Symbol:
Pimreg
Name:
PICALM interacting mitotic regulator
RGD ID:
1308747
Description:
Predicted to be located in nucleolus and nucleoplasm. Orthologous to human PIMREG (PICALM interacting mitotic regulator); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,7-dihydropurine-6-thione.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Fam64a; family with sequence similarity 64, member A; LOC360559; RGD1308747; similar to hypothetical protein FLJ10156
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 57,168,136 - 57,173,713 (+) NCBI GRCr8 mRatBN7.2 10 56,669,603 - 56,674,540 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 56,669,675 - 56,674,791 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 61,333,647 - 61,338,494 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 60,822,134 - 60,826,981 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 56,321,186 - 56,326,033 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 58,613,588 - 58,618,524 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 58,613,674 - 58,618,514 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 58,354,609 - 58,360,750 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 58,895,262 - 58,900,104 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 58,908,869 - 58,913,730 (+) NCBI Celera 10 55,800,601 - 55,805,442 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pimreg Rat 1,2-dichloroethane decreases expression ISO Pimreg (Mus musculus) 6480464 ethylene dichloride results in decreased expression of FAM64A mRNA CTD PMID:28960355 Pimreg Rat 1,2-dimethylhydrazine increases expression ISO Pimreg (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of FAM64A mRNA CTD PMID:22206623 Pimreg Rat 17beta-estradiol increases expression ISO PIMREG (Homo sapiens) 6480464 Estradiol results in increased expression of PIMREG mRNA CTD PMID:19167446 Pimreg Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of FAM64A mRNA CTD PMID:32145629 Pimreg Rat 17beta-estradiol increases expression ISO Pimreg (Mus musculus) 6480464 Estradiol results in increased expression of PIMREG mRNA CTD PMID:19484750 Pimreg Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Pimreg (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pimreg Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Pimreg (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pimreg Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PIMREG (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PIMREG mRNA CTD PMID:21802500 Pimreg Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PIMREG mRNA CTD PMID:32109520 Pimreg Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pimreg (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PIMREG mRNA CTD PMID:26290441 Pimreg Rat 3,7-dihydropurine-6-thione decreases expression EXP 6480464 Mercaptopurine results in decreased expression of PIMREG mRNA CTD PMID:23358152 Pimreg Rat 4,4'-sulfonyldiphenol decreases expression ISO Pimreg (Mus musculus) 6480464 bisphenol S results in decreased expression of PIMREG mRNA CTD PMID:39298647 Pimreg Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PIMREG mRNA CTD PMID:24780913 Pimreg Rat acrolein multiple interactions ISO PIMREG (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PIMREG mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PIMREG mRNA CTD PMID:32699268 Pimreg Rat acrylamide decreases expression ISO PIMREG (Homo sapiens) 6480464 Acrylamide results in decreased expression of PIMREG mRNA CTD PMID:32763439 Pimreg Rat aflatoxin M1 decreases expression ISO PIMREG (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of PIMREG mRNA CTD PMID:30928695 Pimreg Rat aldehydo-D-glucose multiple interactions ISO Pimreg (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of PIMREG mRNA CTD PMID:37567420 Pimreg Rat all-trans-retinoic acid decreases expression ISO PIMREG (Homo sapiens) 6480464 Tretinoin results in decreased expression of PIMREG mRNA CTD PMID:23724009 Pimreg Rat alpha-pinene multiple interactions ISO PIMREG (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PIMREG mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PIMREG mRNA CTD PMID:32699268 Pimreg Rat arsenite(3-) multiple interactions ISO PIMREG (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to PIMREG mRNA] CTD PMID:32406909 Pimreg Rat azathioprine decreases expression ISO PIMREG (Homo sapiens) 6480464 Azathioprine results in decreased expression of PIMREG mRNA CTD PMID:22623647 Pimreg Rat benzo[a]pyrene decreases expression ISO PIMREG (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PIMREG mRNA CTD PMID:20064835 and PMID:21802500 Pimreg Rat benzo[a]pyrene increases expression ISO Pimreg (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PIMREG mRNA CTD PMID:32417428 Pimreg Rat benzo[a]pyrene affects methylation ISO PIMREG (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of FAM64A 5' UTR CTD PMID:27901495 Pimreg Rat benzo[a]pyrene multiple interactions ISO Pimreg (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PIMREG mRNA CTD PMID:27858113 Pimreg Rat benzo[a]pyrene diol epoxide I decreases expression ISO PIMREG (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 and PMID:26238291 Pimreg Rat benzo[b]fluoranthene increases expression ISO Pimreg (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of PIMREG mRNA CTD PMID:26377693 Pimreg Rat benzo[b]fluoranthene multiple interactions ISO Pimreg (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PIMREG mRNA CTD PMID:27858113 Pimreg Rat beta-lapachone increases expression ISO PIMREG (Homo sapiens) 6480464 beta-lapachone results in increased expression of PIMREG mRNA CTD PMID:38218311 Pimreg Rat beta-lapachone decreases expression ISO PIMREG (Homo sapiens) 6480464 beta-lapachone results in decreased expression of PIMREG mRNA CTD PMID:38218311 Pimreg Rat bis(2-chloroethyl) sulfide decreases expression ISO PIMREG (Homo sapiens) 6480464 Mustard Gas results in decreased expression of PIMREG mRNA CTD PMID:25102026 Pimreg Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PIMREG mRNA CTD PMID:25181051 Pimreg Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of FAM64A mRNA CTD PMID:32145629 Pimreg Rat bisphenol A decreases expression ISO PIMREG (Homo sapiens) 6480464 bisphenol A results in decreased expression of PIMREG mRNA CTD PMID:29275510 Pimreg Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PIMREG mRNA CTD PMID:30816183 and PMID:32528016 Pimreg Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of PIMREG mRNA CTD PMID:19167457 Pimreg Rat caffeine decreases phosphorylation ISO PIMREG (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PIMREG protein CTD PMID:35688186 Pimreg Rat calcitriol decreases expression ISO PIMREG (Homo sapiens) 6480464 Calcitriol results in decreased expression of PIMREG mRNA CTD PMID:21592394 Pimreg Rat calcitriol multiple interactions ISO PIMREG (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of PIMREG mRNA CTD PMID:21592394 Pimreg Rat carbon nanotube increases expression ISO Pimreg (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Pimreg Rat chromium(6+) multiple interactions ISO PIMREG (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of PIMREG mRNA CTD PMID:38479592 Pimreg Rat chrysene multiple interactions ISO Pimreg (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PIMREG mRNA CTD PMID:27858113 Pimreg Rat cobalt dichloride decreases expression ISO PIMREG (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PIMREG mRNA CTD PMID:19376846 Pimreg Rat copper atom multiple interactions ISO PIMREG (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of PIMREG mRNA CTD PMID:20971185 Pimreg Rat copper(0) multiple interactions ISO PIMREG (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of PIMREG mRNA CTD PMID:20971185 Pimreg Rat copper(II) sulfate decreases expression ISO PIMREG (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PIMREG mRNA CTD PMID:19549813 Pimreg Rat coumarin affects phosphorylation ISO PIMREG (Homo sapiens) 6480464 coumarin affects the phosphorylation of PIMREG protein CTD PMID:35688186 Pimreg Rat coumestrol increases expression ISO PIMREG (Homo sapiens) 6480464 Coumestrol results in increased expression of PIMREG mRNA CTD PMID:19167446 Pimreg Rat coumestrol multiple interactions ISO PIMREG (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Pimreg Rat crocidolite asbestos increases expression ISO PIMREG (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of PIMREG mRNA CTD PMID:29523930 Pimreg Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PIMREG mRNA CTD PMID:26577399 Pimreg Rat cyclosporin A decreases expression ISO PIMREG (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PIMREG mRNA CTD PMID:21632981 and PMID:25562108 Pimreg Rat D-glucose multiple interactions ISO Pimreg (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of PIMREG mRNA CTD PMID:37567420 Pimreg Rat DDE increases expression ISO PIMREG (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of PIMREG mRNA CTD PMID:38568856 Pimreg Rat diallyl trisulfide decreases expression ISO PIMREG (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of PIMREG mRNA CTD PMID:34995734 Pimreg Rat dibenz[a,h]anthracene increases expression ISO Pimreg (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Pimreg Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PIMREG mRNA CTD PMID:21266533 Pimreg Rat dibutyl phthalate decreases expression ISO Pimreg (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PIMREG mRNA CTD PMID:21266533 Pimreg Rat dichloroacetic acid increases expression ISO Pimreg (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of PIMREG mRNA CTD PMID:28962523 Pimreg Rat dioxygen decreases expression ISO PIMREG (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of PIMREG mRNA CTD PMID:26516004 Pimreg Rat dioxygen multiple interactions EXP 6480464 [dan-shen root extract co-treated with Andrographis paniculata extract] inhibits the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of PIMREG mRNA] and [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of PIMREG mRNA CTD PMID:33729688 Pimreg Rat dorsomorphin multiple interactions ISO PIMREG (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PIMREG mRNA CTD PMID:27188386 Pimreg Rat doxorubicin increases expression ISO Pimreg (Mus musculus) 6480464 Doxorubicin results in increased expression of PIMREG mRNA CTD PMID:36227756 Pimreg Rat Enterolactone multiple interactions ISO PIMREG (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PIMREG mRNA CTD PMID:19167446 Pimreg Rat FR900359 decreases phosphorylation ISO PIMREG (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of PIMREG protein CTD PMID:37730182 Pimreg Rat fructose multiple interactions ISO Pimreg (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of PIMREG mRNA CTD PMID:37567420 Pimreg Rat glucose multiple interactions ISO Pimreg (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of PIMREG mRNA CTD PMID:37567420 Pimreg Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of PIMREG mRNA CTD PMID:24395379 Pimreg Rat glyphosate multiple interactions ISO Pimreg (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of PIMREG mRNA CTD PMID:37567420 Pimreg Rat lead(0) affects expression ISO PIMREG (Homo sapiens) 6480464 Lead affects the expression of PIMREG mRNA CTD PMID:28903495 Pimreg Rat leflunomide decreases expression ISO PIMREG (Homo sapiens) 6480464 leflunomide results in decreased expression of PIMREG mRNA CTD PMID:28988120 Pimreg Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of FAM64A mRNA CTD PMID:35283115 Pimreg Rat lipopolysaccharide multiple interactions ISO PIMREG (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of PIMREG mRNA CTD PMID:35811015 Pimreg Rat menadione affects expression ISO PIMREG (Homo sapiens) 6480464 Vitamin K 3 affects the expression of PIMREG mRNA CTD PMID:20044591 Pimreg Rat mercaptopurine decreases expression EXP 6480464 Mercaptopurine results in decreased expression of PIMREG mRNA CTD PMID:23358152 Pimreg Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of PIMREG mRNA CTD PMID:28341135 Pimreg Rat miconazole increases expression ISO Pimreg (Mus musculus) 6480464 Miconazole results in increased expression of PIMREG mRNA CTD PMID:27462272 Pimreg Rat N-methyl-4-phenylpyridinium decreases expression ISO PIMREG (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PIMREG mRNA CTD PMID:24810058 Pimreg Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PIMREG mRNA CTD PMID:25729387 Pimreg Rat ozone decreases expression ISO Pimreg (Mus musculus) 6480464 Ozone results in decreased expression of PIMREG mRNA CTD PMID:24336422 Pimreg Rat ozone multiple interactions ISO Pimreg (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PIMREG mRNA more ... CTD PMID:27106289 and PMID:34911549 Pimreg Rat ozone multiple interactions ISO PIMREG (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PIMREG mRNA more ... CTD PMID:32699268 Pimreg Rat palbociclib decreases expression ISO PIMREG (Homo sapiens) 6480464 palbociclib results in decreased expression of PIMREG mRNA CTD PMID:22869556 Pimreg Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PIMREG mRNA CTD PMID:33387578 Pimreg Rat PCB138 multiple interactions ISO Pimreg (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pimreg Rat phenylmercury acetate decreases expression ISO PIMREG (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of PIMREG mRNA CTD PMID:26272509 Pimreg Rat phenylmercury acetate multiple interactions ISO PIMREG (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PIMREG mRNA CTD PMID:27188386 Pimreg Rat propanal decreases expression ISO PIMREG (Homo sapiens) 6480464 propionaldehyde results in decreased expression of PIMREG mRNA CTD PMID:26079696 Pimreg Rat purine-6-thiol decreases expression EXP 6480464 Mercaptopurine results in decreased expression of PIMREG mRNA CTD PMID:23358152 Pimreg Rat quercetin affects expression EXP 6480464 Quercetin affects the expression of PIMREG mRNA CTD PMID:18178720 Pimreg Rat resveratrol multiple interactions ISO PIMREG (Homo sapiens) 6480464 [Coumestrol co-treated with Resveratrol] results in increased expression of PIMREG mRNA and [Plant Extracts co-treated with Resveratrol] results in decreased expression of PIMREG mRNA CTD PMID:19167446 and PMID:23557933 Pimreg Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PIMREG (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of PIMREG mRNA CTD PMID:35811015 Pimreg Rat SB 431542 multiple interactions ISO PIMREG (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PIMREG mRNA CTD PMID:27188386 Pimreg Rat silicon dioxide increases expression ISO Pimreg (Mus musculus) 6480464 Silicon Dioxide results in increased expression of FAM64A mRNA CTD PMID:29341224 Pimreg Rat Soman increases expression EXP 6480464 Soman results in increased expression of PIMREG mRNA CTD PMID:19281266 Pimreg Rat sunitinib decreases expression ISO PIMREG (Homo sapiens) 6480464 Sunitinib results in decreased expression of PIMREG mRNA CTD PMID:31533062 Pimreg Rat testosterone multiple interactions ISO PIMREG (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of PIMREG mRNA CTD PMID:21592394 Pimreg Rat testosterone decreases expression ISO PIMREG (Homo sapiens) 6480464 Testosterone results in decreased expression of PIMREG mRNA CTD PMID:21592394 Pimreg Rat tetraphene multiple interactions ISO Pimreg (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of PIMREG mRNA CTD PMID:27858113 Pimreg Rat thapsigargin decreases expression ISO PIMREG (Homo sapiens) 6480464 Thapsigargin results in decreased expression of PIMREG mRNA CTD PMID:22378314 Pimreg Rat titanium dioxide increases methylation ISO Pimreg (Mus musculus) 6480464 titanium dioxide results in increased methylation of FAM64A promoter alternative form CTD PMID:35295148 Pimreg Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PIMREG mRNA CTD PMID:25729387 Pimreg Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PIMREG mRNA CTD PMID:33387578 Pimreg Rat triclosan decreases expression ISO PIMREG (Homo sapiens) 6480464 Triclosan results in decreased expression of PIMREG mRNA CTD PMID:30510588 Pimreg Rat trimellitic anhydride increases expression ISO Pimreg (Mus musculus) 6480464 trimellitic anhydride results in increased expression of PIMREG mRNA CTD PMID:19042947 Pimreg Rat trovafloxacin decreases expression ISO Pimreg (Mus musculus) 6480464 trovafloxacin results in decreased expression of FAM64A mRNA CTD PMID:35537566 Pimreg Rat tungsten increases expression ISO Pimreg (Mus musculus) 6480464 Tungsten results in increased expression of FAM64A mRNA CTD PMID:30912803 Pimreg Rat tunicamycin decreases expression ISO PIMREG (Homo sapiens) 6480464 Tunicamycin results in decreased expression of PIMREG mRNA CTD PMID:22378314 and PMID:29453283 Pimreg Rat valproic acid increases methylation ISO PIMREG (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PIMREG gene CTD PMID:29154799 Pimreg Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of PIMREG gene CTD PMID:31682807 Pimreg Rat zinc atom decreases expression ISO PIMREG (Homo sapiens) 6480464 Zinc results in decreased expression of PIMREG mRNA CTD PMID:19071009 Pimreg Rat zinc(0) decreases expression ISO PIMREG (Homo sapiens) 6480464 Zinc results in decreased expression of PIMREG mRNA CTD PMID:19071009
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,7-dihydropurine-6-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) acrylamide (ISO) aflatoxin M1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) arsenite(3-) (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) C60 fullerene (EXP) caffeine (ISO) calcitriol (ISO) carbon nanotube (ISO) chromium(6+) (ISO) chrysene (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumarin (ISO) coumestrol (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) D-glucose (ISO) DDE (ISO) diallyl trisulfide (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (EXP,ISO) dichloroacetic acid (ISO) dioxygen (EXP,ISO) dorsomorphin (ISO) doxorubicin (ISO) Enterolactone (ISO) FR900359 (ISO) fructose (ISO) glucose (ISO) glycidol (EXP) glyphosate (ISO) lead(0) (ISO) leflunomide (ISO) lidocaine (EXP) lipopolysaccharide (ISO) menadione (ISO) mercaptopurine (EXP) methamphetamine (EXP) miconazole (ISO) N-methyl-4-phenylpyridinium (ISO) oxaliplatin (EXP) ozone (ISO) palbociclib (ISO) paracetamol (EXP) PCB138 (ISO) phenylmercury acetate (ISO) propanal (ISO) purine-6-thiol (EXP) quercetin (EXP) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) Soman (EXP) sunitinib (ISO) testosterone (ISO) tetraphene (ISO) thapsigargin (ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) triclosan (ISO) trimellitic anhydride (ISO) trovafloxacin (ISO) tungsten (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO)
Pimreg Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 57,168,136 - 57,173,713 (+) NCBI GRCr8 mRatBN7.2 10 56,669,603 - 56,674,540 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 56,669,675 - 56,674,791 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 61,333,647 - 61,338,494 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 60,822,134 - 60,826,981 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 56,321,186 - 56,326,033 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 58,613,588 - 58,618,524 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 58,613,674 - 58,618,514 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 58,354,609 - 58,360,750 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 58,895,262 - 58,900,104 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 58,908,869 - 58,913,730 (+) NCBI Celera 10 55,800,601 - 55,805,442 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
PIMREG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 6,444,455 - 6,451,469 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 6,444,441 - 6,451,469 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 6,347,775 - 6,354,789 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 6,288,519 - 6,295,108 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 6,368,303 - 6,374,898 (+) NCBI Celera Cytogenetic Map 17 p13.2 NCBI HuRef 17 6,243,091 - 6,249,743 (+) NCBI HuRef CHM1_1 17 6,357,166 - 6,363,816 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 6,344,181 - 6,351,199 (+) NCBI T2T-CHM13v2.0
Pimreg Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 71,932,867 - 71,938,197 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 71,932,858 - 71,938,196 (+) Ensembl GRCm39 Ensembl GRCm38 11 72,042,428 - 72,047,372 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 72,042,032 - 72,047,370 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 71,856,004 - 71,860,872 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 71,858,697 - 71,863,565 (+) NCBI MGSCv36 mm8 Celera 11 79,567,398 - 79,572,265 (+) NCBI Celera Cytogenetic Map 11 B4 NCBI cM Map 11 43.81 NCBI
Pimreg Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 11,967,977 - 11,972,049 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 11,967,986 - 11,972,049 (+) NCBI ChiLan1.0 ChiLan1.0
PIMREG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 14,045,457 - 14,052,099 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 16,011,515 - 16,018,156 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 6,482,837 - 6,489,480 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 6,471,520 - 6,478,156 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 6,471,520 - 6,478,156 (+) Ensembl panpan1.1 panPan2
PIMREG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 30,820,867 - 30,825,169 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 30,820,867 - 30,825,300 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 30,952,548 - 30,956,850 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 30,922,550 - 30,926,870 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 30,922,550 - 30,927,714 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 30,887,362 - 30,891,663 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 30,846,408 - 30,850,707 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 31,019,761 - 31,024,063 (-) NCBI UU_Cfam_GSD_1.0
Pimreg
PIMREG Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 50,898,501 - 50,903,464 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 50,898,493 - 50,903,238 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 52,896,983 - 52,901,847 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PIMREG
Pimreg
.
Assembly: mRatBN7.2
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
10
56670398
56670399
G
A
snv
European Variation Archive Release 3 , SHR/NHsd (2021), European Variation Archive Release 6, BUF/N (2020), BXH2/CubMcwi (2020), FHH/EurMcwi (2019), LEW/Crl (2019), MR/N (2020), MWF/Hsd (2019), PVG/Seac (2019), SS/JrHsdMcwi (2019), WKY/NCrl (2019), WKY/N (2020), FHH/EurMcwi (2019NG), LEW/Crl (2019NG), MWF/SimwMcwi (2019NG), MWF/SimwMcwi (2019), SS/HsdMcwiCrl (2021), SS/JrHsdMcwi (2019NG), SS/JrHsd (2021), WKY/NCrl (2019NG), SHR/OlalpcvMcwi (2019NG), HXB4/IpcvMcwi (2020), LH/MavRrrcAek (2020), LL/MavRrrcAek (2020), LN/MavRrrcAek (2020), SHRSP/A3NCrl (2019), SHR/OlalpcvMcwi (2019), SR/JrHsd (2020), WAG/RijCrl (2020), WN/N (2020), BXH6/CubMcwi (2021), MR/NRrrc (2022), RCS/LavRrrcMcwi (2021), SHRSP/A3NCrl (2019NG), SHR/NCrl (2021), SHR/NHsd (2021), European Variation Archive Release 4 View more Information
Assembly: RGSC_v3.4
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
10
58895970
58895971
G
A
snv
FHH/EurMcwi (MCW) , LCR/2Mco (UMich), SR/JrHsd (MCW), SS/JrHsdMcwi (MCW), SHR/OlaIpcv (ICL), FHH/EurMcwi (MDC), SHRSP/Gcrc (MDC), SS/JrHsdMcwi (MDC), BUF/N (KNAW), MR/N (KNAW), SHR/OlaIpcv (KNAW), GH/OmrMcwi (MCW), FHH/EurMcwi (ICL), FHL/EurMcwi (ICL), LEW/Crl (ICL), LEW/NCrl (ICL), LH/MavRrrc (ICL), LL/MavRrrc (ICL), LN/MavRrrc (ICL), MHS/Gib (ICL), SBN/Ygl (ICL), SHR/OlaIpcv (ICL), SHR/NHsd (ICL), SHRSP/Gcrc (ICL), SR/JrHsd (ICL), SS/Jr (ICL), SS/JrHsdMcwi (ICL), WAG/Rij (ICL), WKY/NCrl (ICL), WKY/Gcrc (ICL), WKY/NHsd (ICL), HCR/1Mco (UMich), LCR/1Mco (UMich), FHL/EurMcwi (MCW) View more Information
Assembly: Rnor_5.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
10
58355398
58355399
G
A
snv
FHH/EurMcwi (MCW) , KFRS3B/Kyo (KyushuU), GH/OmrMcwi (MCW), SBN/Ygl (MCW), SR/JrHsd (MCW), SS/JrHsdMcwi (MCW), WN/N (KNAW), LH/MavRrrc (KNAW), LL/MavRrrc (KNAW), LN/MavRrrc (KNAW), MHS/Gib (KNAW), MR/N (KNAW), SR/JrHsd (KNAW), SS/Jr (KNAW), SS/JrHsdMcwi (KNAW), WAG/Rij (KNAW), BUF/N (KNAW), FHH/EurMcwi (KNAW), FHL/EurMcwi (KNAW), LEW/Crl (KNAW), LEW/NCrl (KNAW), SBN/Ygl (KNAW), SHR/NCrlPrin (KNAW), SHR/NHsd (KNAW), SHR/OlaIpcv (KNAW), SHR/OlaIpcvPrin (KNAW), SHRSP/Gcrc (KNAW), WKY/Gcrc (KNAW), WKY/N (KNAW), WKY/NCrl (KNAW), WKY/NHsd (KNAW), SDLEF7/Barth (UDEL), LE/OrlBarth (UDEL), Crl:SD (UDEL), IS/Kyo (KyushuU), NIG-III/Hok (KyushuU), HTX/Kyo (KyushuU), RCS/Kyo (KyushuU), IS-Tlk/Kyo (KyushuU), HWY/Slc (KyushuU), DOB/Oda (KyushuU), FHL/EurMcwi (MCW) View more Information
Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
10
58614382
58614383
G
A
snv
European Variation Archive Release 3 , WN/N (2020), European Variation Archive Release 6, CDR, FHH/EurMcwi (MCW), FHL/EurMcwi (MCW), GH/OmrMcwi (MCW), SBN/Ygl (MCW), SR/JrHsd (MCW), SS/JrHsdMcwi (MCW), Buf/N (MCW), MR/N (MCW), BUF/N (2020), BXH2/CubMcwi (2020), FHH/EurMcwi (2019), HXB4/IpcvMcwi (2020), LEW/Crl (2019), LH/MavRrrcAek (2020), LL/MavRrrcAek (2020), LN/MavRrrcAek (2020), MR/N (2020), MWF/Hsd (2019), PVG/Seac (2019), SHRSP/A3NCrl (2019), SHR/OlalpcvMcwi (2019), SR/JrHsd (2020), SS/JrHsdMcwi (2019), WAG/RijCrl (2020), WKY/NCrl (2019), WKY/N (2020), European Variation Archive Release 4 View more Information
Predicted Target Of
Count of predictions: 408 Count of miRNA genes: 197 Interacting mature miRNAs: 228 Transcripts: ENSRNOT00000010975 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1578762 Toxo1 Toxoplasma gondii resistance QTL 1 brain integrity trait (VT:0010579) percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028) 10 52200030 59378278 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 1354585 Eae18a Experimental allergic encephalomyelitis QTL 18a 7.5 0.0004 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 10 53797385 58445852 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 2298495 Eae23 Experimental allergic encephalomyelitis QTL 23 16.93 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis duration (CMO:0001424) 10 55273696 60677262 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
RH133622
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 56,674,112 - 56,674,331 (+) MAPPER mRatBN7.2 mRatBN7.2 17 81,865,287 - 81,865,506 (+) MAPPER mRatBN7.2 Rnor_6.0 17 85,947,184 - 85,947,402 NCBI Rnor6.0 Rnor_6.0 10 58,618,097 - 58,618,315 NCBI Rnor6.0 Rnor_5.0 17 87,661,752 - 87,661,970 UniSTS Rnor5.0 Rnor_5.0 10 58,359,113 - 58,359,331 UniSTS Rnor5.0 RGSC_v3.4 10 58,899,686 - 58,899,904 UniSTS RGSC3.4 RGSC_v3.4 17 93,310,935 - 93,311,153 UniSTS RGSC3.4 Celera 17 81,136,313 - 81,136,531 UniSTS Celera 10 55,805,024 - 55,805,242 UniSTS Cytogenetic Map 17 q12.3 UniSTS Cytogenetic Map 10 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
49
111
88
87
56
25
56
6
213
96
91
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010975 ⟹ ENSRNOP00000010975
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 56,669,675 - 56,674,791 (+) Ensembl Rnor_6.0 Ensembl 10 58,613,674 - 58,618,514 (+) Ensembl
RefSeq Acc Id:
NM_001113781 ⟹ NP_001107253
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 57,168,223 - 57,173,064 (+) NCBI mRatBN7.2 10 56,669,690 - 56,674,531 (+) NCBI Rnor_6.0 10 58,613,674 - 58,618,515 (+) NCBI Rnor_5.0 10 58,354,609 - 58,360,750 (+) NCBI RGSC_v3.4 10 58,895,262 - 58,900,104 (+) RGD Celera 10 55,800,601 - 55,805,442 (+) RGD
Sequence:
CTGGTATCAAGCAGGGAGGATCTATCGGGCAGAGGAAACTGGACCAAGCACATGGCGTCTCAGTGGCAGGGCATGAGGACCTCCGTGCGCAGACGATCACTCCTAAAGGAGGAGCAGCTAGAGAAGGA
hide sequence
RefSeq Acc Id:
XM_006246760 ⟹ XP_006246822
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 57,168,136 - 57,173,713 (+) NCBI mRatBN7.2 10 56,669,603 - 56,674,540 (+) NCBI Rnor_6.0 10 58,613,588 - 58,618,524 (+) NCBI Rnor_5.0 10 58,354,609 - 58,360,750 (+) NCBI
Sequence:
GGGCTGCAAGTGCCAGGACGGGGCGGGGCCGCGCGGAGTTTCAAATCCGCTGTGGTGGGCTAGGAGAGGGTGTCGATTTTCGAGTCCTGGTATCAAGCAGGGAGGATCTATCGGGCAGAGGAAACTGG
hide sequence
RefSeq Acc Id:
NP_001107253 ⟸ NM_001113781
- UniProtKB:
B0BN57 (UniProtKB/TrEMBL), F7EXP2 (UniProtKB/TrEMBL)
- Sequence:
MASQWQGMRTSVRRRSLLKEEQLEKEVTRSAGGHLETGPLGSLCRQFQRRLPLRAVSLNLGNGPSWKRLETPEPEQQGLQAAARSAKSALGAMSQRIQESCQSGTKWLMETQVRVRRKRGAQKDRGSP
hide sequence
RefSeq Acc Id:
XP_006246822 ⟸ XM_006246760
- Peptide Label:
isoform X1
- UniProtKB:
B0BN57 (UniProtKB/TrEMBL), F7EXP2 (UniProtKB/TrEMBL)
- Sequence:
MASQWQGMRTSVRRRSLLKEEQLEKEVTRSAGGHLETGPLGSLCRQFQRRLPLRAVSLNLGNGPSWKRLETPEPEQQGLQAAARSAKSALGAMSQRIQESCQSGTKWLMETQVRVRRKRGAQKDRGSP
hide sequence
Ensembl Acc Id:
ENSRNOP00000010975 ⟸ ENSRNOT00000010975
RGD ID: 13697384 Promoter ID: EPDNEW_R7907 Type: initiation region Name: Pimreg_1 Description: PICALM interacting mitotic regulator SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 58,613,659 - 58,613,719 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-03-07
Pimreg
PICALM interacting mitotic regulator
Fam64a
family with sequence similarity 64, member A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-07
Fam64a
family with sequence similarity 64, member A
RGD1308747_predicted
similar to hypothetical protein FLJ10156 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
RGD1308747_predicted
similar to hypothetical protein FLJ10156 (predicted)
LOC360559_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC360559_predicted
similar to hypothetical protein FLJ10156 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
