Advanced Search (OLGA)

Gene: Mad2l2 (mitotic arrest deficient 2 like 2) Chinchilla lanigera

Subscribe to Updates

Analyze

Symbol:

Mad2l2

Name:

mitotic arrest deficient 2 like 2

RGD ID:

9043725

Description:

ENCODES a protein that exhibits JUN kinase binding (ortholog); RNA polymerase II-specific DNA-binding transcription factor binding (ortholog); transcription corepressor activity (ortholog); INVOLVED IN actin filament organization (ortholog); DNA damage response, signal transduction resulting in transcription (ortholog); double-strand break repair (ortholog); ASSOCIATED WITH Asthenozoospermia (ortholog); Charcot-Marie-Tooth disease type 2 (ortholog); chromosome 1p36 deletion syndrome (ortholog); FOUND IN anaphase-promoting complex (ortholog); nucleoplasm (ortholog); nucleus (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

MAD2 mitotic arrest deficient-like 2; MAD2 mitotic arrest deficient-like 2 (yeast); mitotic spindle assembly checkpoint protein MAD2B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955486	2,191,903 - 2,198,538 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955486	2,191,903 - 2,197,193 (+)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mad2l2	Chinchilla	Asthenozoospermia		ISO	MAD2L2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: asthenozoospermia	ClinVar	PMID:25741868
Mad2l2	Chinchilla	Charcot-Marie-Tooth disease type 2		ISO	MAD2L2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth disease type 2	ClinVar	PMID:28492532
Mad2l2	Chinchilla	chromosome 1p36 deletion syndrome		ISO	MAD2L2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 1p36 deletion syndrome	ClinVar
Mad2l2	Chinchilla	Familial Atrial Fibrillation 6		ISO	MAD2L2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Atrial fibrillation more ...	ClinVar	PMID:28492532
Mad2l2	Chinchilla	Fanconi anemia complementation group V		ISO	MAD2L2 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:25741868 more ...
Mad2l2	Chinchilla	oligospermia		ISO	MAD2L2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Oligospermia	ClinVar	PMID:25741868
Mad2l2	Chinchilla	Teratozoospermia		ISO	MAD2L2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Teratozoospermia	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mad2l2	Chinchilla	Fanconi anemia complementation group V		ISO	MAD2L2 (Homo sapiens)	7240710		OMIM

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mad2l2	Chinchilla	actin filament organization	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:19443654	BHF-UCL	PMID:19443654
Mad2l2	Chinchilla	DNA damage response, signal transduction resulting in transcription	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:17296730	UniProt	PMID:17296730
Mad2l2	Chinchilla	double-strand break repair	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:15988022	UniProt	PMID:15988022
Mad2l2	Chinchilla	error-prone translesion synthesis	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:24449906	ComplexPortal	PMID:24449906
Mad2l2	Chinchilla	negative regulation of canonical Wnt signaling pathway	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:19443654	BHF-UCL	PMID:19443654
Mad2l2	Chinchilla	negative regulation of cell-cell adhesion mediated by cadherin	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:19443654	BHF-UCL	PMID:19443654
Mad2l2	Chinchilla	negative regulation of double-strand break repair via homologous recombination	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:29656893	UniProt	PMID:29656893
Mad2l2	Chinchilla	negative regulation of epithelial to mesenchymal transition	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:19443654	BHF-UCL	PMID:19443654
Mad2l2	Chinchilla	negative regulation of protein catabolic process	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:11459826	UniProt	PMID:11459826
Mad2l2	Chinchilla	negative regulation of transcription by competitive promoter binding	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:19443654	BHF-UCL	PMID:19443654
Mad2l2	Chinchilla	negative regulation of transcription by RNA polymerase II	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:19443654	BHF-UCL	PMID:19443654
Mad2l2	Chinchilla	negative regulation of ubiquitin protein ligase activity	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:11459826	UniProt	PMID:11459826
Mad2l2	Chinchilla	positive regulation of DNA-templated transcription	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:17296730	UniProt	PMID:17296730
Mad2l2	Chinchilla	positive regulation of double-strand break repair via nonhomologous end joining	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:29656893	UniProt	PMID:29656893
Mad2l2	Chinchilla	positive regulation of epithelial to mesenchymal transition		ISO	Mad2l2 (Rattus norvegicus)	9068941	TGFb1	RGD	PMID:27488450 and REF_RGD_ID:152995505
Mad2l2	Chinchilla	positive regulation of extracellular matrix assembly		ISO	Mad2l2 (Rattus norvegicus)	9068941		RGD	PMID:27488450 and REF_RGD_ID:152995505
Mad2l2	Chinchilla	positive regulation of gene expression		ISO	Mad2l2 (Rattus norvegicus)	9068941	Fsp1 more ...	RGD	PMID:27488450 and REF_RGD_ID:152995505
Mad2l2	Chinchilla	positive regulation of isotype switching	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:29656893	UniProt	PMID:29656893
Mad2l2	Chinchilla	positive regulation of peptidyl-serine phosphorylation	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:17296730	UniProt	PMID:17296730
Mad2l2	Chinchilla	regulation of cell growth	involved_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:15988022	UniProt	PMID:15988022

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mad2l2	Chinchilla	anaphase-promoting complex	located_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:11459825	UniProt	PMID:11459825
Mad2l2	Chinchilla	nucleoplasm	located_in	ISO	MAD2L2 (Homo sapiens)	9068941		HPA	GO_REF:0000052
Mad2l2	Chinchilla	nucleus	located_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:17541814 and PMID:19443654	UniProt	PMID:17541814 and PMID:19443654
Mad2l2	Chinchilla	spindle	located_in	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:21063390	UniProt	PMID:21063390
Mad2l2	Chinchilla	zeta DNA polymerase complex	part_of	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:20164194	UniProt	PMID:20164194
Mad2l2	Chinchilla	zeta DNA polymerase complex	part_of	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:24449906	ComplexPortal	PMID:24449906

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mad2l2	Chinchilla	JUN kinase binding	enables	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:17296730	UniProt	PMID:17296730
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:O60673	9068941	PMID:22828282	IntAct	PMID:22828282
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:O14672 more ...	9068941	PMID:10527948	BHF-UCL	PMID:10527948
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:A8K8P3-4 more ...	9068941	PMID:25416956	IntAct	PMID:25416956
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:P18011 more ...	9068941	PMID:17719540	IntAct	PMID:17719540
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:Q86V20	9068941	PMID:29789392	UniProt	PMID:29789392
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:Q6ZNX1 and UniProtKB:Q96JM3	9068941	PMID:29656893	IntAct	PMID:29656893
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:O15499 more ...	9068941	PMID:32296183	IntAct	PMID:32296183
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:Q12834 and UniProtKB:Q9UM11	9068941	PMID:11459826	UniProt	PMID:11459826
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:Q96JM3	9068941	PMID:21063390 more ...	IntAct	PMID:21063390 more ...
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:Q6ZNX1 and UniProtKB:Q86V20	9068941	PMID:29656893	UniProt	PMID:29656893
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:Q13443	9068941	PMID:10527948 and PMID:10531379	IntAct	PMID:10527948 and PMID:10531379
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:Q7Z3K3	9068941	PMID:20850016	UniProt	PMID:20850016
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:Q9H869	9068941	PMID:17541814	UniProt	PMID:17541814
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:Q9UBZ9	9068941	PMID:11485998	UniProt	PMID:11485998
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:P50570-2	9068941	PMID:32814053	IntAct	PMID:32814053
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:Q2TB18	9068941	PMID:34354233	UniProt	PMID:34354233
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:P19419	9068941	PMID:17296730	UniProt	PMID:17296730
Mad2l2	Chinchilla	protein binding	enables	ISO	UniProtKB:Q92733	9068941	PMID:11717438	UniProt	PMID:11717438
Mad2l2	Chinchilla	RNA polymerase II-specific DNA-binding transcription factor binding	enables	ISO	UniProtKB:Q9NQB0	9068941	PMID:19443654	BHF-UCL	PMID:19443654
Mad2l2	Chinchilla	transcription corepressor activity	enables	ISO	MAD2L2 (Homo sapiens)	9068941	PMID:19443654	BHF-UCL	PMID:19443654

#	Reference Title	Reference Citation
1.	Transitive Annotation Pipeline	Automated assignment of GO, PW and RDO ISO annotations across species

PMID:30032202

Mad2l2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955486	2,191,903 - 2,198,538 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955486	2,191,903 - 2,197,193 (+)	NCBI	ChiLan1.0	ChiLan1.0

MAD2L2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	11,674,480 - 11,691,830 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	11,657,230 - 11,691,811 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	11,734,537 - 11,751,616 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	11,657,124 - 11,663,780 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	11,668,802 - 11,675,459	NCBI
Celera	1	10,846,601 - 10,863,739 (-)	NCBI		Celera
Cytogenetic Map	1	p36.22	NCBI
HuRef	1	10,888,642 - 10,905,769 (-)	NCBI		HuRef
CHM1_1	1	11,722,539 - 11,739,685 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	11,218,548 - 11,235,917 (-)	NCBI		T2T-CHM13v2.0

Mad2l2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	148,214,615 - 148,230,161 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	148,214,841 - 148,230,156 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	148,130,158 - 148,145,704 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	148,130,384 - 148,145,699 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	147,514,599 - 147,519,805 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	146,984,290 - 146,989,496 (+)	NCBI		MGSCv36	mm8
Celera	4	150,401,823 - 150,407,027 (+)	NCBI		Celera
Cytogenetic Map	4	E2	NCBI
cM Map	4	78.67	NCBI

Mad2l2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	163,846,678 - 163,859,851 (+)	NCBI		GRCr8
mRatBN7.2	5	158,563,545 - 158,576,698 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	158,563,567 - 158,576,693 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	161,288,790 - 161,293,471 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	163,110,607 - 163,115,262 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	163,066,954 - 163,071,609 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	164,943,183 - 164,956,255 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	164,950,917 - 164,956,255 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	168,601,233 - 168,614,293 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	165,218,362 - 165,222,828 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	165,228,549 - 165,233,014 (+)	NCBI
Celera	5	156,851,516 - 156,855,981 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

MAD2L2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	216,532,737 - 216,550,231 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	215,178,858 - 215,196,364 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	10,436,532 - 10,454,023 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	11,654,963 - 11,671,364 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	11,654,963 - 11,661,526 (-)	Ensembl	panpan1.1		panPan2

MAD2L2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	84,539,724 - 84,549,402 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	84,545,226 - 84,549,356 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	81,076,962 - 81,081,699 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	85,207,730 - 85,212,516 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	85,201,068 - 85,212,508 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	81,956,536 - 81,961,266 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	82,957,166 - 82,961,884 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	84,020,037 - 84,024,757 (+)	NCBI		UU_Cfam_GSD_1.0

Mad2l2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	34,713,906 - 34,718,120 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	538,625 - 542,901 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	538,703 - 542,901 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MAD2L2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	71,773,154 - 71,786,517 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	71,773,680 - 71,779,192 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	65,692,635 - 65,698,160 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MAD2L2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	120,099,928 - 120,115,954 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	120,110,269 - 120,116,083 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	23,977,591 - 23,984,254 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mad2l2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624818	1,282,082 - 1,286,997 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624818	1,274,553 - 1,286,750 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_005403996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01058994	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBDI01170196	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSCLAT00000006248 ⟹ ENSCLAP00000006145

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0 Ensembl	NW_004955486	2,191,903 - 2,198,538 (+)	Ensembl

RefSeq Acc Id:

XM_005403996 ⟹ XP_005404053

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955486	2,191,903 - 2,197,193 (+)	NCBI

Sequence:

show sequence

ACCGCGGACGTCACCGAGCGGCGCCGAGGCGGCGCGCGGGTTGAGTGGGAGGCGGGAGTGATCGGTTCGGCGGCTCGCGGCGCTGGGGCTCCGACCCGAACCCAGGCGGGGACGGAGGCCGGAGCCCA
CACCTGGGAGGCGGAAAGGGCGGGATTCCCTCAGGGGAGGGACTCGGCCGGGTAGGAGGCGGGACTTCCCCCCGCCGGGCTGCGCTTTCCGCGTGTCCGGCTTTGCGCTCCGGCCCTGCGCCTCCAGG
TGTTTTTCTCCGCGTCCGCGGCCCGGCGCGGCTTGCGCGCACAGCTGGGTTTTTCCCTGCACCCCGCCCCGGTGGAACGAGGCCGATCGGGGCGCGGCGTTGCCCCCAGGCCGTGACACCGACGTGGG
GGGTCCTCCGCAGCTGTCCTGATCGGGGCAGAGGGGACGCCCTGCCCCGGCCTCCCCACACCGAGGCGAACCACCTGACCCGCGACGCCAGCTCGCGGCAGGAAGGATGACCACGCTTACGCGACAGG
ACCTCAACTTTGGCCAAGTGGTGGCCGACGTGCTCTGCGAGTTCCTGGAGGTGGCCGTGCACCTGATCCTGTACGTGCGCGAGGTCTACCCGGTGGGCATCTTCCAAAAGCGCAAGAAGTACAACGTA
CCGGTGCAGATGTCCTGCCATCCGGAGCTGAATCAGTACATCCAGGACACGCTGCACTGTGTCAAGCCACTCCTGGAGAAGAACGATGTGGAAAAAGTGGTGGTGGTGATTTTGGATAAAGAGCATCG
ACCCGTGGAGAAGTTCGTCTTTGAGATCACTCAGCCTCCCTTGCTGTCTATCAGCTCTGACTCTTTGCTGTCCCATGTGGAGCAGCTGCTCCGAGCCTTCATCCTGAAGATCAGTGTGTGTGATGCCG
TCCTGGACCACAATCCACCAGGCTGCACTTTCACCGTCCTGGTGCACACGAGAGAAGCTGCCACTCGAAACATGGAGAAGATCCAGGTCATCAAGGACTTCCCTTGGATCCTAGCAGACGAGCAGGAC
GTCCACATGCATGACCCCCGGCTGATACCCCTGAAAACCATGACGTCGGACATTTTAAAGATGCAGCTCTATGTTGAAGAGCGAGCTCATAAAAGCAGCTGAGGATGAGCCTGCACCCACCGATGATG
CCACGACTGTCTGACCAGGGACCCGGCTGCGGACAGCGCCGCGGGCCCCACCTCCAAGTGCTCTTCCTGCTCCTCACAGGCGCCTGCCCGCCATCTGGGGCTGCTTAGGTCTGCCTGGCTTCGTGGAG
GAGGCGTCCCCAGGAAGGCAGTGAGAGACGCTGGGACCTCAATTTCTCATCTCTTGGGGCTCAGCCGGCTAACACTGTCTGTCTCAAATACTGTGAGTTGTTTCAATAAAGTGCCCCAAGGGCTGGCT
GGGGTGTCCCTCTCCAGAATGAAAGGGACAGGTGCAGCCGGGTGAA

hide sequence


Protein RefSeqs	XP_005404053	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSCLAP00000006145
	ENSCLAP00000006145.1

RefSeq Acc Id:

XP_005404053 ⟸ XM_005403996

- UniProtKB:

A0A8C2V1A3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFIL
KISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKSS

hide sequence

Ensembl Acc Id:

ENSCLAP00000006145 ⟸ ENSCLAT00000006248

Protein Domains

HORMA

Database	Acc Id	Source(s)
Ensembl Genes	ENSCLAG00000004348	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSCLAT00000006248	ENTREZGENE
	ENSCLAT00000006248.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.900.10	UniProtKB/TrEMBL
InterPro	HORMA_dom	UniProtKB/TrEMBL
	HORMA_dom_sf	UniProtKB/TrEMBL
	Mad2-like	UniProtKB/TrEMBL
NCBI Gene	Mad2l2	ENTREZGENE
PANTHER	MITOTIC SPINDLE ASSEMBLY CHECKPOINT PROTEIN MAD2B	UniProtKB/TrEMBL
	PTHR11842	UniProtKB/TrEMBL
Pfam	HORMA	UniProtKB/TrEMBL
PROSITE	HORMA	UniProtKB/TrEMBL
Superfamily-SCOP	SSF56019	UniProtKB/TrEMBL
UniProt	A0A8C2V1A3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-02-28	Mad2l2	mitotic arrest deficient 2 like 2		MAD2 mitotic arrest deficient-like 2 (yeast)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM