Symbol:
Il17ra
Name:
interleukin 17 receptor A
RGD ID:
1306559
Description:
Predicted to enable interleukin-17 receptor activity and signaling receptor binding activity. Involved in cellular response to cytokine stimulus. Predicted to be located in plasma membrane. Human ortholog(s) of this gene implicated in immunodeficiency 51. Orthologous to human IL17RA (interleukin 17 receptor A); PARTICIPATES IN cytokine mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Il17r; interleukin 17 receptor; interleukin-17 receptor A; LOC312679
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 155,339,742 - 155,362,382 (+) NCBI GRCr8 mRatBN7.2 4 153,667,534 - 153,690,174 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 153,667,534 - 153,690,174 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 159,942,994 - 159,965,630 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 155,726,725 - 155,749,362 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 154,350,081 - 154,372,717 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 152,995,865 - 153,018,394 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 152,995,865 - 153,018,394 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 220,083,472 - 220,106,001 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 156,838,353 - 156,862,345 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 157,083,050 - 157,107,186 (+) NCBI Celera 4 142,518,868 - 142,541,353 (+) NCBI Celera Cytogenetic Map 4 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Il17ra Rat (+)-catechin multiple interactions ISO IL17RA (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of IL17RA mRNA CTD PMID:24763279 Il17ra Rat (1->4)-beta-D-glucan multiple interactions ISO Il17ra (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of IL17RA mRNA CTD PMID:36331819 Il17ra Rat 1,2-dimethylhydrazine increases expression ISO Il17ra (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of IL17RA mRNA CTD PMID:22206623 Il17ra Rat 17alpha-ethynylestradiol increases expression ISO Il17ra (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of IL17RA mRNA CTD PMID:12072388 and PMID:36329302 Il17ra Rat 17beta-estradiol affects expression ISO Il17ra (Mus musculus) 6480464 Estradiol affects the expression of IL17RA mRNA CTD PMID:15598610 Il17ra Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of IL17RA mRNA CTD PMID:22298810 Il17ra Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of IL17RA mRNA CTD PMID:34747641 Il17ra Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Il17ra (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of IL17RA mRNA CTD PMID:25975270 Il17ra Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of IL17RA mRNA CTD PMID:21215274 Il17ra Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of IL17R mRNA CTD PMID:21346803 Il17ra Rat 2-hydroxypropanoic acid decreases expression ISO IL17RA (Homo sapiens) 6480464 Lactic Acid results in decreased expression of IL17RA mRNA CTD PMID:30851411 Il17ra Rat 4,4'-sulfonyldiphenol decreases expression ISO Il17ra (Mus musculus) 6480464 bisphenol S results in decreased expression of IL17RA mRNA CTD PMID:39298647 Il17ra Rat 4,4'-sulfonyldiphenol increases methylation ISO IL17RA (Homo sapiens) 6480464 bisphenol S results in increased methylation of IL17RA gene CTD PMID:31601247 Il17ra Rat 4-hydroxyphenyl retinamide increases expression ISO Il17ra (Mus musculus) 6480464 Fenretinide results in increased expression of IL17RA mRNA CTD PMID:28973697 Il17ra Rat 7,12-dimethyltetraphene multiple interactions ISO Il17ra (Mus musculus) 6480464 IL17RA results in increased susceptibility to [9 more ... CTD PMID:22359662 Il17ra Rat acrylamide increases expression ISO IL17RA (Homo sapiens) 6480464 Acrylamide results in increased expression of IL17RA mRNA CTD PMID:32763439 Il17ra Rat aflatoxin B1 increases methylation ISO IL17RA (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of IL17RA gene CTD PMID:27153756 Il17ra Rat aldehydo-D-glucose increases expression ISO Il17ra (Mus musculus) 6480464 Glucose results in increased expression of IL17RA mRNA CTD PMID:18310510 Il17ra Rat all-trans-retinoic acid decreases expression ISO IL17RA (Homo sapiens) 6480464 Tretinoin results in decreased expression of IL17RA mRNA CTD PMID:33167477 Il17ra Rat antirheumatic drug decreases expression ISO IL17RA (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of IL17RA mRNA CTD PMID:24449571 Il17ra Rat aristolochic acid A increases expression ISO IL17RA (Homo sapiens) 6480464 aristolochic acid I results in increased expression of IL17RA mRNA CTD PMID:33212167 Il17ra Rat benzene decreases expression ISO Il17ra (Mus musculus) 6480464 Benzene results in decreased expression of IL17RA mRNA CTD PMID:15120971 and PMID:15122651 Il17ra Rat benzo[a]pyrene affects methylation ISO IL17RA (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of IL17RA promoter CTD PMID:27901495 Il17ra Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of IL17RA mRNA CTD PMID:25181051 Il17ra Rat buta-1,3-diene decreases expression ISO Il17ra (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of IL17RA mRNA CTD PMID:29038090 Il17ra Rat Butylbenzyl phthalate increases expression ISO Il17ra (Mus musculus) 6480464 butylbenzyl phthalate results in increased expression of IL17R mRNA CTD PMID:32308655 Il17ra Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of IL17RA mRNA CTD PMID:19167457 Il17ra Rat calcitriol increases expression ISO IL17RA (Homo sapiens) 6480464 Calcitriol results in increased expression of IL17R mRNA CTD PMID:21592394 Il17ra Rat calcitriol multiple interactions ISO IL17RA (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of IL17R mRNA CTD PMID:21592394 Il17ra Rat carbon nanotube increases expression ISO Il17ra (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Il17ra Rat copper(II) sulfate increases expression ISO IL17RA (Homo sapiens) 6480464 Copper Sulfate results in increased expression of IL17RA mRNA CTD PMID:19549813 Il17ra Rat cyanidin cation multiple interactions ISO Il17ra (Mus musculus) 6480464 cyanidin inhibits the reaction [[IL17A protein co-treated with Freund's Adjuvant] results in increased expression of IL17RA mRNA] and cyanidin inhibits the reaction [[IL17A protein co-treated with Freund's Adjuvant] results in increased expression of IL17RA protein] CTD PMID:32044269 Il17ra Rat cyclosporin A increases expression ISO Il17ra (Mus musculus) 6480464 Cyclosporine results in increased expression of IL17RA mRNA CTD PMID:23958496 Il17ra Rat D-glucose increases expression ISO Il17ra (Mus musculus) 6480464 Glucose results in increased expression of IL17RA mRNA CTD PMID:18310510 Il17ra Rat dibutyl phthalate increases expression ISO Il17ra (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of IL17RA mRNA CTD PMID:17361019 Il17ra Rat dioxygen multiple interactions ISO Il17ra (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of IL17RA mRNA CTD PMID:30529165 Il17ra Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of IL17RA mRNA CTD PMID:33729688 Il17ra Rat disodium selenite increases expression ISO IL17RA (Homo sapiens) 6480464 Sodium Selenite results in increased expression of IL17R mRNA CTD PMID:18175754 Il17ra Rat dorsomorphin multiple interactions ISO IL17RA (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IL17RA mRNA CTD PMID:27188386 Il17ra Rat doxorubicin decreases expression ISO IL17RA (Homo sapiens) 6480464 Doxorubicin results in decreased expression of IL17RA mRNA CTD PMID:29803840 Il17ra Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of IL17RA mRNA CTD PMID:29391264 Il17ra Rat fluoranthene multiple interactions ISO Il17ra (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of IL17RA mRNA CTD PMID:28329830 Il17ra Rat FR900359 increases phosphorylation ISO IL17RA (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of IL17RA protein CTD PMID:37730182 Il17ra Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of IL17R mRNA CTD PMID:22061828 Il17ra Rat glucose increases expression ISO Il17ra (Mus musculus) 6480464 Glucose results in increased expression of IL17RA mRNA CTD PMID:18310510 Il17ra Rat microcystin-LR increases expression ISO Il17ra (Mus musculus) 6480464 cyanoginosin LR results in increased expression of IL17RA mRNA CTD PMID:37342990 Il17ra Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of IL17RA mRNA CTD PMID:24136188 Il17ra Rat nickel atom decreases expression ISO IL17RA (Homo sapiens) 6480464 Nickel results in decreased expression of IL17RA mRNA CTD PMID:23195993 Il17ra Rat nickel atom increases expression ISO IL17RA (Homo sapiens) 6480464 Nickel results in increased expression of IL17RA mRNA CTD PMID:24768652 and PMID:25583101 Il17ra Rat ozone multiple interactions ISO Il17ra (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of IL17RA mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of IL17RA mRNA CTD PMID:34911549 Il17ra Rat ozone multiple interactions ISO IL17RA (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of IL17RA mRNA CTD PMID:35430440 Il17ra Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of IL17RA mRNA CTD PMID:35737395 Il17ra Rat paracetamol affects expression ISO Il17ra (Mus musculus) 6480464 Acetaminophen affects the expression of IL17RA mRNA CTD PMID:17562736 Il17ra Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of IL17RA mRNA CTD PMID:33387578 Il17ra Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Il17ra (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of IL17RA mRNA CTD PMID:36331819 Il17ra Rat phorbol 13-acetate 12-myristate multiple interactions ISO Il17ra (Mus musculus) 6480464 [IL17RA gene mutant form results in decreased susceptibility to Tetradecanoylphorbol Acetate] which results in decreased expression of IL1B protein more ... CTD PMID:22359662 Il17ra Rat phorbol 13-acetate 12-myristate decreases response to substance ISO Il17ra (Mus musculus) 6480464 IL17RA gene mutant form results in decreased susceptibility to Tetradecanoylphorbol Acetate CTD PMID:22359662 Il17ra Rat pregnenolone 16alpha-carbonitrile increases expression ISO Il17ra (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of IL17RA mRNA CTD PMID:28903501 Il17ra Rat prostaglandin E2 multiple interactions ISO Il17ra (Mus musculus) 6480464 IL17RA gene mutant form inhibits the reaction [[Tetradecanoylphorbol Acetate results in increased expression of PTGS2 protein] which results in increased abundance of Dinoprostone] CTD PMID:22359662 Il17ra Rat rac-lactic acid decreases expression ISO IL17RA (Homo sapiens) 6480464 Lactic Acid results in decreased expression of IL17RA mRNA CTD PMID:30851411 Il17ra Rat SB 431542 multiple interactions ISO IL17RA (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IL17RA mRNA CTD PMID:27188386 Il17ra Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of IL17RA mRNA CTD PMID:21602193 and PMID:32721576 Il17ra Rat silicon dioxide multiple interactions ISO Il17ra (Mus musculus) 6480464 IL17R protein affects the reaction [Silicon Dioxide results in increased activity of MPO protein] more ... CTD PMID:20421647 Il17ra Rat silicon dioxide increases response to substance ISO Il17ra (Mus musculus) 6480464 IL17R results in increased susceptibility to Silicon Dioxide CTD PMID:20421647 Il17ra Rat sodium arsenite increases expression ISO IL17RA (Homo sapiens) 6480464 sodium arsenite results in increased expression of IL17RA mRNA CTD PMID:38568856 Il17ra Rat sodium fluoride increases expression ISO Il17ra (Mus musculus) 6480464 Sodium Fluoride results in increased expression of IL17RA mRNA and Sodium Fluoride results in increased expression of IL17RA protein CTD PMID:30225638 Il17ra Rat Soman increases expression EXP 6480464 Soman results in increased expression of IL17R mRNA CTD PMID:19281266 Il17ra Rat sunitinib decreases expression ISO IL17RA (Homo sapiens) 6480464 Sunitinib results in decreased expression of IL17RA mRNA CTD PMID:31533062 Il17ra Rat tacrolimus hydrate increases expression ISO Il17ra (Mus musculus) 6480464 Tacrolimus results in increased expression of IL17RA mRNA CTD PMID:23958496 Il17ra Rat tamoxifen increases expression ISO Il17ra (Mus musculus) 6480464 Tamoxifen results in increased expression of IL17RA mRNA CTD PMID:25123088 Il17ra Rat tamoxifen affects expression ISO Il17ra (Mus musculus) 6480464 Tamoxifen affects the expression of IL17RA mRNA CTD PMID:20937368 Il17ra Rat testosterone increases expression ISO IL17RA (Homo sapiens) 6480464 Testosterone results in increased expression of IL17R mRNA CTD PMID:21592394 Il17ra Rat testosterone multiple interactions ISO IL17RA (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of IL17R mRNA CTD PMID:21592394 Il17ra Rat thimerosal decreases expression ISO IL17RA (Homo sapiens) 6480464 Thimerosal results in decreased expression of IL17RA mRNA CTD PMID:27188386 Il17ra Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of IL17RA mRNA CTD PMID:34492290 Il17ra Rat titanium dioxide increases expression ISO Il17ra (Mus musculus) 6480464 titanium dioxide results in increased expression of IL17RA mRNA CTD PMID:27760801 Il17ra Rat titanium dioxide decreases methylation ISO Il17ra (Mus musculus) 6480464 titanium dioxide results in decreased methylation of IL17RA gene CTD PMID:35295148 Il17ra Rat triphenyl phosphate affects expression ISO IL17RA (Homo sapiens) 6480464 triphenyl phosphate affects the expression of IL17RA mRNA CTD PMID:37042841 Il17ra Rat trovafloxacin multiple interactions ISO Il17ra (Mus musculus) 6480464 [trovafloxacin co-treated with lipopolysaccharide and E coli O55-B5] results in increased expression of IL17RA mRNA CTD PMID:18930950 Il17ra Rat valproic acid increases methylation ISO IL17RA (Homo sapiens) 6480464 Valproic Acid results in increased methylation of IL17RA gene CTD PMID:29154799 Il17ra Rat valproic acid multiple interactions ISO IL17RA (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IL17RA mRNA CTD PMID:27188386 Il17ra Rat valproic acid increases expression ISO IL17RA (Homo sapiens) 6480464 Valproic Acid results in increased expression of IL17RA mRNA CTD PMID:23179753 and PMID:26272509 Il17ra Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of IL17R mRNA CTD PMID:19015723
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 7,12-dimethyltetraphene (ISO) acrylamide (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) benzene (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) buta-1,3-diene (ISO) Butylbenzyl phthalate (ISO) C60 fullerene (EXP) calcitriol (ISO) carbon nanotube (ISO) copper(II) sulfate (ISO) cyanidin cation (ISO) cyclosporin A (ISO) D-glucose (ISO) dibutyl phthalate (ISO) dioxygen (EXP,ISO) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) fluoranthene (ISO) FR900359 (ISO) gentamycin (EXP) glucose (ISO) microcystin-LR (ISO) nefazodone (EXP) nickel atom (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phorbol 13-acetate 12-myristate (ISO) pregnenolone 16alpha-carbonitrile (ISO) prostaglandin E2 (ISO) rac-lactic acid (ISO) SB 431542 (ISO) silicon dioxide (EXP,ISO) sodium arsenite (ISO) sodium fluoride (ISO) Soman (EXP) sunitinib (ISO) tacrolimus hydrate (ISO) tamoxifen (ISO) testosterone (ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) trovafloxacin (ISO) valproic acid (ISO) vinclozolin (EXP)
1.
Peripheral and Islet Interleukin-17 Pathway Activation Characterizes Human Autoimmune Diabetes and Promotes Cytokine-Mediated {beta}-Cell Death.
Arif S, etal., Diabetes. 2011 Aug;60(8):2112-9. Epub 2011 Jun 9.
2.
IL-17RA is required for CCL2 expression, macrophage recruitment, and emphysema in response to cigarette smoke.
Chen K, etal., PLoS One. 2011;6(5):e20333. Epub 2011 May 27.
3.
Critical role of IL-17RA in immunopathology of influenza infection.
Crowe CR, etal., J Immunol. 2009 Oct 15;183(8):5301-10. Epub 2009 Sep 25.
4.
Bone marrow derived-mesenchymal stem cells downregulate IL17A dependent IL6/STAT3 signaling pathway in CCl4-induced rat liver fibrosis.
Farouk S, etal., PLoS One. 2018 Oct 22;13(10):e0206130. doi: 10.1371/journal.pone.0206130. eCollection 2018.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Comprehensive gene review and curation
RGD comprehensive gene curation
13.
IL-17A-expressing T cells are essential for bacterial clearance in a murine model of hypersensitivity pneumonitis.
Simonian PL, etal., J Immunol. 2009 May 15;182(10):6540-9.
Il17ra Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 155,339,742 - 155,362,382 (+) NCBI GRCr8 mRatBN7.2 4 153,667,534 - 153,690,174 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 153,667,534 - 153,690,174 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 159,942,994 - 159,965,630 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 155,726,725 - 155,749,362 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 154,350,081 - 154,372,717 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 152,995,865 - 153,018,394 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 152,995,865 - 153,018,394 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 220,083,472 - 220,106,001 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 156,838,353 - 156,862,345 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 157,083,050 - 157,107,186 (+) NCBI Celera 4 142,518,868 - 142,541,353 (+) NCBI Celera Cytogenetic Map 4 q42 NCBI
IL17RA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 17,085,000 - 17,115,693 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 17,084,954 - 17,115,693 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 17,565,890 - 17,596,583 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 15,945,849 - 15,971,405 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 15,940,411 - 15,965,941 NCBI Celera 22 1,188,127 - 1,213,694 (+) NCBI Celera Cytogenetic Map 22 q11.1 NCBI HuRef 22 1,385,786 - 1,416,555 (+) NCBI HuRef CHM1_1 22 17,570,853 - 17,601,396 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 17,761,784 - 17,792,571 (+) NCBI T2T-CHM13v2.0
Il17ra Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 120,440,143 - 120,460,692 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 120,440,208 - 120,464,520 (+) Ensembl GRCm39 Ensembl GRCm38 6 120,463,181 - 120,483,731 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 120,463,247 - 120,487,559 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 120,413,215 - 120,433,745 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 120,428,854 - 120,448,651 (+) NCBI MGSCv36 mm8 Celera 6 122,300,019 - 122,320,559 (+) NCBI Celera Cytogenetic Map 6 F1 NCBI cM Map 6 56.95 NCBI
Il17ra Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955454 5,230,522 - 5,254,394 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955454 5,230,384 - 5,252,769 (+) NCBI ChiLan1.0 ChiLan1.0
IL17RA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 27,397,454 - 27,430,661 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 29,947,499 - 29,981,308 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 511,091 - 541,504 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 15,950,069 - 15,974,865 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 15,950,463 - 15,974,865 (+) Ensembl panpan1.1 panPan2
IL17RA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 44,798,960 - 44,812,287 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 44,791,066 - 44,811,064 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 1,866,105 - 1,888,771 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 45,159,783 - 45,182,452 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 27 45,089,350 - 45,111,971 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 45,061,199 - 45,083,837 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 1,223,566 - 1,246,226 (-) NCBI UU_Cfam_GSD_1.0
Il17ra
IL17RA
Il17ra
.
Predicted Target Of
Count of predictions: 137 Count of miRNA genes: 110 Interacting mature miRNAs: 117 Transcripts: ENSRNOT00000014885 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 1582237 Kidm34 Kidney mass QTL 34 4 0.0001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 4 148090542 168069246 Rat 61446 Coreg2 Compensatory renal growth QTL 2 3.5 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 4 148423102 157580971 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 1581574 Eae20 Experimental allergic encephalomyelitis QTL 20 7.8 nervous system integrity trait (VT:0010566) percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047) 4 153031106 158841762 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 634342 Cia24 Collagen induced arthritis QTL 24 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 146565735 175236377 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 12798525 Anxrr57 Anxiety related response QTL 57 3.21 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 147278504 167139601 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014885 ⟹ ENSRNOP00000014885
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 153,667,534 - 153,690,174 (+) Ensembl Rnor_6.0 Ensembl 4 152,995,865 - 153,018,394 (+) Ensembl
RefSeq Acc Id:
NM_001107883 ⟹ NP_001101353
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 155,339,742 - 155,362,382 (+) NCBI mRatBN7.2 4 153,667,534 - 153,690,174 (+) NCBI Rnor_6.0 4 152,995,865 - 153,018,394 (+) NCBI Rnor_5.0 4 220,083,472 - 220,106,001 (+) NCBI RGSC_v3.4 4 156,838,353 - 156,862,345 (+) RGD Celera 4 142,518,868 - 142,541,353 (+) RGD
Sequence:
CGAAGTCGACCTGCGTCAGTCCTCGGCTAGGAAAGCCCGTCGTGGGCCCTCGCTGTCCGGCGGAGCCAGCCGCGAGCGCTCCGCGACCAGGCCGGGGGCCATGGCGACTCCGCGCCGCTGGCCACGGG
hide sequence
RefSeq Acc Id:
NP_001101353 ⟸ NM_001107883
- UniProtKB:
D4A740 (UniProtKB/TrEMBL), A6ILA4 (UniProtKB/TrEMBL)
- Sequence:
MATPRRWPRVVPGPALGWLLLLLSALFRGRASLRLLDFPALVCSQEGLNCRVENSTCLDDSWIYPRNLTPSSPKNIYLHLNVSSTQHGDLVPVLHVEWTLQTDASILYLEGAELSILKLNTNEQLCVK
hide sequence
Ensembl Acc Id:
ENSRNOP00000014885 ⟸ ENSRNOT00000014885
RGD ID: 13693356 Promoter ID: EPDNEW_R3880 Type: initiation region Name: Il17ra_1 Description: interleukin 17 receptor A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 152,995,882 - 152,995,942 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Il17ra
interleukin 17 receptor A
Il17r_predicted
interleukin 17 receptor (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Il17r_predicted
interleukin 17 receptor (predicted)
Symbol and Name status set to approved
70820 APPROVED
