Symbol:
Snf8
Name:
SNF8 subunit of ESCRT-II
RGD ID:
1310144
Description:
Predicted to enable channel regulator activity; lipid binding activity; and protein homodimerization activity. Predicted to be involved in several processes, including endosomal transport; multivesicular body assembly; and positive regulation of macromolecule metabolic process. Predicted to act upstream of or within regulation of transcription by RNA polymerase II. Predicted to be located in several cellular components, including endosome; nucleoplasm; and perinuclear region of cytoplasm. Predicted to be part of ESCRT II complex and transcription regulator complex. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy. Orthologous to human SNF8 (SNF8 subunit of ESCRT-II); PARTICIPATES IN autophagy pathway; endocytosis pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
D11moh34; EAP30 subunit of ELL complex; ELL-associated protein of 30 kDa; ESCRT-II complex subunit VPS22; LOC287645; MGC105799; RGD1310144; similar to EAP30 subunit of ELL complex; SNF8, ESCRT-II complex subunit; SNF8, ESCRT-II complex subunit, homolog; SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae); vacuolar-sorting protein SNF8
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SNF8 (SNF8 subunit of ESCRT-II) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Snf8 (SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Snf8 (SNF8 subunit of ESCRT-II) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SNF8 (SNF8 subunit of ESCRT-II) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SNF8 (SNF8 subunit of ESCRT-II) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Snf8 (SNF8 subunit of ESCRT-II) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SNF8 (SNF8 subunit of ESCRT-II) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SNF8 (SNF8 subunit of ESCRT-II) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Snf8 (SNF8 subunit of ESCRT-II) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SNF8 (SNF8 subunit of ESCRT-II)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Snf8 (SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
snf8 (SNF8 subunit of ESCRT-II)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SNF8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
lsn
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
vps-22
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
snf8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 81,481,054 - 81,493,430 (+) NCBI GRCr8 mRatBN7.2 10 80,984,337 - 80,996,724 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 80,984,363 - 80,996,734 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 85,932,673 - 85,944,874 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 85,430,709 - 85,442,910 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 80,823,176 - 80,835,608 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 83,856,331 - 83,868,621 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 83,856,280 - 83,868,598 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 83,661,434 - 83,673,490 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 84,749,033 - 84,761,230 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 84,763,402 - 84,775,600 (+) NCBI Celera 10 79,752,499 - 79,764,696 (+) NCBI Celera Cytogenetic Map 10 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Snf8 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1621568 6480464 1,2-Dimethylhydrazine results in increased expression of SNF8 mRNA CTD PMID:22206623 Snf8 Rat 14-Deoxy-11,12-didehydroandrographolide decreases expression ISO RGD:1604833 6480464 14-deoxy-11,12-didehydroandrographolide results in decreased expression of SNF8 mRNA CTD PMID:22101062 Snf8 Rat 17alpha-ethynylestradiol affects expression ISO RGD:1621568 6480464 Ethinyl Estradiol affects the expression of SNF8 mRNA CTD PMID:17555576 Snf8 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1621568 6480464 Tetrachlorodibenzodioxin affects the expression of SNF8 mRNA CTD PMID:21570461 Snf8 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SNF8 mRNA CTD PMID:33387578 Snf8 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of SNF8 mRNA CTD PMID:21346803 Snf8 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of SNF8 mRNA CTD PMID:21346803 Snf8 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1621568 6480464 bisphenol S results in increased expression of SNF8 mRNA CTD PMID:39298647 Snf8 Rat arsane multiple interactions ISO RGD:1604833 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SNF8 more ... CTD PMID:39836092 Snf8 Rat arsenic atom multiple interactions ISO RGD:1604833 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SNF8 more ... CTD PMID:39836092 Snf8 Rat arsenite(3-) multiple interactions ISO RGD:1604833 6480464 arsenite promotes the reaction [G3BP1 protein binds to SNF8 mRNA] CTD PMID:32406909 Snf8 Rat atrazine decreases expression ISO RGD:1604833 6480464 Atrazine results in decreased expression of SNF8 mRNA CTD PMID:22378314 Snf8 Rat benzo[a]pyrene increases methylation ISO RGD:1604833 6480464 Benzo(a)pyrene results in increased methylation of SNF8 promoter CTD PMID:27901495 Snf8 Rat benzo[a]pyrene decreases expression ISO RGD:1604833 6480464 Benzo(a)pyrene results in decreased expression of SNF8 protein CTD PMID:32717239 Snf8 Rat benzo[a]pyrene increases expression ISO RGD:1621568 6480464 Benzo(a)pyrene results in increased expression of SNF8 mRNA CTD PMID:22228805 Snf8 Rat beta-lapachone decreases expression ISO RGD:1604833 6480464 beta-lapachone results in decreased expression of SNF8 mRNA CTD PMID:38218311 Snf8 Rat beta-lapachone increases expression ISO RGD:1604833 6480464 beta-lapachone results in increased expression of SNF8 mRNA CTD PMID:38218311 Snf8 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1621568 6480464 Diethylhexyl Phthalate results in increased expression of SNF8 mRNA CTD PMID:33754040 Snf8 Rat bisphenol A increases expression ISO RGD:1604833 6480464 bisphenol A results in increased expression of SNF8 mRNA CTD PMID:20678512 Snf8 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SNF8 mRNA CTD PMID:30816183|PMID:32528016|PMID:33296240|PMID:34947998 Snf8 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SNF8 mRNA CTD PMID:25181051 Snf8 Rat bisphenol A decreases expression ISO RGD:1621568 6480464 bisphenol A results in decreased expression of SNF8 mRNA CTD PMID:26063408 Snf8 Rat cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of SNF8 mRNA CTD PMID:21865292 Snf8 Rat cytarabine decreases expression ISO RGD:1604833 6480464 Cytarabine results in decreased expression of SNF8 mRNA CTD PMID:21198554 Snf8 Rat Dibutyl phosphate affects expression ISO RGD:1604833 6480464 di-n-butylphosphoric acid affects the expression of SNF8 mRNA CTD PMID:37042841 Snf8 Rat dorsomorphin multiple interactions ISO RGD:1604833 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Snf8 Rat elemental selenium increases expression ISO RGD:1604833 6480464 Selenium results in increased expression of SNF8 mRNA CTD PMID:19244175 Snf8 Rat folic acid increases expression ISO RGD:1621568 6480464 Folic Acid results in increased expression of SNF8 mRNA CTD PMID:25629700 Snf8 Rat hydralazine multiple interactions ISO RGD:1604833 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of SNF8 mRNA CTD PMID:17183730 Snf8 Rat ivermectin decreases expression ISO RGD:1604833 6480464 Ivermectin results in decreased expression of SNF8 protein CTD PMID:32959892 Snf8 Rat lead(0) decreases expression ISO RGD:1604833 6480464 Lead results in decreased expression of SNF8 mRNA CTD PMID:19921347 Snf8 Rat lead(0) affects expression ISO RGD:1604833 6480464 Lead affects the expression of SNF8 mRNA CTD PMID:28903495 Snf8 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of SNF8 mRNA CTD PMID:19013527 Snf8 Rat SB 431542 multiple interactions ISO RGD:1604833 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Snf8 Rat selenium atom increases expression ISO RGD:1604833 6480464 Selenium results in increased expression of SNF8 mRNA CTD PMID:19244175 Snf8 Rat sodium arsenite multiple interactions ISO RGD:1604833 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SNF8 more ... CTD PMID:39836092 Snf8 Rat sunitinib decreases expression ISO RGD:1604833 6480464 Sunitinib results in decreased expression of SNF8 mRNA CTD PMID:31533062 Snf8 Rat titanium dioxide decreases methylation ISO RGD:1621568 6480464 titanium dioxide results in decreased methylation of SNF8 promoter CTD PMID:35295148 Snf8 Rat triphenyl phosphate affects expression ISO RGD:1604833 6480464 triphenyl phosphate affects the expression of SNF8 mRNA CTD PMID:37042841 Snf8 Rat valproic acid multiple interactions ISO RGD:1604833 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of SNF8 mRNA; [NOG protein co-treated more ... CTD PMID:17183730|PMID:27188386 Snf8 Rat valproic acid affects expression ISO RGD:1604833 6480464 Valproic Acid affects the expression of SNF8 mRNA CTD PMID:25979313 Snf8 Rat valproic acid increases expression ISO RGD:1604833 6480464 Valproic Acid results in increased expression of SNF8 mRNA CTD PMID:23179753|PMID:24383497|PMID:25192806|PMID:26272509|PMID:27188386|PMID:28001369 Snf8 Rat vitamin E increases expression ISO RGD:1604833 6480464 Vitamin E results in increased expression of SNF8 mRNA CTD PMID:19244175
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Snf8 Rat channel regulator activity enables ISO RGD:1604833 1624291 PMID:23171048 RGD PMID:23171048 Snf8 Rat channel regulator activity enables IEA UniProtKB:Q96H20|ensembl:ENSP00000421380 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Snf8 Rat lipid binding enables ISO RGD:1604833 1624291 ChEBI:16038|ChEBI:49183 PMID:18539118 RGD PMID:18539118 Snf8 Rat lipid binding enables IEA UniProtKB:Q96H20|ensembl:ENSP00000421380 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Snf8 Rat protein binding enables ISO RGD:1604833 1624291 UniProtKB:O14901|UniProtKB:O60341|UniProtKB:O75190-2|UniProtKB:O75400-2|UniProtKB:O95793|UniProtKB:O95793-2|UniProtKB:P13473-2|UniProtKB:P24928|UniProtKB:P40222|UniProtKB:P49736|UniProtKB:P51687|UniProtKB:P55199|UniProtKB:P55212|UniProtKB:P62826|UniProtKB:Q08379|UniProtKB:Q08AM6|UniProtKB:Q6PJH3|UniProtKB:Q86VN1|UniProtKB:Q8IVS8|UniProtKB:Q8WUE5|UniProtKB:Q92989|UniProtKB:Q96FZ7|UniProtKB:Q96GM5|UniProtKB:Q96LA8|UniProtKB:Q96NA2|UniProtKB:Q99816|UniProtKB:Q9BRG1|UniProtKB:Q9BYV2|UniProtKB:Q9NW38|UniProtKB:Q9Y210 PMID:14505570, PMID:14519844, PMID:16189514, PMID:16973552, PMID:17010938, PMID:17959629, PMID:19819239, PMID:21516116, PMID:22978549, PMID:23171048, PMID:23455924, PMID:25416956, PMID:28514442, more ... RGD PMID:14505570|PMID:14519844|PMID:16189514|PMID:16973552|PMID:17010938|PMID:17959629|PMID:19819239|PMID:21516116|PMID:22978549|PMID:23171048|PMID:23455924|PMID:25416956|PMID:28514442|PMID:29892012|PMID:31515488|PMID:32296183|PMID:32814053|PMID:33961781|PMID:35271311 Snf8 Rat protein homodimerization activity enables ISO RGD:1604833 1624291 UniProtKB:Q96H20 PMID:14505570, PMID:14519844 RGD PMID:14505570|PMID:14519844 Snf8 Rat protein homodimerization activity enables IEA UniProtKB:Q96H20|ensembl:ENSP00000421380 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 14-Deoxy-11,12-didehydroandrographolide (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cyclosporin A (EXP) cytarabine (ISO) Dibutyl phosphate (ISO) dorsomorphin (ISO) elemental selenium (ISO) folic acid (ISO) hydralazine (ISO) ivermectin (ISO) lead(0) (ISO) rotenone (EXP) SB 431542 (ISO) selenium atom (ISO) sodium arsenite (ISO) sunitinib (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vitamin E (ISO)
Biological Process
biological_process (ND) early endosome to late endosome transport (IEA,ISO) endocytic recycling (IEA,ISO) macroautophagy (IEA,ISO,ISS) multivesicular body assembly (IEA,ISO,ISS) multivesicular body sorting pathway (IEA,ISO,ISS) positive regulation of exosomal secretion (IEA,ISO) positive regulation of gene expression (IEA,ISO) positive regulation of protein catabolic process (IEA,ISO) protein transport (IEA) protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway (IBA) regulation of MAP kinase activity (ISO) regulation of protein catabolic process (IEA,ISO) regulation of protein complex stability (IEA,ISO) regulation of transcription by RNA polymerase II (IEA,ISO)
Cellular Component
cytoplasm (IEA,ISO) cytosol (IEA,ISO) endosome (IEA) endosome membrane (IEA,ISO) ESCRT II complex (IBA,IEA,ISO) late endosome membrane (IEA,ISO) membrane (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IEA,ISO) perinuclear region of cytoplasm (IEA,ISO) plasma membrane (IEA,ISO) recycling endosome (IEA,ISO) transcription regulator complex (IEA,ISO)
Snf8 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 81,481,054 - 81,493,430 (+) NCBI GRCr8 mRatBN7.2 10 80,984,337 - 80,996,724 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 80,984,363 - 80,996,734 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 85,932,673 - 85,944,874 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 85,430,709 - 85,442,910 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 80,823,176 - 80,835,608 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 83,856,331 - 83,868,621 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 83,856,280 - 83,868,598 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 83,661,434 - 83,673,490 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 84,749,033 - 84,761,230 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 84,763,402 - 84,775,600 (+) NCBI Celera 10 79,752,499 - 79,764,696 (+) NCBI Celera Cytogenetic Map 10 q26 NCBI
SNF8 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 48,929,316 - 48,944,842 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 48,929,316 - 48,944,842 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 47,006,678 - 47,022,204 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 44,362,457 - 44,377,153 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 43,461,656 - 43,476,351 (-) NCBI Celera Cytogenetic Map 17 q21.32 NCBI HuRef 17 42,375,136 - 42,389,830 (-) NCBI HuRef CHM1_1 17 47,073,206 - 47,087,896 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 49,793,036 - 49,808,559 (-) NCBI T2T-CHM13v2.0
Snf8 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 95,925,711 - 95,938,256 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 95,925,711 - 95,938,256 (+) Ensembl GRCm39 Ensembl GRCm38 11 96,034,885 - 96,047,430 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 96,034,885 - 96,047,430 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 95,896,231 - 95,908,719 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 95,851,007 - 95,863,495 (+) NCBI MGSCv36 mm8 Celera 11 105,685,354 - 105,697,707 (+) NCBI Celera Cytogenetic Map 11 D NCBI cM Map 11 59.24 NCBI
Snf8 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955451 12,396,625 - 12,406,014 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955451 12,396,625 - 12,406,014 (+) NCBI ChiLan1.0 ChiLan1.0
SNF8 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 16,158,715 - 16,172,794 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 18,124,309 - 18,138,395 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 8,595,647 - 8,609,730 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 8,577,948 - 8,794,859 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 8,578,050 - 8,794,480 (+) Ensembl panpan1.1 panPan2
SNF8 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 25,151,992 - 25,162,105 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 25,152,011 - 25,162,023 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 24,613,162 - 24,623,187 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 25,947,254 - 25,957,310 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 25,947,273 - 25,957,217 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 24,715,090 - 24,725,126 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 24,973,356 - 24,983,364 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 25,102,284 - 25,112,314 (-) NCBI UU_Cfam_GSD_1.0
Snf8 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 24,554,980 - 24,567,996 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 12,507,116 - 12,523,674 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 12,507,147 - 12,520,424 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SNF8 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 25,142,813 - 25,153,016 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 25,142,748 - 25,152,847 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 25,108,502 - 25,118,624 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SNF8 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 69,343,260 - 69,357,843 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 69,339,804 - 69,357,860 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 40,445,605 - 40,459,909 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Snf8
.
Predicted Target Of
Count of predictions: 81 Count of miRNA genes: 72 Interacting mature miRNAs: 79 Transcripts: ENSRNOT00000008964 Prediction methods: Microtar, Rnahybrid, Targetscan Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631555 Bp134 Blood pressure QTL 134 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 80515287 91230079 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 724516 Uae17 Urinary albumin excretion QTL 17 3.6 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 78210622 85220348 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2298481 Eau9 Experimental allergic uveoretinitis QTL 9 0.0169 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 65927233 82565079 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 1358915 Stresp7 Stress response QTL 7 3.52 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 78899655 87307728 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 2325836 Bp346 Blood pressure QTL 346 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 84007272 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 12880053 Cm104 Cardiac mass QTL 104 0.009 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 73452992 83463334 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 12880050 Am10 Aortic mass QTL 10 0.016 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 74372084 84007272 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631537 Oia4 Oil induced arthritis QTL 4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 75631887 87055282 Rat 634354 Rends3 Renal damage susceptibility QTL 3 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 10 79813789 85160854 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
RH137056
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 80,996,513 - 80,996,700 (+) MAPPER mRatBN7.2 Rnor_6.0 10 83,868,401 - 83,868,587 NCBI Rnor6.0 Rnor_5.0 10 83,673,270 - 83,673,456 UniSTS Rnor5.0 RGSC_v3.4 10 84,761,103 - 84,761,289 UniSTS RGSC3.4 Celera 10 79,764,569 - 79,764,755 UniSTS RH 3.4 Map 10 738.2 UniSTS Cytogenetic Map 10 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000008964 ⟹ ENSRNOP00000008964
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 80,984,365 - 80,996,734 (+) Ensembl Rnor_6.0 Ensembl 10 83,856,280 - 83,868,598 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110029 ⟹ ENSRNOP00000087170
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 80,984,389 - 80,996,734 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114272 ⟹ ENSRNOP00000096004
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 80,984,363 - 80,996,641 (+) Ensembl
RefSeq Acc Id:
NM_001007804 ⟹ NP_001007805
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 81,481,057 - 81,493,430 (+) NCBI mRatBN7.2 10 80,984,350 - 80,996,724 (+) NCBI Rnor_6.0 10 83,856,331 - 83,868,528 (+) NCBI Rnor_5.0 10 83,661,434 - 83,673,490 (+) NCBI RGSC_v3.4 10 84,749,033 - 84,761,230 (+) RGD Celera 10 79,752,499 - 79,764,696 (+) RGD
Sequence:
ATGCACCGGCGCGGGGTGGGAGCTGGCGCCATTGCCAAGAAGAAACTCGCCGAGGCCAAGTATAAGGAGCGAGGGACTGTCTTGGCTGAGGACCAGCTGGCTCAGATGTCAAAACAGTTGGACATGTT
hide sequence
RefSeq Acc Id:
XM_063268726 ⟹ XP_063124796
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 81,481,510 - 81,493,430 (+) NCBI
RefSeq Acc Id:
XM_063268727 ⟹ XP_063124797
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 81,485,013 - 81,493,430 (+) NCBI
RefSeq Acc Id:
XR_005489752
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 81,481,054 - 81,493,241 (+) NCBI mRatBN7.2 10 80,984,337 - 80,996,724 (+) NCBI
RefSeq Acc Id:
NP_001007805 ⟸ NM_001007804
- UniProtKB:
Q5RK19 (UniProtKB/Swiss-Prot), A6HIC5 (UniProtKB/TrEMBL), A0A8I6APW2 (UniProtKB/TrEMBL), A6HIC6 (UniProtKB/TrEMBL)
- Sequence:
MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQV
hide sequence
Ensembl Acc Id:
ENSRNOP00000008964 ⟸ ENSRNOT00000008964
Ensembl Acc Id:
ENSRNOP00000087170 ⟸ ENSRNOT00000110029
Ensembl Acc Id:
ENSRNOP00000096004 ⟸ ENSRNOT00000114272
RefSeq Acc Id:
XP_063124796 ⟸ XM_063268726
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6APW2 (UniProtKB/TrEMBL), A6HIC6 (UniProtKB/TrEMBL), A0A8I6A7G8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124797 ⟸ XM_063268727
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6APW2 (UniProtKB/TrEMBL), A6HIC6 (UniProtKB/TrEMBL)
RGD ID: 13697625 Promoter ID: EPDNEW_R8149 Type: multiple initiation site Name: Snf8_1 Description: SNF8, ESCRT-II complex subunit SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 83,856,239 - 83,856,299 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-04-02
Snf8
SNF8 subunit of ESCRT-II
Snf8
SNF8, ESCRT-II complex subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-06-14
Snf8
SNF8, ESCRT-II complex subunit
Snf8
SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Snf8
SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)
RGD1310144
similar to EAP30 subunit of ELL complex
Symbol and Name updated
1299863 APPROVED
2005-12-06
RGD1310144
similar to EAP30 subunit of ELL complex
RGD1310144_predicted
similar to EAP30 subunit of ELL complex (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1310144_predicted
similar to EAP30 subunit of ELL complex (predicted)
LOC287645_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC287645_predicted
similar to EAP30 subunit of ELL complex (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
