Il17ra (interleukin 17 receptor A)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Il17ra (interleukin 17 receptor A) Rattus norvegicus

Analyze

Symbol:

Il17ra

Name:

interleukin 17 receptor A

RGD ID:

1306559

Description:

Predicted to enable interleukin-17 receptor activity and signaling receptor binding activity. Involved in cellular response to cytokine stimulus. Predicted to be located in plasma membrane. Human ortholog(s) of this gene implicated in immunodeficiency 51. Orthologous to human IL17RA (interleukin 17 receptor A); PARTICIPATES IN cytokine mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Il17r; interleukin 17 receptor; interleukin-17 receptor A; LOC312679

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IL17RA (interleukin 17 receptor A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Il17ra (interleukin 17 receptor A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Il17ra (interleukin 17 receptor A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IL17RA (interleukin 17 receptor A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IL17RA (interleukin 17 receptor A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Il17ra (interleukin 17 receptor A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IL17RA (interleukin 17 receptor A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Il17ra (interleukin 17 receptor A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GALNS (galactosamine (N-acetyl)-6-sulfatase)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	IL17RA (interleukin 17 receptor A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Il17ra (interleukin 17 receptor A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	il17ra1a (interleukin 17 receptor A1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ilcr-1	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	ilcr-2	Alliance	DIOPT (OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	153,667,534 - 153,690,174 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	153,667,534 - 153,690,174 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	159,942,994 - 159,965,630 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	155,726,725 - 155,749,362 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	154,350,081 - 154,372,717 (+)	NCBI	Rnor_WKY
Rnor_6.0	4	152,995,865 - 153,018,394 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	152,995,865 - 153,018,394 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	220,083,472 - 220,106,001 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	156,838,353 - 156,862,345 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	157,083,050 - 157,107,186 (+)	NCBI
Celera	4	142,518,868 - 142,541,353 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

brain ischemia (ISO)

chronic mucocutaneous candidiasis (ISO)

Experimental Liver Cirrhosis (IEP)

extrinsic allergic alveolitis (ISO)

genetic disease (ISO)

Human Influenza (ISO)

immunodeficiency 51 (ISO)

Inflammation (ISO)

Neurodevelopmental Disorders (ISO)

Polyarteritis Nodosa, Childhood-Onset (ISO)

psoriasis (ISO)

pulmonary emphysema (ISO)

viral pneumonia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

7,12-dimethyltetraphene (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

buta-1,3-diene (ISO)

C60 fullerene (EXP)

calcitriol (ISO)

carbon nanotube (ISO)

copper(II) sulfate (ISO)

cyanidin cation (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

dibutyl phthalate (ISO)

dioxygen (EXP,ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

fluoranthene (ISO)

gentamycin (EXP)

glucose (ISO)

nefazodone (EXP)

nickel atom (ISO)

ozone (EXP,ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phorbol 13-acetate 12-myristate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

prostaglandin E2 (ISO)

rac-lactic acid (ISO)

SB 431542 (ISO)

silicon dioxide (EXP,ISO)

sodium fluoride (ISO)

Soman (EXP)

sunitinib (ISO)

tacrolimus hydrate (ISO)

tamoxifen (ISO)

testosterone (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to cytokine stimulus (IDA)

defense response to fungus (ISO)

fibroblast activation (ISO)

granulocyte chemotaxis (ISO)

interleukin-17-mediated signaling pathway (ISO)

interleukin-17A-mediated signaling pathway (ISO)

positive regulation of chemokine (C-X-C motif) ligand 1 production (ISO)

positive regulation of cytokine production involved in inflammatory response (ISO)

positive regulation of inflammatory response (ISO)

positive regulation of interleukin-13 production (ISO)

positive regulation of interleukin-23 production (ISO)

positive regulation of interleukin-5 production (ISO)

positive regulation of interleukin-6 production (ISO)

protein catabolic process (ISO)

response to virus (ISO)

T-helper 17 type immune response (ISO)

Cellular Component

plasma membrane (ISO)

Molecular Function

interleukin-17 receptor activity (IBA,ISO)

protein binding (ISO)

signaling receptor binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cytokine mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Peripheral and Islet Interleukin-17 Pathway Activation Characterizes Human Autoimmune Diabetes and Promotes Cytokine-Mediated {beta}-Cell Death.	Arif S, etal., Diabetes. 2011 Aug;60(8):2112-9. Epub 2011 Jun 9.
2.	IL-17RA is required for CCL2 expression, macrophage recruitment, and emphysema in response to cigarette smoke.	Chen K, etal., PLoS One. 2011;6(5):e20333. Epub 2011 May 27.
3.	Critical role of IL-17RA in immunopathology of influenza infection.	Crowe CR, etal., J Immunol. 2009 Oct 15;183(8):5301-10. Epub 2009 Sep 25.
4.	Bone marrow derived-mesenchymal stem cells downregulate IL17A dependent IL6/STAT3 signaling pathway in CCl4-induced rat liver fibrosis.	Farouk S, etal., PLoS One. 2018 Oct 22;13(10):e0206130. doi: 10.1371/journal.pone.0206130. eCollection 2018.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	IL-17A-expressing T cells are essential for bacterial clearance in a murine model of hypersensitivity pneumonitis.	Simonian PL, etal., J Immunol. 2009 May 15;182(10):6540-9.

Additional References at PubMed

PMID:16785495	PMID:17827167	PMID:17911633	PMID:18768888	PMID:20554964	PMID:21145111	PMID:22851861	PMID:28898718

Genomics

Comparative Map Data

Il17ra
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	153,667,534 - 153,690,174 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	153,667,534 - 153,690,174 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	159,942,994 - 159,965,630 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	155,726,725 - 155,749,362 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	154,350,081 - 154,372,717 (+)	NCBI	Rnor_WKY
Rnor_6.0	4	152,995,865 - 153,018,394 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	152,995,865 - 153,018,394 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	220,083,472 - 220,106,001 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	156,838,353 - 156,862,345 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	157,083,050 - 157,107,186 (+)	NCBI
Celera	4	142,518,868 - 142,541,353 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

IL17RA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	17,085,000 - 17,115,693 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	22	17,084,954 - 17,115,693 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	17,565,890 - 17,596,583 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	15,945,849 - 15,971,405 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	15,940,411 - 15,965,941	NCBI
Celera	22	1,188,127 - 1,213,694 (+)	NCBI		Celera
Cytogenetic Map	22	q11.1	NCBI
HuRef	22	1,385,786 - 1,416,555 (+)	NCBI		HuRef
CHM1_1	22	17,570,853 - 17,601,396 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	17,761,784 - 17,792,571 (+)	NCBI		T2T-CHM13v2.0

Il17ra
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	120,440,143 - 120,460,692 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	120,440,208 - 120,464,520 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	120,463,181 - 120,483,731 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	120,463,247 - 120,487,559 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	120,413,215 - 120,433,745 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	120,428,854 - 120,448,651 (+)	NCBI		MGSCv36	mm8
Celera	6	122,300,019 - 122,320,559 (+)	NCBI		Celera
Cytogenetic Map	6	F1	NCBI
cM Map	6	56.95	NCBI

Il17ra
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955454	5,230,522 - 5,254,394 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955454	5,230,384 - 5,252,769 (+)	NCBI	ChiLan1.0	ChiLan1.0

IL17RA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	22	29,947,499 - 29,981,308 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	511,091 - 541,504 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	15,950,069 - 15,974,865 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	15,950,463 - 15,974,865 (+)	Ensembl	panpan1.1		panPan2

IL17RA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	44,798,960 - 44,812,287 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	44,791,066 - 44,811,064 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	1,866,105 - 1,888,771 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	45,159,783 - 45,182,452 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	27	45,089,350 - 45,111,971 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	45,061,199 - 45,083,837 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	1,223,566 - 1,246,226 (-)	NCBI		UU_Cfam_GSD_1.0

Il17ra
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	110,779,728 - 110,802,955 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936807	143,165 - 165,820 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IL17RA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	69,461,290 - 69,480,112 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	69,461,280 - 69,480,343 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

Il17ra
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624735	10,138,418 - 10,164,198 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624735	10,139,787 - 10,164,074 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Il17ra
81 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	137
Count of miRNA genes:	110
Interacting mature miRNAs:	117
Transcripts:	ENSRNOT00000014885
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	132642577	167139601	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	146565735	175236377	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	147278504	167139601	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	148090542	168069246	Rat
61446	Coreg2	Compensatory renal growth QTL 2	3.5		kidney mass (VT:0002707)	compensatory renal growth score (CMO:0001894)	4	148423102	157580971	Rat
1581574	Eae20	Experimental allergic encephalomyelitis QTL 20	7.8		nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	153031106	158841762	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	6	49	39	19	39			25	35	32	11
Low		37	8	2		2	8	11	49		9		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000014885 ⟹ ENSRNOP00000014885

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	153,667,534 - 153,690,174 (+)	Ensembl
Rnor_6.0 Ensembl	4	152,995,865 - 153,018,394 (+)	Ensembl

RefSeq Acc Id:

NM_001107883 ⟹ NP_001101353

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	153,667,534 - 153,690,174 (+)	NCBI
Rnor_6.0	4	152,995,865 - 153,018,394 (+)	NCBI
Rnor_5.0	4	220,083,472 - 220,106,001 (+)	NCBI
RGSC_v3.4	4	156,838,353 - 156,862,345 (+)	RGD
Celera	4	142,518,868 - 142,541,353 (+)	RGD

Sequence:

show sequence

CGAAGTCGACCTGCGTCAGTCCTCGGCTAGGAAAGCCCGTCGTGGGCCCTCGCTGTCCGGCGGA
GCCAGCCGCGAGCGCTCCGCGACCAGGCCGGGGGCCATGGCGACTCCGCGCCGCTGGCCACGGG
TCGTCCCCGGGCCCGCGCTGGGATGGCTGCTTCTGCTGTTGAGCGCGCTGTTCCGGGGCCGCGC
CTCCCTGCGCCTCCTCGACTTCCCGGCTCTAGTCTGCTCGCAGGAGGGGCTGAACTGCAGAGTC
GAGAATAGTACTTGCCTGGATGACAGCTGGATTTACCCTCGAAACCTGACGCCGTCTTCCCCGA
AAAACATCTATCTCCATCTGAACGTTTCGTCTACCCAGCACGGAGACCTAGTCCCTGTGTTGCA
CGTTGAGTGGACCTTGCAGACAGATGCCAGCATCCTGTATCTCGAGGGTGCAGAGCTGTCCATC
CTGAAGCTGAACACCAATGAGCAGCTGTGTGTCAAGTTCAAGTTTCTGTCCAAGCTGTCGAATC
ATCATAAGCGGTGGCGGTTCTCCTTCAGTCACTTCGTGGTAGATCCTGGCCAGGAGTATGAGGT
GACTGTTCACCACCTGCCCAAGCCCATCCCTGACGGGGACCCAAACCACAAGTCCAAGACCATC
TTAGTGCCTGGCTGCGAGGACACGGAGATGAAGATGACTACACCGTGTGTGAGCTCAGGCAGCC
TTTGGAACCCCAACATCACAGTGGAGACCTTGGACACCCAGCATCTTCGAGTGGACTTCACCCT
GTGGAATGAATCCACCCCCTACCAGATCCTGCTGGAAAGTTTTTCGGGCTCAGAGAACCAGAGC
TGCTTTGAAGACATTAAACAGATATCTGCGCCCGGACAGGAGGAATTCCACCAGCGATCCAATG
TCACATTCACTCTGAGCAAGTCTGGCTGGTGCTGCCACCACCTCGTGCAGGTCCAGCCCTTCTT
CAACAGCTGCCAAAATGACTGCTTGAGACACGCTGTGACTGTGCCCTGCCCAGTCATCTCAGAG
ACCCCAGTTTCCATAACAGCCGCAGACTATATTCCCCTCTGGGTGTATGGCCTCATCACCCTCA
TCGCCATCCTGCTGGTGGGCTCTGTCATCCTGCTGATTATCTGCATGACCTGGAGGCTTTCTGG
TGCTGATCAAGAGAAACATGGAGATGACTCCAAAGTCAATGGCATCTTGCCAACAACAGACCTG
ACTCCCCCACCCCTGCAGCCCAGGAAGGTCTGGATCGTCTACTCGGCTGACCACCCCCTCTATG
TGGACGTGGTCCTAAAGTTCGCCCAGTTCCTGATCACTGCCTGTGGTACTGAAGTAGCCCTTGA
CCTGCTGGAAGAGCAGACCATCTCTGAGATGGGGGTCATGACTTGGGTGAGCCGGCAGAAGCAG
GAAATGGAGGAGAGCGGTTCCAAGATCATCGTCCTGTGCTCCCGAGGGACCCGAGCTAAGTGGA
AAGCCATCTTGGGTTGGGCGGAGCCTGCTGTCCAGCTACGGTGTGACCACTGGAAGCCTGCTGG
GGACCTTTTCACAGCAGCCATGAACATGATTCTACCAGACTTCAAGAGGCCAGCCTGCTTCGGC
ACCTACATTGTTTGCTACTTCAGTGGCATCTGTAACGAGAGGGATGTCCCCGACCTCTTCAACA
TCACCTCCAGGTACCCACTTATGGACAAATTTGAGGAGGTTTACTTCCGGATCCAGGACCTGGA
GATGTTTGAACCTGGCCGGATGCACCATGTCAAAGAGCTCACAGGGGAAAATTACCTGCAGAGC
CCTAGTGGCCGGCAGCTCAAGGAGGCTGTGGTTAGGTTCCAGGAGTGGCAAACCCGGTACCCCG
ACTGGTTTGAGCGAGAGAACCTCTGCTTAGCAGGTGACCAAGACCTTCCATCCCTGGATGAGGA
AGTGTTTGAAGACCCACTGCTGCCACCAGGGGGAAGAATCGTCAAACAGCAGCCCCTGGTGCGG
GAGCTGCCTTCAGAAGGCTGCCTTGTGGTAGATGTCTGTGCCAGGGAGGAAGAAAGTGGAGTGG
TAAAGCTGGAGCCTCAGCTGTGGCCACAAAGACAGCTAATGGCTCAGACCCTCCAAACCTTGGT
GCTGCCAACAGAACAGGTCCCTGCAGCTCATGTGGTGGAGCCTGTCCGTCTTCTAGATGGCACT
GGAGCAGCTACCCAGCTGGCCATTGCCGAGGACGGCGAGGCTTGCCCGCTGCTTGGGGTCCGGA
GGAACAGCATCCTTTGCCTCCCCATGGACTCAGATGACTCGCCTCTCTGTAGCACTCCAATGAT
GTCACCTGACCACCTCCAAGGCGATGCAAGAGAGCAGCTAGAAAGCCTGATGCTCTCGGTGCTG
CAGCATAGCCTGAGCGCACAGGCTCAGGAGGGCTGGCCGAGGCCTGAGGTGGTCCTCAAGGACT
GCATGCCCTCTGAGGAGGAGCAGCGGCAGTCAGTGCAGTCAGACCAGGGCTACATCTCCAGAAG
CTCCCCGCAACCCCCCGACTGGCTCACAGAGGAGGAAGAGCTAGAACTGGGTGAGTCCGGTGAG
TCTCTCTCTCCGGAGGAGCTGCGGAGCCTGAGGAGTGTCCAGCGGCGGCTTTTCTTCTGGGAGC
TTGAGAAGAACCCTGGCTGGGACAGCAGAGGCCAGGAGCAGAAGATCAGCCTCCCCCCTGGGCC
TCCTAATCCTGCTACTTAAGAGGATGTCTGCTGTACTGTGCGTGTGGGGGAAGTGCCCAGCTTG
GAGATACGGGCATCTGCGTCTGACATAGTATTGTATGCCTGAAGTCCCAGCACTTGGGGGCTGG
GACTTGATGGTCTCCTGAACACAGGGGTTCAGGGCCAGCATGAAAACATAGCAAGGTCTCAGAG
AAATAAATGCAGACATCTTGGTTCTGGTCCCTAAACGCTCCCCTGTACCTGATATGGACGGAAC
GTCTGGTCATCATTGCACAAGAGTCCACAGCCCGCTCCCAGAACCAACAGCCAAGTGTGGCGCT
CATTCCTTGAACATTTATTCTGTACCTACTAGTCAGGCATTTGGAATTCAAAAACAAGTTACAT
GACACAGTCTTGGCCACAAAGAAGCTTAACATTCAGTAAAGATGTGAAATTAGCCAGAATGAAC
AGAGGGCCCCTCCCCTGGCCGCAGAAGGGGGGCGGGGATCGGGGTCTGGGCAGGAGGGGAGCTG
CATTCCTGGGGGAGCAGCCTGCGGCTTGGGTATCAAGGAGCCAGAGTAAGCTGTGTGCTAGGGT
GGGAGCAGCTGGGGACTGCTTTCATAAGTGGATCTGCTGCCCTGTGGGGGAGCAAACTGTATGC
CAAAGTTCCCCAGAAGTCTTCTCAGATCGGTTTTTTAGAAAGAGTCAGTATAGAAACGGGTGAT
GCAAACTTAAGAAGCAGGAAGAGGCGTGTGAAATCCTGTGCTCAAGTGCTGGCTGCCAGTCCGT
GGGAGAGCTGAGGCATGTGATTCTTCGTGGGCTGCAGCCACCAGATCCCAGCAGCTTGGGAGTC
TAAGATCCCTCGGCTCTACCTCAGGTACAGTGATGGAGTAAAGAAAGGTGGAGAACATGGCAGG
CTCTCCAAGGTCAGAGGGAAGCATCGCTGTGTAGCTCCGTATGAGAAGCCGCTTTAAGGTAGCT
CCTGGGCGCCCTCTTGGAGCAGACAGCAGCCTTGCAGCACAGGTTCTGGAGAACGCACAGGTCT
GCATGCCCTGGCTACCCACTTCCAATCGTCTCGACTGCAGTGAGAAAAGGACCATGAATGCTGT
GGGAAACGAGAATGCAGTGACTGTGTGTGCTGTAATGAAGACGTAATAAAGTTACTGTTTTGGT
AAGAA

hide sequence

RefSeq Acc Id:

XM_039107660 ⟹ XP_038963588

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	153,667,642 - 153,690,174 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101353	(Get FASTA)	NCBI Sequence Viewer
	XP_038963588	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM02034	(Get FASTA)	NCBI Sequence Viewer
	EDM02035	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001101353 ⟸ NM_001107883

- UniProtKB:

D4A740 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MATPRRWPRVVPGPALGWLLLLLSALFRGRASLRLLDFPALVCSQEGLNCRVENSTCLDDSWIY
PRNLTPSSPKNIYLHLNVSSTQHGDLVPVLHVEWTLQTDASILYLEGAELSILKLNTNEQLCVK
FKFLSKLSNHHKRWRFSFSHFVVDPGQEYEVTVHHLPKPIPDGDPNHKSKTILVPGCEDTEMKM
TTPCVSSGSLWNPNITVETLDTQHLRVDFTLWNESTPYQILLESFSGSENQSCFEDIKQISAPG
QEEFHQRSNVTFTLSKSGWCCHHLVQVQPFFNSCQNDCLRHAVTVPCPVISETPVSITAADYIP
LWVYGLITLIAILLVGSVILLIICMTWRLSGADQEKHGDDSKVNGILPTTDLTPPPLQPRKVWI
VYSADHPLYVDVVLKFAQFLITACGTEVALDLLEEQTISEMGVMTWVSRQKQEMEESGSKIIVL
CSRGTRAKWKAILGWAEPAVQLRCDHWKPAGDLFTAAMNMILPDFKRPACFGTYIVCYFSGICN
ERDVPDLFNITSRYPLMDKFEEVYFRIQDLEMFEPGRMHHVKELTGENYLQSPSGRQLKEAVVR
FQEWQTRYPDWFERENLCLAGDQDLPSLDEEVFEDPLLPPGGRIVKQQPLVRELPSEGCLVVDV
CAREEESGVVKLEPQLWPQRQLMAQTLQTLVLPTEQVPAAHVVEPVRLLDGTGAATQLAIAEDG
EACPLLGVRRNSILCLPMDSDDSPLCSTPMMSPDHLQGDAREQLESLMLSVLQHSLSAQAQEGW
PRPEVVLKDCMPSEEEQRQSVQSDQGYISRSSPQPPDWLTEEEELELGESGESLSPEELRSLRS
VQRRLFFWELEKNPGWDSRGQEQKISLPPGPPNPAT

hide sequence

RefSeq Acc Id:

ENSRNOP00000014885 ⟸ ENSRNOT00000014885

RefSeq Acc Id:	XP_038963588 ⟸ XM_039107660
- Peptide Label:	isoform X1

Protein Domains

SEFIR

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A740-F1-model_v2	AlphaFold	D4A740	1-868	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693356

Promoter ID:

EPDNEW_R3880

Type:

initiation region

Name:

Il17ra_1

Description:

interleukin 17 receptor A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	152,995,882 - 152,995,942	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306559	AgrOrtholog
BioCyc Gene	G2FUF-43199	BioCyc
Ensembl Genes	ENSRNOG00000011153	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000014885	ENTREZGENE
	ENSRNOP00000014885.6	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000014885	ENTREZGENE
	ENSRNOT00000014885.7	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.2150	UniProtKB/TrEMBL
	2.60.40.2160	UniProtKB/TrEMBL
	3.40.50.11530	UniProtKB/TrEMBL
InterPro	IL-17_rcpt-like	UniProtKB/TrEMBL
	IL17R_fnIII_D1	UniProtKB/TrEMBL
	IL17RA/B_FnIII-like_1_sf	UniProtKB/TrEMBL
	IL17RA/B_FnIII-like_2_sf	UniProtKB/TrEMBL
	SEFIR	UniProtKB/TrEMBL
KEGG Report	rno:312679	UniProtKB/TrEMBL
NCBI Gene	312679	ENTREZGENE
PANTHER	INTERLEUKIN-17 RECEPTOR A	UniProtKB/TrEMBL
	PTHR15583	UniProtKB/TrEMBL
Pfam	IL17R_fnIII_D1	UniProtKB/TrEMBL
	IL17R_fnIII_D2	UniProtKB/TrEMBL
	SEFIR	UniProtKB/TrEMBL
PhenoGen	Il17ra	PhenoGen
PROSITE	SEFIR	UniProtKB/TrEMBL
UniProt	D4A740	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Il17ra	interleukin 17 receptor A	Il17r_predicted	interleukin 17 receptor (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Il17r_predicted	interleukin 17 receptor (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)