787 - 26,674,035 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	23,686,913 - 23,698,160 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	23,686,912 - 23,698,160	NCBI
Celera	17	23,524,290 - 23,535,780 (+)	NCBI		Celera
Cytogenetic Map	17	q11.2	NCBI
HuRef	17	22,870,942 - 22,882,432 (+)	NCBI		HuRef
CHM1_1	17	26,725,440 - 26,736,930 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	29,277,609 - 29,288,860 (+)	NCBI		T2T-CHM13v2.0

Tnfaip1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	78,413,676 - 78,427,122 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	78,413,676 - 78,427,158 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	78,522,850 - 78,536,270 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	78,522,850 - 78,536,332 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	78,336,352 - 78,349,762 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	78,339,043 - 78,352,389 (-)	NCBI		MGSCv36	mm8
Celera	11	88,154,923 - 88,168,333 (-)	NCBI		Celera
Cytogenetic Map	11	B5	NCBI
cM Map	11	46.74	NCBI

Tnfaip1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	63,915,824 - 63,930,514 (-)	NCBI		GRCr8
mRatBN7.2	10	63,417,774 - 63,432,466 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	63,417,775 - 63,432,466 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	68,050,427 - 68,065,093 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	67,555,758 - 67,570,424 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	63,025,275 - 63,039,976 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	65,791,002 - 65,805,693 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	65,791,003 - 65,805,693 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	65,837,922 - 65,853,370 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	64,632,189 - 64,646,879 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	64,647,455 - 64,660,389 (-)	NCBI
Celera	10	62,394,329 - 62,409,019 (-)	NCBI		Celera
Cytogenetic Map	10	q25	NCBI

Tnfaip1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955481	4,786,015 - 4,799,274 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955481	4,786,015 - 4,799,376 (-)	NCBI	ChiLan1.0	ChiLan1.0

TNFAIP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	36,111,643 - 36,122,935 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	37,992,035 - 38,003,328 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	28,427,448 - 28,438,826 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	28,929,788 - 28,941,278 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	28,929,788 - 28,941,278 (-)	Ensembl	panpan1.1		panPan2

TNFAIP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	42,588,009 - 42,597,961 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	42,588,112 - 42,595,596 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	41,744,941 - 41,754,881 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	43,407,163 - 43,417,110 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	43,407,185 - 43,417,107 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	42,191,412 - 42,201,351 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	42,482,639 - 42,492,584 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	42,559,687 - 42,569,626 (+)	NCBI		UU_Cfam_GSD_1.0

Tnfaip1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	41,613,977 - 41,625,942 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936538	4,491,925 - 4,503,645 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936538	4,491,915 - 4,503,887 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TNFAIP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	44,616,916 - 44,629,934 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	44,616,840 - 44,626,330 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	46,529,322 - 46,538,741 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TNFAIP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	22,102,499 - 22,111,739 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	22,102,531 - 22,115,451 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666075	8,014,614 - 8,026,413 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tnfaip1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624786	939,605 - 952,675 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624786	939,619 - 952,698 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in TNFAIP1
26 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 17q11.2(chr17:28283125-28904397)x3	copy number gain	See cases [RCV000136494]	Chr17:28283125..28904397 [GRCh38] Chr17:26610151..27231415 [GRCh37] Chr17:23634278..24255541 [NCBI36] Chr17:17q11.2	benign
GRCh37/hg19 17q11.1-11.2(chr17:25403446-31685464)x3	copy number gain	not provided [RCV000762776]	Chr17:25403446..31685464 [GRCh37] Chr17:17q11.1-11.2	likely pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:526-81041938)	copy number gain	See cases [RCV000511439]	Chr17:526..81041938 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
NM_021137.5(TNFAIP1):c.854C>T (p.Thr285Ile)	single nucleotide variant	not specified [RCV004294948]	Chr17:28344503 [GRCh38] Chr17:26671529 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.781G>A (p.Val261Ile)	single nucleotide variant	not specified [RCV004296523]	Chr17:28344430 [GRCh38] Chr17:26671456 [GRCh37] Chr17:17q11.2	uncertain significance
GRCh37/hg19 17p13.3-q25.3(chr17:526-81041938)x3	copy number gain	See cases [RCV000512441]	Chr17:526..81041938 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17q11.1-11.2(chr17:25248166-30645676)x1	copy number loss	Mitogen-activated protein kinase kinase inhibitor response [RCV000626439]	Chr17:25248166..30645676 [GRCh37] Chr17:17q11.1-11.2	drug response
GRCh37/hg19 17p13.3-q25.3(chr17:8547-81060040)x3	copy number gain	not provided [RCV000739324]	Chr17:8547..81060040 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:7214-81058310)x3	copy number gain	not provided [RCV000739320]	Chr17:7214..81058310 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:12344-81057996)x3	copy number gain	not provided [RCV000739325]	Chr17:12344..81057996 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p11.2-q11.2(chr17:21279289-27474974)x2	copy number gain	not provided [RCV000739439]	Chr17:21279289..27474974 [GRCh37] Chr17:17p11.2-q11.2	likely pathogenic
GRCh37/hg19 17q11.2(chr17:26619789-26723666)x1	copy number loss	not provided [RCV000751972]	Chr17:26619789..26723666 [GRCh37] Chr17:17q11.2	uncertain significance
GRCh37/hg19 17p11.2-q21.2(chr17:21690653-38772647)x3	copy number gain	not provided [RCV000846852]	Chr17:21690653..38772647 [GRCh37] Chr17:17p11.2-q21.2	pathogenic
GRCh37/hg19 17q11.1-11.2(chr17:25274363-28450707)x3	copy number gain	not provided [RCV001006886]	Chr17:25274363..28450707 [GRCh37] Chr17:17q11.1-11.2	pathogenic
GRCh37/hg19 17p11.2-q11.2(chr17:21690653-28281232)	copy number gain	not specified [RCV002052591]	Chr17:21690653..28281232 [GRCh37] Chr17:17p11.2-q11.2	pathogenic
NM_021137.5(TNFAIP1):c.71G>T (p.Gly24Val)	single nucleotide variant	not specified [RCV004164270]	Chr17:28339592 [GRCh38] Chr17:26666618 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.76G>C (p.Gly26Arg)	single nucleotide variant	not specified [RCV004161226]	Chr17:28339597 [GRCh38] Chr17:26666623 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.880C>T (p.Arg294Cys)	single nucleotide variant	not specified [RCV004158511]	Chr17:28344529 [GRCh38] Chr17:26671555 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.118T>C (p.Tyr40His)	single nucleotide variant	not specified [RCV004098802]	Chr17:28339639 [GRCh38] Chr17:26666665 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.946G>A (p.Asp316Asn)	single nucleotide variant	not specified [RCV004178619]	Chr17:28344595 [GRCh38] Chr17:26671621 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.143G>A (p.Arg48His)	single nucleotide variant	not specified [RCV004249911]	Chr17:28339664 [GRCh38] Chr17:26666690 [GRCh37] Chr17:17q11.2	uncertain significance
GRCh37/hg19 17q11.1-11.2(chr17:25263507-27829791)x3	copy number gain	Developmental delay with or without intellectual impairment or behavioral abnormalities [RCV003329553]	Chr17:25263507..27829791 [GRCh37] Chr17:17q11.1-11.2	uncertain significance
NM_021137.5(TNFAIP1):c.618C>T (p.Asp206=)	single nucleotide variant	not provided [RCV003885617]	Chr17:28342346 [GRCh38] Chr17:26669372 [GRCh37] Chr17:17q11.2	benign
NM_021137.5(TNFAIP1):c.278C>A (p.Thr93Asn)	single nucleotide variant	not specified [RCV004473055]	Chr17:28340381 [GRCh38] Chr17:26667407 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.854C>A (p.Thr285Asn)	single nucleotide variant	not specified [RCV004473057]	Chr17:28344503 [GRCh38] Chr17:26671529 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.871C>T (p.Arg291Cys)	single nucleotide variant	not specified [RCV004473058]	Chr17:28344520 [GRCh38] Chr17:26671546 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.535C>G (p.Leu179Val)	single nucleotide variant	not specified [RCV004473056]	Chr17:28342263 [GRCh38] Chr17:26669289 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.872G>A (p.Arg291His)	single nucleotide variant	not specified [RCV004473059]	Chr17:28344521 [GRCh38] Chr17:26671547 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.633G>T (p.Trp211Cys)	single nucleotide variant	not specified [RCV004687001]	Chr17:28342361 [GRCh38] Chr17:26669387 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.607G>A (p.Val203Ile)	single nucleotide variant	not specified [RCV004687000]	Chr17:28342335 [GRCh38] Chr17:26669361 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.421A>T (p.Thr141Ser)	single nucleotide variant	not specified [RCV004680041]	Chr17:28341282 [GRCh38] Chr17:26668308 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.422C>T (p.Thr141Ile)	single nucleotide variant	not specified [RCV004882737]	Chr17:28341283 [GRCh38] Chr17:26668309 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.740A>T (p.Tyr247Phe)	single nucleotide variant	not specified [RCV004882735]	Chr17:28344389 [GRCh38] Chr17:26671415 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.815G>A (p.Arg272His)	single nucleotide variant	not specified [RCV004882736]	Chr17:28344464 [GRCh38] Chr17:26671490 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.394C>G (p.Gln132Glu)	single nucleotide variant	not specified [RCV004882738]	Chr17:28341255 [GRCh38] Chr17:26668281 [GRCh37] Chr17:17q11.2	uncertain significance
NM_021137.5(TNFAIP1):c.878G>A (p.Arg293His)	single nucleotide variant	not specified [RCV004882734]	Chr17:28344527 [GRCh38] Chr17:26671553 [GRCh37] Chr17:17q11.2	uncertain significance

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
MIR372	hsa-miR-372-3p	OncomiRDB	external_info	NA	NA	23242208

Predicted Target Of

	Summary Value
Count of predictions:	2796
Count of miRNA genes:	1016
Interacting mature miRNAs:	1257
Transcripts:	ENST00000226225, ENST00000544907, ENST00000577535, ENST00000578158, ENST00000582302, ENST00000583213
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597122068	GWAS1218142_H	blood protein measurement QTL GWAS1218142 (human)		3e-14	blood protein amount (VT:0005416)	blood protein measurement (CMO:0000028)	17	28337780	28337781	Human
597302713	GWAS1398787_H	level of protein phosphatase 1G in blood serum QTL GWAS1398787 (human)		1e-17	level of protein phosphatase 1G in blood serum		17	28344170	28344171	Human
597304178	GWAS1400252_H	level of mRNA-capping enzyme in blood serum QTL GWAS1400252 (human)		4e-12	level of mRNA-capping enzyme in blood serum		17	28344170	28344171	Human
597302323	GWAS1398397_H	level of major intrinsically disordered Notch2-binding receptor 1 in blood serum QTL GWAS1398397 (human)		2e-23	level of major intrinsically disordered Notch2-binding receptor 1 in blood serum		17	28343601	28343602	Human
597273619	GWAS1369693_H	vitronectin measurement QTL GWAS1369693 (human)		2e-11	vitronectin measurement		17	28340075	28340076	Human
597122493	GWAS1218567_H	blood protein measurement QTL GWAS1218567 (human)		8e-13	blood protein amount (VT:0005416)	blood protein measurement (CMO:0000028)	17	28343601	28343602	Human
597119749	GWAS1215823_H	blood protein measurement QTL GWAS1215823 (human)		4e-29	blood protein amount (VT:0005416)	blood protein measurement (CMO:0000028)	17	28344170	28344171	Human
1298406	BP16_H	Blood pressure QTL 16 (human)		0.0004	Blood pressure	hypertension susceptibility	17	14778647	40778647	Human
597262892	GWAS1358966_H	low density lipoprotein cholesterol measurement QTL GWAS1358966 (human)		6e-09	low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	17	28337189	28337190	Human
597123618	GWAS1219692_H	blood protein measurement QTL GWAS1219692 (human)		4e-12	blood protein amount (VT:0005416)	blood protein measurement (CMO:0000028)	17	28338622	28338623	Human
597303693	GWAS1399767_H	level of MAP6 domain-containing protein 1 in blood serum QTL GWAS1399767 (human)		2e-12	level of MAP6 domain-containing protein 1 in blood serum		17	28343601	28343602	Human
597302755	GWAS1398829_H	protein measurement QTL GWAS1398829 (human)		6e-13	protein measurement		17	28343601	28343602	Human
597119374	GWAS1215448_H	blood protein measurement QTL GWAS1215448 (human)		2e-16	blood protein amount (VT:0005416)	blood protein measurement (CMO:0000028)	17	28344170	28344171	Human
597263138	GWAS1359212_H	growth/differentiation factor 5 measurement QTL GWAS1359212 (human)		7e-34	growth/differentiation factor 5 measurement		17	28343601	28343602	Human
597301537	GWAS1397611_H	cadherin-12 measurement QTL GWAS1397611 (human)		5e-16	cadherin-12 measurement		17	28343601	28343602	Human
597122571	GWAS1218645_H	blood protein measurement QTL GWAS1218645 (human)		1e-15	blood protein amount (VT:0005416)	blood protein measurement (CMO:0000028)	17	28343601	28343602	Human
597304230	GWAS1400304_H	protein lin-7 homolog B measurement QTL GWAS1400304 (human)		4e-13	protein lin-7 homolog B measurement		17	28344170	28344171	Human
597071851	GWAS1167925_H	low density lipoprotein cholesterol measurement QTL GWAS1167925 (human)		2e-09	low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	17	28337189	28337190	Human
597194535	GWAS1290609_H	body mass index QTL GWAS1290609 (human)		3e-08	body mass index	body mass index (BMI) (CMO:0000105)	17	28340200	28340201	Human

RH64867

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	26,672,142 - 26,672,284	UniSTS	GRCh37
Build 36	17	23,696,269 - 23,696,411	RGD	NCBI36
Celera	17	23,533,886 - 23,534,028	RGD
Cytogenetic Map	17	q22-q23	UniSTS
HuRef	17	22,880,538 - 22,880,680	UniSTS

RH64911

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	26,674,287 - 26,674,471	UniSTS	GRCh37
Build 36	17	23,698,414 - 23,698,598	RGD	NCBI36
Celera	17	23,536,032 - 23,536,216	RGD
Cytogenetic Map	17	q11.2	UniSTS
Cytogenetic Map	17	q22-q23	UniSTS
HuRef	17	22,882,684 - 22,882,868	UniSTS

SHGC-31509

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	26,671,631 - 26,671,846	UniSTS	GRCh37
Build 36	17	23,695,758 - 23,695,973	RGD	NCBI36
Celera	17	23,533,374 - 23,533,589	RGD
Cytogenetic Map	17	q22-q23	UniSTS
HuRef	17	22,880,026 - 22,880,241	UniSTS
Stanford-G3 RH Map	17	1029.0	UniSTS
GeneMap99-G3 RH Map	17	1530.0	UniSTS

TNFAIP1__5106

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	26,671,423 - 26,672,329	UniSTS	GRCh37
Build 36	17	23,695,550 - 23,696,456	RGD	NCBI36
Celera	17	23,533,166 - 23,534,073	RGD
HuRef	17	22,879,818 - 22,880,725	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2439	2788	2253	4974	1726	2351	6	624	1951	465	2270	7306	6472	53	3734	1	852	1744	1617	175	1


RefSeq Transcripts	NM_021137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017024993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054317033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC002094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK300584	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK312387	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY065346	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC001643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC001949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC003694	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BT020121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR456819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DB093553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M80783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MZ292543	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000226225 ⟹ ENSP00000226225

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	28,335,761 - 28,347,009 (+)	Ensembl

Ensembl Acc Id:

ENST00000544907 ⟹ ENSP00000440749

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	28,335,602 - 28,345,255 (+)	Ensembl

Ensembl Acc Id:

ENST00000577535 ⟹ ENSP00000466301

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	28,340,406 - 28,342,512 (+)	Ensembl

Ensembl Acc Id:

ENST00000578158 ⟹ ENSP00000464637

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	28,335,653 - 28,340,425 (+)	Ensembl

Ensembl Acc Id:

ENST00000582302 ⟹ ENSP00000464515

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	28,336,467 - 28,340,478 (+)	Ensembl

Ensembl Acc Id:

ENST00000583213

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	28,335,761 - 28,344,510 (+)	Ensembl

RefSeq Acc Id:

NM_021137 ⟹ NP_066960

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	28,335,761 - 28,347,009 (+)	NCBI
GRCh37	17	26,662,548 - 26,674,035 (+)	ENTREZGENE
Build 36	17	23,686,913 - 23,698,160 (+)	NCBI Archive
HuRef	17	22,870,942 - 22,882,432 (+)	ENTREZGENE
CHM1_1	17	26,725,440 - 26,736,930 (+)	NCBI
T2T-CHM13v2.0	17	29,277,609 - 29,288,860 (+)	NCBI

Sequence:

show sequence

ACAGCTTGGGACTGCTGAGGGGCAGGCGGCTGCAGGCTAGGGGCGGCTCGGAGTCCGCTGGCCACCCAGCTGAGAGGAGAGGCGCCCCCGGGGACGCACTGAGATTATGAGGCTCTGGCCTCCACTGG
CCACTCACTCGTGACCCTTTCCACCACGGCGGAGCCTTCCAAGCCTACCTCCTGCCGTGTGGTGATCTACCTGCAGCGGGAGATGTCGGGGGACACCTGCCTGTGCCCAGCCTCAGGGGCCAAGCCCA
AGCTCAGTGGCTTCAAGGGAGGAGGGTTGGGCAACAAGTATGTCCAGCTCAACGTGGGCGGCTCTCTGTACTACACCACTGTGCGGGCCCTGACCCGCCACGACACCATGCTCAAGGCCATGTTCAGT
GGGCGCATGGAGGTGCTGACCGACAAAGAAGGCTGGATCCTCATAGACCGTTGTGGAAAGCACTTTGGCACCATTTTGAATTACCTCCGAGATGACACCATCACCCTCCCTCAGAACCGGCAAGAAAT
CAAGGAATTGATGGCTGAAGCAAAGTATTACCTCATCCAGGGGCTGGTGAATATGTGCCAGAGTGCCCTGCAGGACAAGAAGGACTCCTACCAGCCTGTGTGCAACATCCCCATCATCACATCCCTAA
AGGAGGAGGAGCGGCTCATCGAATCCTCCACCAAGCCCGTGGTGAAGCTGCTGTACAACAGAAGCAACAACAAGTATTCCTACACCAGCAACTCTGACGACCACCTGCTGAAAAACATCGAGCTGTTT
GACAAGCTCTCCCTGCGCTTCAACGGCCGCGTGCTCTTCATCAAGGATGTCATTGGTGACGAGATCTGCTGCTGGTCCTTTTATGGCCAGGGCCGTAAGCTGGCAGAGGTGTGCTGTACCTCCATCGT
GTATGCCACGGAGAAGAAGCAGACCAAGGTGGAATTCCCAGAGGCCCGAATCTATGAGGAGACACTCAACGTCCTACTCTATGAGACTCCCCGCGTCCCCGACAACTCCTTGTTGGAGGCCACAAGCC
GTAGCCGCAGCCAGGCTTCCCCCAGTGAAGATGAGGAGACCTTTGAACTGCGGGACCGTGTCCGCCGCATCCACGTCAAGCGCTACAGCACTTACGATGACCGGCAGCTCGGCCACCAGTCTACCCAT
CGCGACTGACCAGACCCTCAGGGAGTCAGGGCACGGGAGGCCCTATCTCCCATCCTGTGGAACCCGCCCCATTGGCCACCCCATGCTGCTGCTGCCTGGGTCTCTGCTCTAGCACCCAGAGGCATGAC
AGGCCCTGCTCAGAGGTCAGAGGGTCTGGGCAGAGGAGGGACCACATTCCCCTGCCTTGCCCCTGAGCACTTCTGGAGACTGCGTCCTGTCCTATCTGCTCACCATCACCCTTCCTGCCCGACGGAGC
TGCTTCTGCTCCCTGGGGCATATGGACTGACCCACCTCCTGCTGAGAACCTTCCCCTAGGCCCTGTGCAGAAGGCTACTGCCCCTTAGGCCTCAGCTGGGGGAAAGGCAGTTCTGGTGCTGTAGAGGC
CCTGGTGCAGAAAGTGGGACGTCTTTTTTCCTAAGGTGTTTAAGCACAGGCTTGATAAGTTTGGTTTTTAAAAAATAATCTAGGAAATGAATAATTCTAAATCTAGTAATGAGGAAACTGAGCATTTC
TTTTGCCCTCCAGGGTGCCAAGACCCTACATATGACAGAACCCTTGGCCCTTCTCCATGCCTGTGGGATCTGTTTCTTTAAAGCACTTTGTACTGTTATTCAGGAGGTTGATAATCTCCTTGACCCAT
GTCTTTCTACCCTAATCCCCACTTCCCTGCAGAATCAATCTGAGGGAGGGGATAAAGAGGAAGCAATAAAAAAAAAACATCCGACAGAGCAGCTCTGGCTTTGCAGCCTGGCCAGCAGCTCAGAGTGC
ACCGAGGAGGGAAGGATGGCTAAGCTGGGACCGGCAGTCCTCACAGGGTGCCTGTGAGAAAGGACATTTTACCCCCACATCATAGTCACATCACTGACTCCTAGGTCTAGCACGACTGCTCTTTGTGA
TTCTCTTGAGTACCCTTGGCTTCCAGCCATGCTGTCCTCACATACGGTAAAGCCAAAGAGCTGTCACATGGGCCAGAAACATGAGCCACGGCAGGAAGACCGTGGAGCCCGTGGGCACTGCATGGTGT
TGGCTGGCATGCCCATCAGCTGAGGACAGCAAACTCCCAGCAGCCCCTACAGAGGTGGCACATGCTTGGCCACACATCTACTCCCTGCCCACACCATCTATGCTCTTGGTTGGTGCTGGCTGGGATGG
CGGTTCTGCCCAGTGGTGTCTCTGAGCGCGGGATGACAGGAGCAACCGAAGCACCCTGAAGGCCTTCACTCCTTGTTGGGTAACTCAGCCATGGAGATGCCAAGCACTAGCCAGGAGGTGAGTTCCTC
TTTAGGGCTTTGGTTTTCATTCCTTTTTGTTTGGCTTGGCCAAACCAGAATTCAGCTTATCTGAATTATTTTCCAAAGGAATGCTGTCAGGGAGGGACTGTTCTGCCAGCCTAACAAAGCAACGTAGC
CACGTATAGTACCCACTTTCTGCTCTTTGGAGAGAACACAGGTTATCAAGTTCATCTCTCTTGACTACTCTTATGATAGCTGATGCCACAGAGCCTATGGGCAAATGCCAGACCCAGGGTTAGACACA
AGGACCTGAAGTGACATGACGGCGGGACAGGGGAAATGTGACTTTCTAATTAGGCATTTTATGTTAGTCACAGTCTTGAATGTATAAACAGCACTAAGACTCTCAGGTCAGGTACCTTGGTGATCAGC
TACTAGTTCTTCCAGCCCTCATTGAGGTAACAAGATAAAGACAAATCCACTTCTTTGGCCAAATTCAGGCTTTGGCTTTATGACTTTCCCACAGAGACTGGAATGCGTCAGCCTGAGACCACTGGCCT
ATTTTCTCAGCTGCCCTCTTGAGGTCCTTTAACACTCAAATTCCCAGCTCCCCACTGAGGTGTTGTGATGCTTGCCTTTTGACCTCCCCATCCCCTTTAGTCCCTGCTTACTACTTTGACATTCACAT
CCTCAGTGTCTCAGTCTTTTTTGCCGAGAAAGCACAGTAGTCTGGGACTGGGCATTTATCTTCTCTGACTGAAAATCTCTCCTTGGTCTTAAGGAAAATACTAACATTGAACTCACTGACATGATCTT
AGCTTCTTTAATCAGACTTTGTGACTTAAAAGTTTGGGGGTTTTCTTTGAAAGTTTCCAGCCCTATTCAGAAAGCAACTCTTGGCTGTGTGCATTTTTCAACTCCAAGCAGCCCAGGGGTAAGTAAAC
AAAGTATGGATGAAGGTCAGATTTTCTTGTCAGTTTCTGAGAAACCTGGCAGCCTGCTGTTAACAACACAGGCCAGTATTGGGTTTTATTGAATTTGGTATGTGACCAAGGTCGGCCTAAAGGATGGC
GCAGGTCCTGGGCAGGAAAGAATTTTTCCTTTATCACATAACTGTAATATTTGGTTGCTCAGCATAAGTGATGGAAGCAAACACTAATTTCTAATAAAATTGTGTTAAACTCAA

hide sequence

RefSeq Acc Id:

XM_017024993 ⟹ XP_016880482

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	28,335,761 - 28,347,009 (+)	NCBI

Sequence:

show sequence

ATGCATGCAGGGACTTGTAGTCTCAGGCTCCCCAGCCGGCTGGGCTGGGCAGCACTCCGGGCGGAGTCGACGAGCGCAGGATGTGAGCTCACAGCTTGGGACTGCTGAGGGGCAGGCGGCTGCAGGCT
AGGGGCGGCTCGGAGTCCGCTGGCCACCCAGCTGAGAGGAGAGGCGCCCCCGGGGACGCACTGAGATTATGAGGCTCTGGCCTCCACTGGCCACTCACTCGTGACCCTTTCCACCACGGCGGAGCCTT
CCAAGCCTACCTCCTGCCGTGTGGTGATCTACCTGCAGCGGGAGATGTCGGGGGACACCTGCCTGTGCCCAGCCTCAGGGGCCAAGCCCAAGCTCAGTGGCTTCAAGGGAGGAGGGTTGGGCAACAAG
TATGTCCAGCTCAACGTGGGCGGCTCTCTGTACTACACCACTGTGCGGGCCCTGACCCGCCACGACACCATGCTCAAGGCCATGTTCAGTGGGCGCATGGAGGTGCTGACCGACAAAGAAGGCTGGAT
CCTCATAGACCGTTGTGGAAAGCACTTTGGCACCATTTTGAATTACCTCCGAGATGACACCATCACCCTCCCTCAGAACCGGCAAGAAATCAAGGAATTGATGGCTGAAGCAAAGTATTACCTCATCC
AGGGGCTGGTGAATATGTGCCAGAGTGCCCTGCAGGACAAGAAGGACTCCTACCAGCCTGTGTGCAACATCCCCATCATCACATCCCTAAAGGAGGAGGAGCGGCTCATCGAATCCTCCACCAAGCCC
GTGGTGAAGCTGCTGTACAACAGAAGCAACAACAAGTATTCCTACACCAGCAACTCTGACGACCACCTGCTGAAAAACATCGAGCTGTTTGACAAGCTCTCCCTGCGCTTCAACGGCCGCGTGCTCTT
CATCAAGGATGTCATTGGTGACGAGATCTGCTGCTGGTCCTTTTATGGCCAGGGCCGTAAGCTGGCAGAGGTGTGCTGTACCTCCATCGTGTATGCCACGGAGAAGAAGCAGACCAAGGTGTGGGGGA
TTGCCCCTGCCTGGGTAGGGGAGGACACACACCCACTGTGCGGGGGACGTGGTCGGGCTGTGACCAGCACGGAGCAAAAGGGGCATGGACTTGGCTCTTTTTTCCAAACACGGTGGAATTCCCAGAGG
CCCGAATCTATGAGGAGACACTCAACGTCCTACTCTATGAGACTCCCCGCGTCCCCGACAACTCCTTGTTGGAGGCCACAAGCCGTAGCCGCAGCCAGGCTTCCCCCAGTGAAGATGAGGAGACCTTT
GAACTGCGGGACCGTGTCCGCCGCATCCACGTCAAGCGCTACAGCACTTACGATGACCGGCAGCTCGGCCACCAGTCTACCCATCGCGACTGACCAGACCCTCAGGGAGTCAGGGCACGGGAGGCCCT
ATCTCCCATCCTGTGGAACCCGCCCCATTGGCCACCCCATGCTGCTGCTGCCTGGGTCTCTGCTCTAGCACCCAGAGGCATGACAGGCCCTGCTCAGAGGTCAGAGGGTCTGGGCAGAGGAGGGACCA
CATTCCCCTGCCTTGCCCCTGAGCACTTCTGGAGACTGCGTCCTGTCCTATCTGCTCACCATCACCCTTCCTGCCCGACGGAGCTGCTTCTGCTCCCTGGGGCATATGGACTGACCCACCTCCTGCTG
AGAACCTTCCCCTAGGCCCTGTGCAGAAGGCTACTGCCCCTTAGGCCTCAGCTGGGGGAAAGGCAGTTCTGGTGCTGTAGAGGCCCTGGTGCAGAAAGTGGGACGTCTTTTTTCCTAAGGTGTTTAAG
CACAGGCTTGATAAGTTTGGTTTTTAAAAAATAATCTAGGAAATGAATAATTCTAAATCTAGTAATGAGGAAACTGAGCATTTCTTTTGCCCTCCAGGGTGCCAAGACCCTACATATGACAGAACCCT
TGGCCCTTCTCCATGCCTGTGGGATCTGTTTCTTTAAAGCACTTTGTACTGTTATTCAGGAGGTTGATAATCTCCTTGACCCATGTCTTTCTACCCTAATCCCCACTTCCCTGCAGAATCAATCTGAG
GGAGGGGATAAAGAGGAAGCAATAAAAAAAAAACATCCGACAGAGCAGCTCTGGCTTTGCAGCCTGGCCAGCAGCTCAGAGTGCACCGAGGAGGGAAGGATGGCTAAGCTGGGACCGGCAGTCCTCAC
AGGGTGCCTGTGAGAAAGGACATTTTACCCCCACATCATAGTCACATCACTGACTCCTAGGTCTAGCACGACTGCTCTTTGTGATTCTCTTGAGTACCCTTGGCTTCCAGCCATGCTGTCCTCACATA
CGGTAAAGCCAAAGAGCTGTCACATGGGCCAGAAACATGAGCCACGGCAGGAAGACCGTGGAGCCCGTGGGCACTGCATGGTGTTGGCTGGCATGCCCATCAGCTGAGGACAGCAAACTCCCAGCAGC
CCCTACAGAGGTGGCACATGCTTGGCCACACATCTACTCCCTGCCCACACCATCTATGCTCTTGGTTGGTGCTGGCTGGGATGGCGGTTCTGCCCAGTGGTGTCTCTGAGCGCGGGATGACAGGAGCA
ACCGAAGCACCCTGAAGGCCTTCACTCCTTGTTGGGTAACTCAGCCATGGAGATGCCAAGCACTAGCCAGGAGGTGAGTTCCTCTTTAGGGCTTTGGTTTTCATTCCTTTTTGTTTGGCTTGGCCAAA
CCAGAATTCAGCTTATCTGAATTATTTTCCAAAGGAATGCTGTCAGGGAGGGACTGTTCTGCCAGCCTAACAAAGCAACGTAGCCACGTATAGTACCCACTTTCTGCTCTTTGGAGAGAACACAGGTT
ATCAAGTTCATCTCTCTTGACTACTCTTATGATAGCTGATGCCACAGAGCCTATGGGCAAATGCCAGACCCAGGGTTAGACACAAGGACCTGAAGTGACATGACGGCGGGACAGGGGAAATGTGACTT
TCTAATTAGGCATTTTATGTTAGTCACAGTCTTGAATGTATAAACAGCACTAAGACTCTCAGGTCAGGTACCTTGGTGATCAGCTACTAGTTCTTCCAGCCCTCATTGAGGTAACAAGATAAAGACAA
ATCCACTTCTTTGGCCAAATTCAGGCTTTGGCTTTATGACTTTCCCACAGAGACTGGAATGCGTCAGCCTGAGACCACTGGCCTATTTTCTCAGCTGCCCTCTTGAGGTCCTTTAACACTCAAATTCC
CAGCTCCCCACTGAGGTGTTGTGATGCTTGCCTTTTGACCTCCCCATCCCCTTTAGTCCCTGCTTACTACTTTGACATTCACATCCTCAGTGTCTCAGTCTTTTTTGCCGAGAAAGCACAGTAGTCTG
GGACTGGGCATTTATCTTCTCTGACTGAAAATCTCTCCTTGGTCTTAAGGAAAATACTAACATTGAACTCACTGACATGATCTTAGCTTCTTTAATCAGACTTTGTGACTTAAAAGTTTGGGGGTTTT
CTTTGAAAGTTTCCAGCCCTATTCAGAAAGCAACTCTTGGCTGTGTGCATTTTTCAACTCCAAGCAGCCCAGGGGTAAGTAAACAAAGTATGGATGAAGGTCAGATTTTCTTGTCAGTTTCTGAGAAA
CCTGGCAGCCTGCTGTTAACAACACAGGCCAGTATTGGGTTTTATTGAATTTGGTATGTGACCAAGGTCGGCCTAAAGGATGGCGCAGGTCCTGGGCAGGAAAGAATTTTTCCTTTATCACATAACTG
TAATATTTGGTTGCTCAGCATAAGTGATGGAAGCAAACACTAATTTCTAATAAAATTGTGTTAAACTCAA

hide sequence

RefSeq Acc Id:

XM_054317033 ⟹ XP_054173008

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	17	29,277,609 - 29,288,860 (+)	NCBI


Protein RefSeqs	NP_066960	(Get FASTA)	NCBI Sequence Viewer
	XP_016880482	(Get FASTA)	NCBI Sequence Viewer
	XP_054173008	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA58385	(Get FASTA)	NCBI Sequence Viewer
	AAH01643	(Get FASTA)	NCBI Sequence Viewer
	AAH01949	(Get FASTA)	NCBI Sequence Viewer
	AAL38649	(Get FASTA)	NCBI Sequence Viewer
	AAV38924	(Get FASTA)	NCBI Sequence Viewer
	BAG35304	(Get FASTA)	NCBI Sequence Viewer
	BAH13310	(Get FASTA)	NCBI Sequence Viewer
	CAG33100	(Get FASTA)	NCBI Sequence Viewer
	EAW51077	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000226225
	ENSP00000226225.2
	ENSP00000440749.2
GenBank Protein	Q13829	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_066960 ⟸ NM_021137

- UniProtKB:

B7Z6M4 (UniProtKB/Swiss-Prot), Q5TZQ1 (UniProtKB/Swiss-Prot), Q13829 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSGDTCLCPASGAKPKLSGFKGGGLGNKYVQLNVGGSLYYTTVRALTRHDTMLKAMFSGRMEVLTDKEGWILIDRCGKHFGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKK
DSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYSYTSNSDDHLLKNIELFDKLSLRFNGRVLFIKDVIGDEICCWSFYGQGRKLAEVCCTSIVYATEKKQTKVEFPEARIYEETLNVLLY
ETPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD

hide sequence

RefSeq Acc Id:

XP_016880482 ⟸ XM_017024993

- Peptide Label:

isoform X1

- Sequence:

show sequence

MSGDTCLCPASGAKPKLSGFKGGGLGNKYVQLNVGGSLYYTTVRALTRHDTMLKAMFSGRMEVL
TDKEGWILIDRCGKHFGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYSYTSNSDDHLLKNIELFDKLSLR
FNGRVLFIKDVIGDEICCWSFYGQGRKLAEVCCTSIVYATEKKQTKVWGIAPAWVGEDTHPLCGGRGRAVTSTEQKGHGLGSFFQTRWNSQRPESMRRHSTSYSMRLPASPTTPCWRPQAVAAARLPP
VKMRRPLNCGTVSAASTSSATALTMTGSSATSLPIATDQTLRESGHGRPYLPSCGTRPIGHPMLLLPGSLL

hide sequence

Ensembl Acc Id:

ENSP00000464515 ⟸ ENST00000582302

Ensembl Acc Id:

ENSP00000440749 ⟸ ENST00000544907

Ensembl Acc Id:

ENSP00000466301 ⟸ ENST00000577535

Protein Domains

BTB

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q13829-F1-model_v2	AlphaFold	Q13829	1-316	view protein structure

RGD ID:

6794638

Promoter ID:

HG_KWN:25537

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

K562

Transcripts:

NM_174887, OTTHUMT00000255681, UC002HAV.1, UC002HAW.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	17	23,686,641 - 23,687,141 (+)	MPROMDB

RGD ID:

6853318

Promoter ID:

EP74484

Type:

initiation region

Name:

HS_TNFAIP1

Description:

Tumor necrosis factor, alpha-induced protein 1 (endothelial).

SO ACC ID:

SO:0000170

Source:

EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Mammalian gene collection (MGC) full-length cDNA cloning

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	17	23,686,942 - 23,687,002	EPD

RGD ID:

7234343

Promoter ID:

EPDNEW_H22917

Type:

initiation region

Name:

TNFAIP1_2

Description:

TNF alpha induced protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H22918

Experiment Methods:

Single-end sequencing.; Paired-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	28,335,573 - 28,335,633	EPDNEW

RGD ID:

7234345

Promoter ID:

EPDNEW_H22918

Type:

initiation region

Name:

TNFAIP1_1

Description:

TNF alpha induced protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H22917

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	28,335,761 - 28,335,821	EPDNEW

Database	Acc Id	Source(s)
COSMIC	TNFAIP1	COSMIC
Ensembl Genes	ENSG00000109079	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000226225	ENTREZGENE
	ENST00000226225.7	UniProtKB/Swiss-Prot
	ENST00000544907.6	UniProtKB/Swiss-Prot
Gene3D-CATH	Potassium Channel Kv1.1, Chain A	UniProtKB/Swiss-Prot
GTEx	ENSG00000109079	GTEx
HGNC ID	HGNC:11894	ENTREZGENE
Human Proteome Map	TNFAIP1	Human Proteome Map
InterPro	BACURD1-3	UniProtKB/Swiss-Prot
	BTB/POZ_dom	UniProtKB/Swiss-Prot
	SKP1/BTB/POZ_sf	UniProtKB/Swiss-Prot
	T1-type_BTB	UniProtKB/Swiss-Prot
KEGG Report	hsa:7126	UniProtKB/Swiss-Prot
NCBI Gene	7126	ENTREZGENE
OMIM	191161	OMIM
PANTHER	BTB/POZ DOMAIN-CONTAINING ADAPTER FOR CUL3-MEDIATED RHOA DEGRADATION PROTEIN 2	UniProtKB/Swiss-Prot
	PTHR11145	UniProtKB/Swiss-Prot
Pfam	BTB_2	UniProtKB/Swiss-Prot
PharmGKB	PA36591	PharmGKB
PROSITE	BTB	UniProtKB/Swiss-Prot
SMART	BTB	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54695	UniProtKB/Swiss-Prot
UniProt	B7Z6M4	ENTREZGENE
	BACD2_HUMAN	UniProtKB/Swiss-Prot
	J3QS43_HUMAN	UniProtKB/TrEMBL
	J3QSD4_HUMAN	UniProtKB/TrEMBL
	K7EM01_HUMAN	UniProtKB/TrEMBL
	Q13829	ENTREZGENE
	Q5TZQ1	ENTREZGENE
UniProt Secondary	B7Z6M4	UniProtKB/Swiss-Prot
	Q5TZQ1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-01	TNFAIP1	TNF alpha induced protein 1	TNFAIP1	tumor necrosis factor, alpha induced protein 1	Symbol and/or name change	5135510	APPROVED
2015-11-24	TNFAIP1	tumor necrosis factor, alpha induced protein 1	TNFAIP1	tumor necrosis factor, alpha-induced protein 1 (endothelial)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - CTD