Symbol:
Mad2l2
Name:
mitotic arrest deficient 2 like 2
RGD ID:
1307499
Description:
Predicted to enable JUN kinase binding activity and RNA polymerase II-specific DNA-binding transcription factor binding activity. Involved in positive regulation of epithelial to mesenchymal transition; positive regulation of extracellular matrix assembly; and positive regulation of gene expression. Predicted to be located in nucleoplasm and spindle. Predicted to be part of anaphase-promoting complex and zeta DNA polymerase complex. Human ortholog(s) of this gene implicated in Fanconi anemia complementation group V. Orthologous to human MAD2L2 (mitotic arrest deficient 2 like 2); PARTICIPATES IN cell cycle pathway, mitotic; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC313702; MAD2 mitotic arrest deficient-like 2; MAD2 mitotic arrest deficient-like 2 (yeast); MAD2-like protein 2; mitotic arrest deficient 2-like protein 2; mitotic spindle assembly checkpoint protein MAD2B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 163,846,678 - 163,859,851 (+) NCBI GRCr8 mRatBN7.2 5 158,563,545 - 158,576,698 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 158,563,567 - 158,576,693 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 161,288,790 - 161,293,471 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 163,110,607 - 163,115,262 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 163,066,954 - 163,071,609 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 164,943,183 - 164,956,255 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 164,950,917 - 164,956,255 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 168,601,233 - 168,614,293 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 165,218,362 - 165,222,828 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 165,228,549 - 165,233,014 (+) NCBI Celera 5 156,851,516 - 156,855,981 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mad2l2 Rat 17alpha-ethynylestradiol multiple interactions ISO Mad2l2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MAD2L2 mRNA CTD PMID:17942748 Mad2l2 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of MAD2L2 mRNA CTD PMID:32145629 Mad2l2 Rat 17beta-estradiol increases expression ISO Mad2l2 (Mus musculus) 6480464 Estradiol results in increased expression of MAD2L2 mRNA CTD PMID:39298647 Mad2l2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO MAD2L2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of MAD2L2 mRNA CTD PMID:12377990 Mad2l2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MAD2L2 mRNA CTD PMID:33387578 Mad2l2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Mad2l2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAD2L2 mRNA CTD PMID:28922406 Mad2l2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAD2L2 mRNA CTD PMID:21215274 Mad2l2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of MAD2L2 mRNA] CTD PMID:21215274 Mad2l2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mad2l2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAD2L2 mRNA CTD PMID:21570461 Mad2l2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mad2l2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MAD2L2 mRNA CTD PMID:17942748 Mad2l2 Rat 4,4'-sulfonyldiphenol increases expression ISO Mad2l2 (Mus musculus) 6480464 bisphenol S results in increased expression of MAD2L2 mRNA CTD PMID:39298647 Mad2l2 Rat 5-fluorouracil decreases expression ISO MAD2L2 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of MAD2L2 protein CTD PMID:16803524 Mad2l2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MAD2L2 mRNA CTD PMID:24780913 Mad2l2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of MAD2L2 mRNA CTD PMID:28959563 Mad2l2 Rat aflatoxin B1 increases expression ISO MAD2L2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of MAD2L2 mRNA CTD PMID:27153756 Mad2l2 Rat aflatoxin B1 increases methylation ISO MAD2L2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MAD2L2 intron CTD PMID:30157460 Mad2l2 Rat Aflatoxin B2 alpha increases methylation ISO MAD2L2 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of MAD2L2 intron CTD PMID:30157460 Mad2l2 Rat all-trans-retinoic acid decreases expression ISO MAD2L2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of MAD2L2 mRNA CTD PMID:33167477 Mad2l2 Rat arsenite(3-) multiple interactions ISO MAD2L2 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to MAD2L2 mRNA] CTD PMID:32406909 Mad2l2 Rat benzo[a]pyrene decreases expression ISO Mad2l2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MAD2L2 mRNA CTD PMID:21715664 Mad2l2 Rat benzo[a]pyrene affects methylation ISO MAD2L2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MAD2L2 5' UTR and Benzo(a)pyrene affects the methylation of MAD2L2 promoter CTD PMID:27901495 Mad2l2 Rat benzo[a]pyrene increases expression ISO Mad2l2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MAD2L2 mRNA CTD PMID:20504355 and PMID:22228805 Mad2l2 Rat beta-lapachone increases expression ISO MAD2L2 (Homo sapiens) 6480464 beta-lapachone results in increased expression of MAD2L2 mRNA CTD PMID:38218311 Mad2l2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Mad2l2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of MAD2L2 mRNA CTD PMID:19850644 Mad2l2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Mad2l2 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of MAD2L2 mRNA] CTD PMID:19850644 Mad2l2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MAD2L2 mRNA CTD PMID:25181051 and PMID:32145629 Mad2l2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MAD2L2 mRNA CTD PMID:34947998 Mad2l2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of MAD2L2 gene CTD PMID:28505145 Mad2l2 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of MAD2L2 promoter CTD PMID:22457795 Mad2l2 Rat cadmium dichloride affects expression EXP 6480464 Cadmium Chloride affects the expression of MAD2L2 mRNA CTD PMID:22110744 Mad2l2 Rat carbamazepine affects expression ISO MAD2L2 (Homo sapiens) 6480464 Carbamazepine affects the expression of MAD2L2 mRNA CTD PMID:25979313 Mad2l2 Rat carbon nanotube increases expression ISO Mad2l2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Mad2l2 Rat CGP 52608 multiple interactions ISO MAD2L2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MAD2L2 gene] CTD PMID:28238834 Mad2l2 Rat chlorpyrifos increases expression ISO Mad2l2 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MAD2L2 mRNA CTD PMID:37019170 Mad2l2 Rat chromium(6+) multiple interactions ISO MAD2L2 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of MAD2L2 mRNA CTD PMID:38479592 Mad2l2 Rat cisplatin decreases expression ISO MAD2L2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of MAD2L2 protein CTD PMID:16803524 Mad2l2 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of MAD2L2 mRNA CTD PMID:26033743 Mad2l2 Rat copper atom multiple interactions ISO MAD2L2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which affects the expression of MAD2L2 mRNA CTD PMID:30911355 Mad2l2 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of MAD2L2 mRNA CTD PMID:26033743 Mad2l2 Rat copper(0) multiple interactions ISO MAD2L2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which affects the expression of MAD2L2 mRNA CTD PMID:30911355 Mad2l2 Rat copper(II) sulfate decreases expression ISO MAD2L2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MAD2L2 mRNA CTD PMID:19549813 Mad2l2 Rat coumestrol increases expression ISO MAD2L2 (Homo sapiens) 6480464 Coumestrol results in increased expression of MAD2L2 mRNA CTD PMID:19167446 Mad2l2 Rat dibenz[a,h]anthracene decreases expression ISO Mad2l2 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Mad2l2 Rat Dibutyl phosphate affects expression ISO MAD2L2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MAD2L2 mRNA CTD PMID:37042841 Mad2l2 Rat dioxygen multiple interactions ISO Mad2l2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of MAD2L2 mRNA CTD PMID:30529165 Mad2l2 Rat diquat increases expression ISO Mad2l2 (Mus musculus) 6480464 Diquat results in increased expression of MAD2L2 mRNA CTD PMID:36851058 Mad2l2 Rat doxorubicin decreases expression ISO MAD2L2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MAD2L2 mRNA CTD PMID:29803840 Mad2l2 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of MAD2L2 mRNA CTD PMID:29391264 Mad2l2 Rat epoxiconazole increases expression ISO Mad2l2 (Mus musculus) 6480464 epoxiconazole results in increased expression of MAD2L2 mRNA CTD PMID:35436446 Mad2l2 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of MAD2L2 mRNA CTD PMID:24136188 Mad2l2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MAD2L2 mRNA CTD PMID:24136188 Mad2l2 Rat hydroxyurea increases mutagenesis ISO Mad2l2 (Mus musculus) 6480464 Hydroxyurea results in increased mutagenesis of MAD2L2 gene CTD PMID:16868089 Mad2l2 Rat methyl methanesulfonate increases expression ISO MAD2L2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of MAD2L2 mRNA CTD PMID:23649840 Mad2l2 Rat N-methyl-N-nitrosourea increases mutagenesis ISO Mad2l2 (Mus musculus) 6480464 Methylnitrosourea results in increased mutagenesis of MAD2L2 gene CTD PMID:16868089 Mad2l2 Rat nickel atom increases expression ISO MAD2L2 (Homo sapiens) 6480464 Nickel results in increased expression of MAD2L2 mRNA CTD PMID:25583101 Mad2l2 Rat ozone multiple interactions ISO Mad2l2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of MAD2L2 mRNA CTD PMID:34911549 Mad2l2 Rat ozone multiple interactions ISO MAD2L2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of MAD2L2 mRNA CTD PMID:35430440 Mad2l2 Rat paracetamol affects expression ISO Mad2l2 (Mus musculus) 6480464 Acetaminophen affects the expression of MAD2L2 mRNA CTD PMID:17562736 Mad2l2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of MAD2L2 mRNA CTD PMID:33387578 Mad2l2 Rat sodium arsenite decreases expression ISO Mad2l2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of MAD2L2 mRNA CTD PMID:19822182 Mad2l2 Rat sodium arsenite increases expression ISO MAD2L2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MAD2L2 mRNA CTD PMID:34032870 Mad2l2 Rat Soman increases expression EXP 6480464 Soman results in increased expression of MAD2L2 mRNA CTD PMID:19281266 Mad2l2 Rat testosterone increases expression ISO MAD2L2 (Homo sapiens) 6480464 Testosterone results in increased expression of MAD2L2 mRNA CTD PMID:33359661 Mad2l2 Rat tetrachloromethane increases expression ISO Mad2l2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of MAD2L2 mRNA CTD PMID:31919559 Mad2l2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MAD2L2 mRNA CTD PMID:34492290 Mad2l2 Rat titanium dioxide decreases methylation ISO Mad2l2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MAD2L2 gene CTD PMID:35295148 Mad2l2 Rat triphenyl phosphate affects expression ISO MAD2L2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MAD2L2 mRNA CTD PMID:37042841 Mad2l2 Rat valproic acid increases expression ISO Mad2l2 (Mus musculus) 6480464 Valproic Acid results in increased expression of MAD2L2 mRNA CTD PMID:21427059 Mad2l2 Rat valproic acid increases expression ISO MAD2L2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MAD2L2 mRNA CTD PMID:23179753 more ... Mad2l2 Rat valproic acid increases methylation ISO MAD2L2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MAD2L2 gene CTD PMID:29154799 Mad2l2 Rat vancomycin decreases expression ISO Mad2l2 (Mus musculus) 6480464 Vancomycin results in decreased expression of MAD2L2 mRNA CTD PMID:18930951 Mad2l2 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of MAD2L2 mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) cadmium dichloride (EXP) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) cisplatin (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) coumestrol (ISO) dibenz[a,h]anthracene (ISO) Dibutyl phosphate (ISO) dioxygen (ISO) diquat (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) finasteride (EXP) flutamide (EXP) hydroxyurea (ISO) methyl methanesulfonate (ISO) N-methyl-N-nitrosourea (ISO) nickel atom (ISO) ozone (ISO) paracetamol (EXP,ISO) sodium arsenite (ISO) Soman (EXP) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP)
Mad2l2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 163,846,678 - 163,859,851 (+) NCBI GRCr8 mRatBN7.2 5 158,563,545 - 158,576,698 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 158,563,567 - 158,576,693 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 161,288,790 - 161,293,471 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 163,110,607 - 163,115,262 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 163,066,954 - 163,071,609 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 164,943,183 - 164,956,255 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 164,950,917 - 164,956,255 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 168,601,233 - 168,614,293 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 165,218,362 - 165,222,828 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 165,228,549 - 165,233,014 (+) NCBI Celera 5 156,851,516 - 156,855,981 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
MAD2L2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 11,674,480 - 11,691,830 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 11,657,230 - 11,691,811 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 11,734,537 - 11,751,616 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 11,657,124 - 11,663,780 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 11,668,802 - 11,675,459 NCBI Celera 1 10,846,601 - 10,863,739 (-) NCBI Celera Cytogenetic Map 1 p36.22 NCBI HuRef 1 10,888,642 - 10,905,769 (-) NCBI HuRef CHM1_1 1 11,722,539 - 11,739,685 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 11,218,548 - 11,235,917 (-) NCBI T2T-CHM13v2.0
Mad2l2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 148,214,615 - 148,230,161 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 148,214,841 - 148,230,156 (+) Ensembl GRCm39 Ensembl GRCm38 4 148,130,158 - 148,145,704 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 148,130,384 - 148,145,699 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 147,514,599 - 147,519,805 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 146,984,290 - 146,989,496 (+) NCBI MGSCv36 mm8 Celera 4 150,401,823 - 150,407,027 (+) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 78.67 NCBI
Mad2l2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955486 2,191,903 - 2,198,538 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955486 2,191,903 - 2,197,193 (+) NCBI ChiLan1.0 ChiLan1.0
MAD2L2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 216,532,737 - 216,550,231 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 215,178,858 - 215,196,364 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 10,436,532 - 10,454,023 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 11,654,963 - 11,671,364 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 11,654,963 - 11,661,526 (-) Ensembl panpan1.1 panPan2
MAD2L2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 84,539,724 - 84,549,402 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 84,545,226 - 84,549,356 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 81,076,962 - 81,081,699 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 85,207,730 - 85,212,516 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 85,201,068 - 85,212,508 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 81,956,536 - 81,961,266 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 82,957,166 - 82,961,884 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 84,020,037 - 84,024,757 (+) NCBI UU_Cfam_GSD_1.0
Mad2l2
MAD2L2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 71,773,154 - 71,786,517 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 71,773,680 - 71,779,192 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 65,692,635 - 65,698,160 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAD2L2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 120,099,928 - 120,115,954 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 120,110,269 - 120,116,083 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 23,977,591 - 23,984,254 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mad2l2
.
Predicted Target Of
Count of predictions: 109 Count of miRNA genes: 56 Interacting mature miRNAs: 60 Transcripts: ENSRNOT00000012193, ENSRNOT00000055658 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1298090 Bp155 Blood pressure QTL 155 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 151006154 161165494 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat
RH132073
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 163,859,350 - 163,859,651 (+) Marker Load Pipeline mRatBN7.2 5 158,576,197 - 158,576,498 (+) MAPPER mRatBN7.2 Rnor_6.0 5 164,955,755 - 164,956,055 NCBI Rnor6.0 Rnor_5.0 5 168,613,793 - 168,614,093 UniSTS Rnor5.0 RGSC_v3.4 5 165,222,328 - 165,222,628 UniSTS RGSC3.4 Celera 5 156,855,481 - 156,855,781 UniSTS RH 3.4 Map 5 1107.5 UniSTS Cytogenetic Map 5 q36 UniSTS
RH133258
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 158,576,936 - 158,577,117 (+) MAPPER mRatBN7.2 Rnor_6.0 5 164,956,494 - 164,956,674 NCBI Rnor6.0 Rnor_5.0 5 168,614,532 - 168,614,712 UniSTS Rnor5.0 RGSC_v3.4 5 165,223,067 - 165,223,247 UniSTS RGSC3.4 Celera 5 156,856,220 - 156,856,400 UniSTS RH 3.4 Map 5 1104.4 UniSTS Cytogenetic Map 5 q36 UniSTS
Mad2l2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 158,572,165 - 158,572,310 (+) MAPPER mRatBN7.2 Rnor_6.0 5 164,951,723 - 164,951,867 NCBI Rnor6.0 Rnor_5.0 5 168,609,761 - 168,609,905 UniSTS Rnor5.0 Celera 5 156,851,450 - 156,851,594 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012193 ⟹ ENSRNOP00000012193
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 164,951,874 - 164,956,248 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000055658 ⟹ ENSRNOP00000052521
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 158,563,567 - 158,576,677 (+) Ensembl Rnor_6.0 Ensembl 5 164,951,789 - 164,956,255 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076305 ⟹ ENSRNOP00000068004
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 164,951,768 - 164,954,766 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000083678 ⟹ ENSRNOP00000070808
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 158,563,576 - 158,576,693 (+) Ensembl Rnor_6.0 Ensembl 5 164,950,917 - 164,956,147 (+) Ensembl
RefSeq Acc Id:
NM_001012106 ⟹ NP_001012106
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,855,170 - 163,859,851 (+) NCBI mRatBN7.2 5 158,572,017 - 158,576,698 (+) NCBI Rnor_6.0 5 164,951,789 - 164,956,255 (+) NCBI Rnor_5.0 5 168,601,233 - 168,614,293 (+) NCBI RGSC_v3.4 5 165,218,362 - 165,222,828 (+) RGD Celera 5 156,851,516 - 156,855,981 (+) RGD
Sequence:
CCCGCGTGCCCGGCTGGGTGCTGTGAGTCCCTACAAACACCCTTCGCGCCCTCCCCCAGGCAGCCAAGGATGACCACCCTCACGCGCCAAGACCTCAACTTCGGCCAAGTGGTGGCCGACGTGCTCTC
hide sequence
RefSeq Acc Id:
NM_001394241 ⟹ NP_001381170
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,855,170 - 163,859,851 (+) NCBI mRatBN7.2 5 158,572,017 - 158,576,698 (+) NCBI
RefSeq Acc Id:
XM_039110095 ⟹ XP_038966023
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,846,678 - 163,859,831 (+) NCBI mRatBN7.2 5 158,563,545 - 158,576,693 (+) NCBI
RefSeq Acc Id:
XM_063287824 ⟹ XP_063143894
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,846,719 - 163,859,403 (+) NCBI
RefSeq Acc Id:
XM_063287825 ⟹ XP_063143895
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,846,719 - 163,859,403 (+) NCBI
RefSeq Acc Id:
XM_063287826 ⟹ XP_063143896
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,850,103 - 163,859,403 (+) NCBI
RefSeq Acc Id:
XM_063287827 ⟹ XP_063143897
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,852,660 - 163,859,403 (+) NCBI
RefSeq Acc Id:
XM_063287828 ⟹ XP_063143898
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,846,719 - 163,859,831 (+) NCBI
RefSeq Acc Id:
XM_063287829 ⟹ XP_063143899
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,852,639 - 163,859,831 (+) NCBI
RefSeq Acc Id:
XM_063287830 ⟹ XP_063143900
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,850,296 - 163,859,831 (+) NCBI
RefSeq Acc Id:
XM_063287831 ⟹ XP_063143901
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,850,077 - 163,859,831 (+) NCBI
RefSeq Acc Id:
XM_063287832 ⟹ XP_063143902
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,855,573 - 163,859,403 (+) NCBI
RefSeq Acc Id:
NP_001012106 ⟸ NM_001012106
- Peptide Label:
isoform 2
- UniProtKB:
D3Z8D9 (UniProtKB/Swiss-Prot)
- Sequence:
MTTLTRQDLNFGQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSIKLGGLKQTVSLTVLGSWR
hide sequence
Ensembl Acc Id:
ENSRNOP00000052521 ⟸ ENSRNOT00000055658
Ensembl Acc Id:
ENSRNOP00000012193 ⟸ ENSRNOT00000012193
Ensembl Acc Id:
ENSRNOP00000070808 ⟸ ENSRNOT00000083678
Ensembl Acc Id:
ENSRNOP00000068004 ⟸ ENSRNOT00000076305
RefSeq Acc Id:
XP_038966023 ⟸ XM_039110095
- Peptide Label:
isoform X2
- UniProtKB:
D3Z8D9 (UniProtKB/Swiss-Prot), Q5PPH8 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001381170 ⟸ NM_001394241
- Peptide Label:
isoform 1
- UniProtKB:
D3Z8D9 (UniProtKB/Swiss-Prot), Q5PPH8 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063143898 ⟸ XM_063287828
- Peptide Label:
isoform X2
- UniProtKB:
Q5PPH8 (UniProtKB/Swiss-Prot), D3Z8D9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063143894 ⟸ XM_063287824
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063143895 ⟸ XM_063287825
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063143901 ⟸ XM_063287831
- Peptide Label:
isoform X2
- UniProtKB:
Q5PPH8 (UniProtKB/Swiss-Prot), D3Z8D9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063143896 ⟸ XM_063287826
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063143900 ⟸ XM_063287830
- Peptide Label:
isoform X2
- UniProtKB:
Q5PPH8 (UniProtKB/Swiss-Prot), D3Z8D9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063143899 ⟸ XM_063287829
- Peptide Label:
isoform X2
- UniProtKB:
Q5PPH8 (UniProtKB/Swiss-Prot), D3Z8D9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063143897 ⟸ XM_063287827
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063143902 ⟸ XM_063287832
- Peptide Label:
isoform X3
RGD ID: 13694264 Promoter ID: EPDNEW_R4782 Type: multiple initiation site Name: Mad2l2_1 Description: mitotic arrest deficient 2 like 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 164,951,770 - 164,951,830 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-03-29
Mad2l2
mitotic arrest deficient 2 like 2
Mad2l2
MAD2 mitotic arrest deficient-like 2 (yeast)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Mad2l2
MAD2 mitotic arrest deficient-like 2 (yeast)
Mad2l2_predicted
MAD2 mitotic arrest deficient-like 2 (yeast) (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Mad2l2_predicted
MAD2 mitotic arrest deficient-like 2 (yeast) (predicted)
Symbol and Name status set to approved
70820 APPROVED
