Bdp1 (BDP1 general transcription factor IIIB subunit) - Rat Genome Database

Bdp1 (BDP1 general transcription factor IIIB subunit) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Bdp1 (BDP1 general transcription factor IIIB subunit) Rattus norvegicus

Subscribe to Updates

Symbol:

Bdp1

Name:

BDP1 general transcription factor IIIB subunit (Ensembl:B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB)

RGD ID:

1308512

Description:

Predicted to enable TFIIIC-class transcription factor complex binding activity. Predicted to be involved in RNA polymerase III preinitiation complex assembly. Predicted to be located in nucleoplasm. Predicted to be part of transcription factor TFIIIB complex. Human ortholog(s) of this gene implicated in autosomal recessive nonsyndromic deafness 112. Orthologous to human BDP1 (BDP1 general transcription factor IIIB subunit); PARTICIPATES IN RNA polymerase III transcription pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; acetamide.

Type:

protein-coding

RefSeq Status:

Previously known as:

B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB; LOC294687; transcription factor TFIIIB component B'' homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	33,112,518 - 33,204,270 (-)	NCBI		GRCr8
mRatBN7.2	2	31,378,407 - 31,470,140 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	31,378,924 - 31,470,119 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	38,456,513 - 38,547,899 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	36,550,865 - 36,642,249 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	31,343,881 - 31,435,274 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	30,248,458 - 30,340,211 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	30,250,633 - 30,340,208 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	49,486,780 - 49,499,375 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	31,035,334 - 31,127,835 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	30,958,250 - 31,048,519 (-)	NCBI
Celera	2	27,479,805 - 27,492,400 (-)	NCBI		Celera
Cytogenetic Map	2	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bdp1	Rat	3-methylcrotonyl-CoA carboxylase 2 deficiency		ISO	RGD:1318324	8554872	ClinVar Annotator: match by term: 3-methylcrotonyl-CoA carboxylase 2 deficiency	ClinVar	PMID:28492532
Bdp1	Rat	autosomal recessive nonsyndromic deafness 112		ISO	RGD:1318324	8554872	ClinVar Annotator: match by term: BDP1-related condition \| ClinVar Annotator: match by term: DEAFNESS, AUTOSOMAL more ...	ClinVar	PMID:24312468\|PMID:25741868\|PMID:26467025
Bdp1	Rat	Deafness		ISO	RGD:1318324	8554872	ClinVar Annotator: match by term: Deafness	ClinVar
Bdp1	Rat	Hearing Loss		ISO	RGD:1318324	8554872	ClinVar Annotator: match by term: Hearing impairment	ClinVar	PMID:30311386
Bdp1	Rat	Neurodevelopmental Disorders		ISO	RGD:1318324	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Bdp1	Rat	Waardenburg syndrome		ISO	RGD:1318324	8554872	ClinVar Annotator: match by term: Waardenburg syndrome	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bdp1	Rat	autosomal recessive nonsyndromic deafness 112		ISO	RGD:1318324	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bdp1	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1556946	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of BDP1 mRNA	CTD	PMID:36331819
Bdp1	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:1556946	6480464	ethylene dichloride results in decreased expression of BDP1 mRNA	CTD	PMID:28960355
Bdp1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1556946	6480464	1,2-Dimethylhydrazine results in decreased expression of BDP1 mRNA	CTD	PMID:22206623
Bdp1	Rat	17beta-estradiol	decreases expression	ISO	RGD:1556946	6480464	Estradiol results in decreased expression of BDP1 mRNA	CTD	PMID:39298647
Bdp1	Rat	17beta-estradiol	increases expression	ISO	RGD:1318324	6480464	Estradiol results in increased expression of BDP1 mRNA	CTD	PMID:31614463
Bdp1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1318324	6480464	Tetrachlorodibenzodioxin affects the expression of BDP1 mRNA	CTD	PMID:22574217
Bdp1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of BDP1 mRNA	CTD	PMID:32109520\|PMID:34747641
Bdp1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1318324	6480464	[Tetrachlorodibenzodioxin co-treated with 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide] results in increased expression of BDP1 mRNA	CTD	PMID:29704546
Bdp1	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2,4-dinitrotoluene affects the expression of BDP1 mRNA	CTD	PMID:21346803
Bdp1	Rat	3,4-methylenedioxymethamphetamine	decreases methylation	ISO	RGD:1556946	6480464	N-Methyl-3,4-methylenedioxyamphetamine results in decreased methylation of BDP1 promoter	CTD	PMID:26251327
Bdp1	Rat	3,4-methylenedioxymethamphetamine	decreases expression	ISO	RGD:1556946	6480464	N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of BDP1 mRNA	CTD	PMID:26251327
Bdp1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1556946	6480464	bisphenol S results in increased expression of BDP1 mRNA	CTD	PMID:39298647
Bdp1	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of BDP1 mRNA	CTD	PMID:31881176
Bdp1	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of BDP1 mRNA	CTD	PMID:28959563
Bdp1	Rat	acrylamide	decreases expression	ISO	RGD:1556946	6480464	Acrylamide results in decreased expression of BDP1 mRNA	CTD	PMID:30807115
Bdp1	Rat	aflatoxin B1	increases expression	ISO	RGD:1556946	6480464	Aflatoxin B1 results in increased expression of BDP1 mRNA	CTD	PMID:19770486
Bdp1	Rat	aflatoxin B1	increases mutagenesis	EXP		6480464	Aflatoxin B1 results in increased mutagenesis of BDP1 gene	CTD	PMID:36908029
Bdp1	Rat	aflatoxin M1	decreases expression	ISO	RGD:1318324	6480464	Aflatoxin M1 results in decreased expression of BDP1 mRNA	CTD	PMID:30928695
Bdp1	Rat	arsane	affects methylation	ISO	RGD:1318324	6480464	Arsenic affects the methylation of BDP1 gene	CTD	PMID:25304211
Bdp1	Rat	arsenic atom	affects methylation	ISO	RGD:1318324	6480464	Arsenic affects the methylation of BDP1 gene	CTD	PMID:25304211
Bdp1	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:1318324	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of BDP1 mRNA	CTD	PMID:19150397\|PMID:26238291
Bdp1	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1556946	6480464	Diethylhexyl Phthalate results in decreased expression of BDP1 mRNA	CTD	PMID:33754040
Bdp1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1556946	6480464	Diethylhexyl Phthalate results in increased expression of BDP1 mRNA	CTD	PMID:34319233
Bdp1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of BDP1 mRNA	CTD	PMID:32145629
Bdp1	Rat	bisphenol A	decreases expression	ISO	RGD:1556946	6480464	bisphenol A results in decreased expression of BDP1 mRNA	CTD	PMID:33221593
Bdp1	Rat	butanal	decreases expression	ISO	RGD:1318324	6480464	butyraldehyde results in decreased expression of BDP1 mRNA	CTD	PMID:26079696
Bdp1	Rat	cadmium dichloride	increases expression	ISO	RGD:1318324	6480464	Cadmium Chloride results in increased expression of BDP1 mRNA	CTD	PMID:26472689
Bdp1	Rat	chromium(6+)	multiple interactions	ISO	RGD:1318324	6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression more ...	CTD	PMID:38479592
Bdp1	Rat	clobetasol	decreases expression	ISO	RGD:1556946	6480464	Clobetasol results in decreased expression of BDP1 mRNA	CTD	PMID:27462272
Bdp1	Rat	clorgyline	increases expression	ISO	RGD:1318324	6480464	Clorgyline results in increased expression of BDP1 mRNA	CTD	PMID:19691856
Bdp1	Rat	copper(II) sulfate	increases expression	ISO	RGD:1318324	6480464	Copper Sulfate results in increased expression of BDP1 mRNA	CTD	PMID:19549813
Bdp1	Rat	coumarin	increases phosphorylation	ISO	RGD:1318324	6480464	coumarin results in increased phosphorylation of BDP1 protein	CTD	PMID:35688186
Bdp1	Rat	dibutyl phthalate	increases expression	ISO	RGD:1556946	6480464	Dibutyl Phthalate results in increased expression of BDP1 mRNA	CTD	PMID:21266533
Bdp1	Rat	diuron	decreases expression	ISO	RGD:1318324	6480464	Diuron results in decreased expression of BDP1 mRNA	CTD	PMID:35967413
Bdp1	Rat	dorsomorphin	multiple interactions	ISO	RGD:1318324	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Bdp1	Rat	doxorubicin	affects expression	ISO	RGD:1318324	6480464	Doxorubicin affects the expression of BDP1 mRNA	CTD	PMID:29803840
Bdp1	Rat	FR900359	affects phosphorylation	ISO	RGD:1318324	6480464	FR900359 affects the phosphorylation of BDP1 protein	CTD	PMID:37730182
Bdp1	Rat	geldanamycin	increases expression	ISO	RGD:1318324	6480464	geldanamycin results in increased expression of BDP1 mRNA	CTD	PMID:26705709
Bdp1	Rat	manganese atom	multiple interactions	ISO	RGD:1318324	6480464	[manganese chloride results in increased abundance of Manganese] which results in decreased expression of BDP1 more ...	CTD	PMID:39836092
Bdp1	Rat	manganese(0)	multiple interactions	ISO	RGD:1318324	6480464	[manganese chloride results in increased abundance of Manganese] which results in decreased expression of BDP1 more ...	CTD	PMID:39836092
Bdp1	Rat	manganese(II) chloride	multiple interactions	ISO	RGD:1318324	6480464	[manganese chloride results in increased abundance of Manganese] which results in decreased expression of BDP1 more ...	CTD	PMID:39836092
Bdp1	Rat	methylmercury chloride	decreases expression	ISO	RGD:1318324	6480464	methylmercuric chloride results in decreased expression of BDP1 mRNA	CTD	PMID:28001369
Bdp1	Rat	mono(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1318324	6480464	mono-(2-ethylhexyl)phthalate results in increased expression of BDP1 mRNA	CTD	PMID:38685446
Bdp1	Rat	okadaic acid	increases expression	ISO	RGD:1318324	6480464	Okadaic Acid results in increased expression of BDP1 mRNA	CTD	PMID:38832940
Bdp1	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	RGD:1318324	6480464	perfluorooctane sulfonic acid results in decreased expression of BDP1 mRNA	CTD	PMID:27153767
Bdp1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1556946	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of BDP1 mRNA	CTD	PMID:36331819
Bdp1	Rat	resveratrol	multiple interactions	ISO	RGD:1318324	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of BDP1 mRNA	CTD	PMID:23557933
Bdp1	Rat	SB 431542	multiple interactions	ISO	RGD:1318324	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Bdp1	Rat	sodium fluoride	decreases expression	ISO	RGD:1556946	6480464	Sodium Fluoride results in decreased expression of BDP1 mRNA	CTD	PMID:27862939
Bdp1	Rat	sunitinib	increases expression	ISO	RGD:1318324	6480464	Sunitinib results in increased expression of BDP1 mRNA	CTD	PMID:31533062
Bdp1	Rat	thimerosal	decreases expression	ISO	RGD:1318324	6480464	Thimerosal results in decreased expression of BDP1 mRNA	CTD	PMID:27188386
Bdp1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of BDP1 mRNA	CTD	PMID:34492290
Bdp1	Rat	thiram	increases expression	ISO	RGD:1318324	6480464	Thiram results in increased expression of BDP1 mRNA	CTD	PMID:38568856
Bdp1	Rat	titanium dioxide	decreases expression	ISO	RGD:1556946	6480464	titanium dioxide results in decreased expression of BDP1 mRNA	CTD	PMID:23557971
Bdp1	Rat	trichostatin A	decreases expression	ISO	RGD:1318324	6480464	trichostatin A results in decreased expression of BDP1 mRNA	CTD	PMID:24935251\|PMID:26272509
Bdp1	Rat	trichostatin A	multiple interactions	ISO	RGD:1318324	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Bdp1	Rat	triphenyl phosphate	affects expression	ISO	RGD:1318324	6480464	triphenyl phosphate affects the expression of BDP1 mRNA	CTD	PMID:37042841
Bdp1	Rat	triptonide	decreases expression	ISO	RGD:1556946	6480464	triptonide results in decreased expression of BDP1 mRNA	CTD	PMID:33045310
Bdp1	Rat	troglitazone	decreases expression	ISO	RGD:1556946	6480464	troglitazone results in decreased expression of BDP1 mRNA	CTD	PMID:28973697
Bdp1	Rat	tungsten	decreases expression	ISO	RGD:1556946	6480464	Tungsten results in decreased expression of BDP1 mRNA	CTD	PMID:30912803
Bdp1	Rat	valproic acid	decreases methylation	ISO	RGD:1318324	6480464	Valproic Acid results in decreased methylation of BDP1 gene	CTD	PMID:29154799
Bdp1	Rat	valproic acid	affects splicing	EXP		6480464	Valproic Acid affects the splicing of BDP1 mRNA	CTD	PMID:29427782
Bdp1	Rat	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of BDP1 mRNA	CTD	PMID:29427782
Bdp1	Rat	valproic acid	decreases expression	ISO	RGD:1318324	6480464	Valproic Acid results in decreased expression of BDP1 mRNA	CTD	PMID:23527032\|PMID:24935251
Bdp1	Rat	vorinostat	decreases expression	ISO	RGD:1318324	6480464	vorinostat results in decreased expression of BDP1 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bdp1	Rat	biological_process		ND		1598407	02/2015: no relevant rat data	RGD
Bdp1	Rat	RNA polymerase III preinitiation complex assembly	involved_in	IBA	PANTHER:PTN000532088\|SGD:S000004984	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bdp1	Rat	nucleoplasm	located_in	ISO	RGD:1318324\|UniProtKB:A6H8Y1-1	1624291		RGD	GO_REF:0000052
Bdp1	Rat	transcription factor TFIIIB complex	part_of	IBA	FB:FBgn0032512\|PANTHER:PTN000532088\|SGD:S000004984\|dictyBase:DDB_G0283405	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bdp1	Rat	protein binding	enables	ISO	RGD:1318324	1624291	UniProtKB:O43298 PMID:16542149	RGD	PMID:16542149
Bdp1	Rat	TFIIIC-class transcription factor complex binding	enables	IBA	PANTHER:PTN000532088\|SGD:S000004984	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bdp1	Rat	RNA polymerase III transcription pathway		ISO	RGD:1318324	9685218		RGD
Bdp1	Rat	RNA polymerase III transcription pathway		ISO	RGD:1318324	9588284		RGD

#	Reference Title	Reference Citation
1.	Cell growth- and differentiation-dependent regulation of RNA polymerase III transcription.	Dumay-Odelot H, etal., Cell Cycle. 2010 Sep 15;9(18):3687-99. Epub 2010 Sep 1.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation
7.	A structural perspective on RNA polymerase I and RNA polymerase III transcription machineries.	Vannini A Biochim Biophys Acta. 2013 Mar-Apr;1829(3-4):258-64. doi: 10.1016/j.bbagrm.2012.09.009. Epub 2012 Sep 29.

PMID:12477932

Bdp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	33,112,518 - 33,204,270 (-)	NCBI		GRCr8
mRatBN7.2	2	31,378,407 - 31,470,140 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	31,378,924 - 31,470,119 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	38,456,513 - 38,547,899 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	36,550,865 - 36,642,249 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	31,343,881 - 31,435,274 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	30,248,458 - 30,340,211 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	30,250,633 - 30,340,208 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	49,486,780 - 49,499,375 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	31,035,334 - 31,127,835 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	30,958,250 - 31,048,519 (-)	NCBI
Celera	2	27,479,805 - 27,492,400 (-)	NCBI		Celera
Cytogenetic Map	2	q12	NCBI

BDP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	71,455,651 - 71,578,288 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	71,455,651 - 71,567,820 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	70,751,478 - 70,863,647 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	70,787,198 - 70,899,405 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	70,787,268 - 70,877,060	NCBI
Celera	5	66,647,216 - 66,759,382 (+)	NCBI		Celera
Cytogenetic Map	5	q13.2	NCBI
HuRef	5	65,957,875 - 66,069,434 (+)	NCBI		HuRef
CHM1_1	5	70,184,159 - 70,296,352 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	71,936,967 - 72,059,628 (+)	NCBI		T2T-CHM13v2.0

Bdp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	100,154,502 - 100,244,524 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	100,154,502 - 100,240,578 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	100,017,994 - 100,104,090 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	100,017,994 - 100,104,070 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	100,787,949 - 100,874,025 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	101,118,251 - 101,204,327 (-)	NCBI		MGSCv36	mm8
Celera	13	103,671,638 - 103,757,601 (-)	NCBI		Celera
Cytogenetic Map	13	D1	NCBI
cM Map	13	52.92	NCBI

Bdp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955575	330,683 - 430,269 (+)	NCBI	ChiLan1.0	ChiLan1.0

BDP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	43,745,852 - 44,032,213 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	41,899,476 - 42,107,897 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	43,733,861 - 43,856,941 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	44,378,112 - 44,497,302 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	44,388,582 - 44,497,302 (-)	Ensembl	panpan1.1		panPan2

BDP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	54,654,406 - 54,743,443 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	54,654,481 - 54,740,787 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	51,620,777 - 51,709,962 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	55,167,775 - 55,256,965 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	2	52,230,430 - 52,319,632 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	52,997,336 - 53,086,508 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	53,888,614 - 53,977,868 (+)	NCBI		UU_Cfam_GSD_1.0

Bdp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	185,915,487 - 186,016,971 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936549	4,842,004 - 4,943,399 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BDP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	47,801,315 - 47,908,851 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	47,801,273 - 47,909,513 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	51,748,126 - 51,854,775 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BDP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	65,815,105 - 65,925,928 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	65,814,993 - 65,914,253 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666049	14,557,750 - 14,670,994 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bdp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624905	524,880 - 638,237 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624905	525,302 - 637,951 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in Bdp1
407 total Variants

Assembly: Rnor_6.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
2	30256617	30256618	G	A	snv	LE/Stm (2019), LEXF11/Stm (2020), FXLE18/Stm (2020), LE/Stm (RGD)	View more Information
2	30285159	30285160	C	A	snv	MR/N (MCW), ACI/EurMcwi (RGD), GK/Ox (RGD), DA/OlaHsd (2019), WAG/RijCrl (2020), GK/FarMcwi (2019), ACI/EurMcwi (2019), ACI/N (2020), ACI/N (MCW), ACI/EurMcwi (MCW), WAG/Rij (RGD)	View more Information
2	30293000	30293001	G	C	snv	SBH/Ygl (RGD), CDR, SBH/Ygl (MCW)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	164
Count of miRNA genes:	121
Interacting mature miRNAs:	130
Transcripts:	ENSRNOT00000024023, ENSRNOT00000067722
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	11591100	56591100	Rat
7387318	Stl32	Serum triglyceride level QTL 32	3.2	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	22384627	67384627	Rat
631682	Bp115	Blood pressure QTL 115	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	1	37410502	Rat
10755434	Coatc7	Coat color QTL 7		0.04794	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	30648065	75648065	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
738010	Lnnr3	Liver neoplastic nodule remodeling QTL 3	2.94		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	2	1	41244106	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300160	Hrtrt3	Heart rate QTL 3	3.62		heart pumping trait (VT:2000009)	absolute change in heart rate (CMO:0000534)	2	29971593	51729300	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	20304672	65304672	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
738012	Anxrr3	Anxiety related response QTL 3	3.8		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	2	9023519	54023519	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
10402051	Gdil2	Gastrointestinal dilation QTL 2			enteric ganglion morphology trait (VT:0001045)	length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836)	2	24903853	74786777	Rat
9590095	Sffal3	Serum free fatty acids level QTL 3	6.78	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	2	27157160	72157160	Rat
1331764	Bp205	Blood pressure QTL 205	3.476		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	26999571	43154682	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1600379	Mcs18	Mammary carcinoma susceptibility QTL 18	2.6		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	7887772	42804738	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1643006	Pain1	Pain QTL 1	3.63	0.005	mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	2	26999571	48268661	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
2300168	Bmd47	Bone mineral density QTL 47	6.6	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	2	20662448	65662448	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	81754745	Rat
1578664	Bmd9	Bone mineral QTL density 9	5		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	11852062	49003364	Rat
1357990	Ael1	Aortic elastin QTL 1	3.1	0.00091	aorta elastin amount (VT:0003905)	aortic elastin	2	19076825	64076825	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	16491740	61491740	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat

D2Got368

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	2	33,119,238 - 33,119,338 (+)	Marker Load Pipeline
mRatBN7.2	2	31,385,127 - 31,385,227 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	30,255,180 - 30,255,279	NCBI	Rnor6.0
Rnor_5.0	2	49,413,872 - 49,413,971	UniSTS	Rnor5.0
RGSC_v3.4	2	31,042,348 - 31,042,447	UniSTS	RGSC3.4
Celera	2	27,406,947 - 27,407,046	UniSTS
Cytogenetic Map	2	q12	UniSTS

BF394779

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	31,448,979 - 31,449,070 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	30,319,041 - 30,319,131	NCBI	Rnor6.0
Rnor_5.0	2	49,478,208 - 49,478,298	UniSTS	Rnor5.0
RGSC_v3.4	2	31,106,683 - 31,106,773	UniSTS	RGSC3.4
Celera	2	27,471,263 - 27,471,353	UniSTS
RH 3.4 Map	2	79.6	UniSTS
Cytogenetic Map	2	q12	UniSTS

RH134708

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	31,378,534 - 31,378,723 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	30,248,588 - 30,248,776	NCBI	Rnor6.0
Rnor_5.0	2	49,407,225 - 49,407,413	UniSTS	Rnor5.0
RGSC_v3.4	2	31,035,461 - 31,035,649	UniSTS	RGSC3.4
Celera	2	27,400,332 - 27,400,520	UniSTS
RH 3.4 Map	2	61.7	UniSTS
Cytogenetic Map	2	q12	UniSTS

RH136673

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	31,380,375 - 31,380,530 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	30,250,429 - 30,250,583	NCBI	Rnor6.0
Rnor_5.0	2	49,409,066 - 49,409,220	UniSTS	Rnor5.0
RGSC_v3.4	2	31,037,302 - 31,037,456	UniSTS	RGSC3.4
Celera	2	27,402,173 - 27,402,327	UniSTS
RH 3.4 Map	2	64.2	UniSTS
Cytogenetic Map	2	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001199195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001402161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590703	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281495	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281496	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024023 ⟹ ENSRNOP00000024023

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	31,378,924 - 31,470,119 (-)	Ensembl
Rnor_6.0 Ensembl	2	30,250,633 - 30,340,103 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000067722 ⟹ ENSRNOP00000061997

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	30,327,691 - 30,340,208 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076991

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	30,314,004 - 30,336,079 (-)	Ensembl

RefSeq Acc Id:

NM_001199195 ⟹ NP_001186124

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	33,191,625 - 33,204,241 (-)	NCBI
mRatBN7.2	2	31,457,523 - 31,470,140 (-)	NCBI
Rnor_6.0	2	30,327,613 - 30,340,208 (-)	NCBI
Rnor_5.0	2	49,486,780 - 49,499,375 (-)	NCBI
Celera	2	27,479,805 - 27,492,400 (-)	NCBI

Sequence:

show sequence

AGAAACTTAGCTTTTAGTGTGGCAGGGTCATGAAGAGAAGGCGGTGGCGGGAGAGCGGAGGAGGCGGAGGGGGCGCGAAACTGCGGTAGCTGGCGCTGGGCTGGTGGTTTTGGCTGGGTGGGAGGGCG
AGAGTCCCAGCCCTCGGGCAGCGGCAGGGGCTCTGGGCTGAGCGCGGCCGTGGAGCCGCCGCTCTCGGTCCCCTGGCTCCGCCATGTTCCGCAGGGCACGCCTTAGCGTGAAGCCGAATGTCAGGCCT
GGTGTAGGCACCAGGGGCTCCGCCGCTCCCAATCCCCAACGTGGACCGGAGGCACCTAGGCCTCCCGAGCCTGCCACCGGGTCTGCTCCGAAGCCAGCGGAGCCCACAGATGTGCCTGCGGTCGATTC
CGGGGGAGCGGAACCCCAAGAACAGGCTCCCGGGAGCAGTAATAATGAAAAGACTGGTGATGGAAGTAATGTTGAAGAGTCTAGCACACTGCCCTCTGCTGCTTCACAGAGAAGAAAGCGAGTGTCTG
GCACGTCTAGTCTTGGTCAGCCTCCTGTCAGTGCCCCCTCACAGAGTCGCCCCTTATCTACAGTTAATCACGATGCGCCACAGCCAAACCCTACTCCAGCTAAAGAGAAACAGCCGTGCTCAGACAGA
TACCGAATATATAAAGCCCGCAAACTGAGAGAGATGTTGAAAGAGGAGCTGAGAAAGGAGAAGAAACAGTGGAAAAACAAATTTGCAACAAATGAAAGCCAGAGACCACCAGATCGTTCAAAAATGAC
TATGAGAGACTTCATATATTACCTTCCAGATAGCAATCCGATGACTTCTTCAGTGGAACAAGAAAAGAAATGTGAGAAATCCTTGGCTCCCACCCCAACAAGAGAGCAAGAAAATCAGAGCACGCAAG
ATGCTAATGATAATGAAGATGTGGAAGAGGAGGTGGATGACGGGCCACTTCTGGTTCCTCGAGTAAAAGTGGCAGAAGATGGCTCTATTATTTTAGATGAAGAAAGTTTAACTGTAGAAGTTTTGAGA
ACGAAAGGCCCCTGTGTTGTTGAGGAGAATGATCCTATATTTGAGCGTGGCTCCACAACTACTTATTCCAGCTTTAGGAAAAACTACTACTCAAAGCCGTGGTCCAATAAAGGTAATTAATTCTCATT
AAAAGTTCTTTGGTGTTCTTTTGGAATGAAATGAGCTTTGATTGAAGCTTCGGACTTCTTATAAATAAAATGTAAACTGTTA

hide sequence

RefSeq Acc Id:

NM_001402161 ⟹ NP_001389090

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	33,112,518 - 33,204,241 (-)	NCBI
mRatBN7.2	2	31,378,407 - 31,470,140 (-)	NCBI

RefSeq Acc Id:

XM_063281495 ⟹ XP_063137565

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	33,112,518 - 33,204,270 (-)	NCBI

RefSeq Acc Id:

XM_063281496 ⟹ XP_063137566

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	33,112,518 - 33,204,243 (-)	NCBI

RefSeq Acc Id:

XM_063281497 ⟹ XP_063137567

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	33,112,518 - 33,204,243 (-)	NCBI

RefSeq Acc Id:

XM_063281498 ⟹ XP_063137568

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	33,142,773 - 33,204,243 (-)	NCBI


Protein RefSeqs	NP_001186124	(Get FASTA)	NCBI Sequence Viewer
	NP_001389090	(Get FASTA)	NCBI Sequence Viewer
	XP_063137565	(Get FASTA)	NCBI Sequence Viewer
	XP_063137566	(Get FASTA)	NCBI Sequence Viewer
	XP_063137567	(Get FASTA)	NCBI Sequence Viewer
	XP_063137568	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66983	(Get FASTA)	NCBI Sequence Viewer
	EDM10187	(Get FASTA)	NCBI Sequence Viewer
	EDM10188	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024023
	ENSRNOP00000024023.7
	ENSRNOP00000099095

RefSeq Acc Id:	NP_001186124 ⟸ NM_001199195
- Peptide Label:	isoform 2
- UniProtKB:	B2RZ11 (UniProtKB/TrEMBL)
- Sequence:	show sequence MFRRARLSVKPNVRPGVGTRGSAAPNPQRGPEAPRPPEPATGSAPKPAEPTDVPAVDSGGAEPQEQAPGSSNNEKTGDGSNVEESSTLPSAASQRRKRVSGTSSLGQPPVSAPSQSRPLSTVNHDAPQ PNPTPAKEKQPCSDRYRIYKARKLREMLKEELRKEKKQWKNKFATNESQRPPDRSKMTMRDFIYYLPDSNPMTSSVEQEKKCEKSLAPTPTREQENQSTQDANDNEDVEEEVDDGPLLVPRVKVAEDG SIILDEESLTVEVLRTKGPCVVEENDPIFERGSTTTYSSFRKNYYSKPWSNKGN hide sequence

Ensembl Acc Id:

ENSRNOP00000061997 ⟸ ENSRNOT00000067722

Ensembl Acc Id:

ENSRNOP00000024023 ⟸ ENSRNOT00000024023

RefSeq Acc Id:	NP_001389090 ⟸ NM_001402161
- Peptide Label:	isoform 1

RefSeq Acc Id:	XP_063137565 ⟸ XM_063281495
- Peptide Label:	isoform X1
- UniProtKB:	D3ZDI4 (UniProtKB/TrEMBL)

Protein Domains

Myb-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZDI4-F1-model_v2	AlphaFold	D3ZDI4	1-2486	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

Promoter ID:

Type:

initiation region

Name:

Bdp1_1

Description:

B double prime 1, subunit of RNA polymerase III transcriptioninitiation factor IIIB

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	30,340,193 - 30,340,253	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-54679	BioCyc
Ensembl Genes	ENSRNOG00000017864	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024023	ENTREZGENE
	ENSRNOT00000024023.8	UniProtKB/TrEMBL
	ENSRNOT00000130376	ENTREZGENE
InterPro	Homeodomain-like	UniProtKB/TrEMBL
	SANT/Myb	UniProtKB/TrEMBL
	TFIIIB_B''_Myb	UniProtKB/TrEMBL
KEGG Report	rno:294687	UniProtKB/TrEMBL
NCBI Gene	294687	ENTREZGENE
PANTHER	RNA POLYMERASE III TRANSCRIPTION INITIATION FACTOR B	UniProtKB/TrEMBL
	TRANSCRIPTION FACTOR TFIIIB COMPONENT B'' HOMOLOG	UniProtKB/TrEMBL
Pfam	Myb_DNA-bind_7	UniProtKB/TrEMBL
PhenoGen	Bdp1	PhenoGen
RatGTEx	ENSRNOG00000017864	RatGTEx
SMART	SANT	UniProtKB/TrEMBL
Superfamily-SCOP	SSF46689	UniProtKB/TrEMBL
UniProt	B2RZ11	ENTREZGENE, UniProtKB/TrEMBL
	D3ZDI4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2024-11-07	Bdp1	BDP1 general transcription factor IIIB subunit	Bdp1	B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Bdp1	B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB	Bdp1_predicted	B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Bdp1_predicted	B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB (predicted)			Symbol and Name status set to approved	70820	APPROVED