Symbol:
Fkbp7
Name:
FKBP prolyl isomerase 7
RGD ID:
1305293
Description:
Predicted to enable calcium ion binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be located in endoplasmic reticulum. Orthologous to human FKBP7 (FKBP prolyl isomerase 7); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
FK506 binding protein 7; LOC295672; peptidyl-prolyl cis-trans isomerase FKBP7
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FKBP7 (FKBP prolyl isomerase 7) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Fkbp7 (FK506 binding protein 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fkbp7 (FKBP prolyl isomerase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FKBP7 (FKBP prolyl isomerase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FKBP7 (FKBP prolyl isomerase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fkbp7 (FKBP prolyl isomerase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FKBP7 (FKBP prolyl isomerase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FKBP7 (FKBP prolyl isomerase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fkbp7 (FKBP prolyl isomerase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NUP153 (nucleoporin 153) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
FKBP7 (FKBP prolyl isomerase 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fkbp7 (FK506 binding protein 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fkbp7 (FKBP prolyl isomerase 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Fkbp14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|SonicParanoid)
Caenorhabditis elegans (roundworm):
fkb-7
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
fkbp7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 82,016,647 - 82,030,913 (-) NCBI GRCr8 mRatBN7.2 3 61,609,384 - 61,623,710 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 61,608,557 - 61,623,280 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 64,964,743 - 64,976,673 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 73,548,393 - 73,560,326 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 71,315,999 - 71,327,944 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 63,522,480 - 63,535,835 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 63,522,403 - 63,535,991 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 70,095,618 - 70,107,822 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 59,361,703 - 59,373,382 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 59,258,213 - 59,269,689 (-) NCBI Celera 3 61,081,934 - 61,106,955 (-) NCBI Celera Cytogenetic Map 3 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Fkbp7 Rat dilated cardiomyopathy 1G ISO RGD:1313236 8554872 ClinVar Annotator: match by term: Dilated cardiomyopathy 1G ClinVar PMID:18948003|PMID:23975875|PMID:24395473|PMID:25589632|PMID:25640679|PMID:28492532|PMID:29792937|PMID:30238059|PMID:30557390 Fkbp7 Rat dystonia 16 ISO RGD:1313236 8554872 ClinVar Annotator: match by term: Dystonia 16 ClinVar PMID:28492532
Only show annotations with direct experimental evidence (0 objects hidden)
Fkbp7 Rat 1,2-dichloroethane decreases expression ISO RGD:1313237 6480464 ethylene dichloride results in decreased expression of FKBP7 mRNA CTD PMID:28960355 Fkbp7 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1313237 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FKBP7 mRNA CTD PMID:17942748 Fkbp7 Rat 17alpha-ethynylestradiol increases expression ISO RGD:1313237 6480464 Ethinyl Estradiol results in increased expression of FKBP7 mRNA CTD PMID:17942748 Fkbp7 Rat 17alpha-ethynylestradiol affects expression ISO RGD:1313237 6480464 Ethinyl Estradiol affects the expression of FKBP7 mRNA CTD PMID:17555576 Fkbp7 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of FKBP7 mRNA CTD PMID:17557909 Fkbp7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1313237 6480464 Tetrachlorodibenzodioxin results in increased expression of FKBP7 mRNA CTD PMID:17942748 Fkbp7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of FKBP7 mRNA CTD PMID:34747641 Fkbp7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of FKBP7 mRNA CTD PMID:32109520 Fkbp7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1313237 6480464 Tetrachlorodibenzodioxin affects the expression of FKBP7 mRNA CTD PMID:21570461 Fkbp7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1313237 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FKBP7 mRNA CTD PMID:17942748 Fkbp7 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1313236 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Fkbp7 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1313237 6480464 bisphenol S results in increased expression of FKBP7 mRNA CTD PMID:30951980 Fkbp7 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1313236 6480464 bisphenol S results in increased expression of FKBP7 protein CTD PMID:34186270 Fkbp7 Rat acetamide affects expression EXP 6480464 acetamide affects the expression of FKBP7 mRNA CTD PMID:31881176 Fkbp7 Rat aflatoxin B1 decreases expression ISO RGD:1313237 6480464 Aflatoxin B1 results in decreased expression of FKBP7 mRNA CTD PMID:19770486 Fkbp7 Rat benzo[a]pyrene increases expression ISO RGD:1313237 6480464 Benzo(a)pyrene results in increased expression of FKBP7 mRNA CTD PMID:22228805 Fkbp7 Rat beta-lapachone decreases expression ISO RGD:1313236 6480464 beta-lapachone results in decreased expression of FKBP7 mRNA CTD PMID:38218311 Fkbp7 Rat bisphenol A increases expression ISO RGD:1313237 6480464 bisphenol A results in increased expression of FKBP7 mRNA CTD PMID:26063408|PMID:30951980 Fkbp7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FKBP7 mRNA CTD PMID:30816183|PMID:34947998 Fkbp7 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of FKBP7 gene CTD PMID:28505145 Fkbp7 Rat bisphenol A multiple interactions ISO RGD:1313236 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Fkbp7 Rat bisphenol AF increases expression ISO RGD:1313236 6480464 bisphenol AF results in increased expression of FKBP7 protein CTD PMID:34186270 Fkbp7 Rat Bisphenol B increases expression ISO RGD:1313236 6480464 bisphenol B results in increased expression of FKBP7 protein CTD PMID:34186270 Fkbp7 Rat bisphenol F multiple interactions ISO RGD:1313236 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Fkbp7 Rat bisphenol F increases expression ISO RGD:1313236 6480464 bisphenol F results in increased expression of FKBP7 protein CTD PMID:34186270 Fkbp7 Rat bisphenol F increases expression ISO RGD:1313237 6480464 bisphenol F results in increased expression of FKBP7 mRNA CTD PMID:30951980 Fkbp7 Rat CGP 52608 multiple interactions ISO RGD:1313236 6480464 CGP 52608 promotes the reaction [RORA protein binds to FKBP7 gene] CTD PMID:28238834 Fkbp7 Rat cisplatin multiple interactions ISO RGD:1313236 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of FKBP7 mRNA CTD PMID:27392435 Fkbp7 Rat copper atom multiple interactions ISO RGD:1313236 6480464 [NSC 689534 binds to Copper] which results in decreased expression of FKBP7 mRNA CTD PMID:20971185 Fkbp7 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of FKBP7 mRNA CTD PMID:30556269 Fkbp7 Rat copper(0) multiple interactions ISO RGD:1313236 6480464 [NSC 689534 binds to Copper] which results in decreased expression of FKBP7 mRNA CTD PMID:20971185 Fkbp7 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of FKBP7 mRNA CTD PMID:30556269 Fkbp7 Rat copper(II) sulfate decreases expression ISO RGD:1313236 6480464 Copper Sulfate results in decreased expression of FKBP7 mRNA CTD PMID:19549813 Fkbp7 Rat crocidolite asbestos decreases expression ISO RGD:1313237 6480464 Asbestos, Crocidolite results in decreased expression of FKBP7 mRNA CTD PMID:29279043 Fkbp7 Rat CU-O LINKAGE decreases expression ISO RGD:1313236 6480464 cupric oxide results in decreased expression of FKBP7 mRNA CTD PMID:22077320 Fkbp7 Rat cyclosporin A decreases expression ISO RGD:1313236 6480464 Cyclosporine results in decreased expression of FKBP7 mRNA CTD PMID:20106945|PMID:25562108 Fkbp7 Rat dexamethasone multiple interactions ISO RGD:1313236 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Fkbp7 Rat doxorubicin decreases expression ISO RGD:1313236 6480464 Doxorubicin results in decreased expression of FKBP7 mRNA CTD PMID:29803840 Fkbp7 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of FKBP7 mRNA CTD PMID:29391264 Fkbp7 Rat entinostat increases expression ISO RGD:1313236 6480464 entinostat results in increased expression of FKBP7 mRNA CTD PMID:27188386 Fkbp7 Rat epoxiconazole decreases expression ISO RGD:1313237 6480464 epoxiconazole results in decreased expression of FKBP7 mRNA CTD PMID:35436446 Fkbp7 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of FKBP7 mRNA CTD PMID:24793618 Fkbp7 Rat folic acid decreases expression ISO RGD:1313237 6480464 Folic Acid results in decreased expression of FKBP7 mRNA CTD PMID:25629700 Fkbp7 Rat furan increases expression EXP 6480464 furan results in increased expression of FKBP7 mRNA CTD PMID:27387713 Fkbp7 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of FKBP7 mRNA CTD PMID:33387578 Fkbp7 Rat indometacin multiple interactions ISO RGD:1313236 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Fkbp7 Rat leflunomide decreases expression ISO RGD:1313236 6480464 leflunomide results in decreased expression of FKBP7 mRNA CTD PMID:28988120 Fkbp7 Rat okadaic acid decreases expression ISO RGD:1313236 6480464 Okadaic Acid results in decreased expression of FKBP7 mRNA CTD PMID:38832940 Fkbp7 Rat ouabain increases expression ISO RGD:1313236 6480464 Ouabain results in increased expression of FKBP7 mRNA CTD PMID:16412265 Fkbp7 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of FKBP7 mRNA CTD PMID:25729387 Fkbp7 Rat perfluorooctanoic acid decreases expression ISO RGD:1313236 6480464 perfluorooctanoic acid results in decreased expression of FKBP7 protein CTD PMID:26879310 Fkbp7 Rat pirinixic acid multiple interactions ISO RGD:1313236 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Fkbp7 Rat sodium arsenite increases expression ISO RGD:1313236 6480464 sodium arsenite results in increased expression of FKBP7 mRNA CTD PMID:22714537 Fkbp7 Rat sodium arsenite decreases expression ISO RGD:1313236 6480464 sodium arsenite results in decreased expression of FKBP7 mRNA CTD PMID:38568856 Fkbp7 Rat Soman increases expression EXP 6480464 Soman results in increased expression of FKBP7 mRNA CTD PMID:19281266 Fkbp7 Rat sunitinib decreases expression ISO RGD:1313236 6480464 Sunitinib results in decreased expression of FKBP7 mRNA CTD PMID:31533062 Fkbp7 Rat tetrachloromethane increases expression ISO RGD:1313237 6480464 Carbon Tetrachloride results in increased expression of FKBP7 mRNA CTD PMID:17484886|PMID:31919559 Fkbp7 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of FKBP7 mRNA CTD PMID:25729387 Fkbp7 Rat Tributyltin oxide increases expression ISO RGD:1313237 6480464 bis(tri-n-butyltin)oxide results in increased expression of FKBP7 mRNA CTD PMID:18958704 Fkbp7 Rat trichostatin A increases expression ISO RGD:1313236 6480464 trichostatin A results in increased expression of FKBP7 mRNA CTD PMID:24935251 Fkbp7 Rat urethane decreases expression ISO RGD:1313236 6480464 Urethane results in decreased expression of FKBP7 mRNA CTD PMID:28818685 Fkbp7 Rat valproic acid affects expression ISO RGD:1313237 6480464 Valproic Acid affects the expression of FKBP7 mRNA CTD PMID:17292431 Fkbp7 Rat valproic acid affects expression ISO RGD:1313236 6480464 Valproic Acid affects the expression of FKBP7 mRNA CTD PMID:25979313 Fkbp7 Rat valproic acid increases expression ISO RGD:1313236 6480464 Valproic Acid results in increased expression of FKBP7 mRNA CTD PMID:23179753|PMID:24935251|PMID:28001369|PMID:29154799 Fkbp7 Rat vorinostat increases expression ISO RGD:1313236 6480464 vorinostat results in increased expression of FKBP7 mRNA CTD PMID:27188386
1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) aflatoxin B1 (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) CGP 52608 (ISO) cisplatin (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) dexamethasone (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) epoxiconazole (ISO) flutamide (EXP) folic acid (ISO) furan (EXP) gentamycin (EXP) indometacin (ISO) leflunomide (ISO) okadaic acid (ISO) ouabain (ISO) oxaliplatin (EXP) perfluorooctanoic acid (ISO) pirinixic acid (ISO) sodium arsenite (ISO) Soman (EXP) sunitinib (ISO) tetrachloromethane (ISO) topotecan (EXP) Tributyltin oxide (ISO) trichostatin A (ISO) urethane (ISO) valproic acid (ISO) vorinostat (ISO)
Fkbp7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 82,016,647 - 82,030,913 (-) NCBI GRCr8 mRatBN7.2 3 61,609,384 - 61,623,710 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 61,608,557 - 61,623,280 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 64,964,743 - 64,976,673 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 73,548,393 - 73,560,326 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 71,315,999 - 71,327,944 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 63,522,480 - 63,535,835 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 63,522,403 - 63,535,991 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 70,095,618 - 70,107,822 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 59,361,703 - 59,373,382 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 59,258,213 - 59,269,689 (-) NCBI Celera 3 61,081,934 - 61,106,955 (-) NCBI Celera Cytogenetic Map 3 q24 NCBI
FKBP7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 178,463,664 - 178,478,600 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 178,463,664 - 178,478,600 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 179,328,391 - 179,343,327 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 179,038,267 - 179,051,568 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 179,155,531 - 179,168,829 NCBI Celera 2 172,931,277 - 172,946,242 (-) NCBI Celera Cytogenetic Map 2 q31.2 NCBI HuRef 2 171,199,075 - 171,213,798 (-) NCBI HuRef CHM1_1 2 179,334,423 - 179,349,378 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 178,946,457 - 178,961,394 (-) NCBI T2T-CHM13v2.0
Fkbp7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 76,493,378 - 76,503,442 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 76,493,388 - 76,503,460 (-) Ensembl GRCm39 Ensembl GRCm38 2 76,663,034 - 76,673,098 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 76,663,044 - 76,673,116 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 76,501,091 - 76,511,155 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 76,463,883 - 76,473,909 (-) NCBI MGSCv36 mm8 Celera 2 78,324,711 - 78,334,771 (-) NCBI Celera Cytogenetic Map 2 C3 NCBI cM Map 2 45.09 NCBI
Fkbp7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 18,373,375 - 18,410,627 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 18,373,372 - 18,385,172 (+) NCBI ChiLan1.0 ChiLan1.0
FKBP7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 81,111,209 - 81,127,198 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 81,126,048 - 81,142,172 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 65,721,439 - 65,736,351 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 183,425,612 - 183,440,522 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 183,425,612 - 183,440,522 (-) Ensembl panpan1.1 panPan2
FKBP7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 36 22,090,094 - 22,101,230 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 36 22,090,246 - 22,101,194 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 36 22,108,507 - 22,119,622 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 36 22,233,808 - 22,244,933 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 22,233,960 - 22,244,909 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 36 22,343,154 - 22,354,275 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 36 22,306,017 - 22,317,125 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 36 22,422,281 - 22,433,398 (-) NCBI UU_Cfam_GSD_1.0
Fkbp7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 139,126,005 - 139,138,115 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936509 7,679,819 - 7,691,789 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936509 7,679,908 - 7,690,881 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FKBP7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 84,168,587 - 84,182,860 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 84,168,483 - 84,182,870 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 93,702,224 - 93,716,733 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FKBP7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 64,016,060 - 64,028,890 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 64,016,232 - 64,028,767 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 135,545,474 - 135,560,616 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fkbp7
.
Predicted Target Of
Count of predictions: 30 Count of miRNA genes: 28 Interacting mature miRNAs: 30 Transcripts: ENSRNOT00000015722 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 9590286 Uminl1 Urine mineral level QTL 1 3.5 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 3 28249687 73249687 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 731180 Bp152 Blood pressure QTL 152 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 53781112 91609953 Rat 631200 Cm25 Cardiac mass QTL 25 4.8 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 3 61134348 89115068 Rat 61356 Bp37 Blood pressure QTL 37 3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 8694196 Abfw2 Abdominal fat weight QTL 2 16.58 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 28249687 73249687 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1582249 Bw77 Body weight QTL 77 3.2 0.0025 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 64655484 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 12879868 Am6 Aortic mass QTL 6 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 31426403 70668733 Rat 11565451 Bw177 Body weight QTL 177 0.002 body mass (VT:0001259) body weight (CMO:0000012) 3 31426403 70668733 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 11565452 Kidm57 Kidney mass QTL 57 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 31426403 70668733 Rat 12879866 Cm94 Cardiac mass QTL 94 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 31426403 70668733 Rat 12879867 Cm95 Cardiac mass QTL 95 0.047 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 31426403 70668733 Rat 1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 61377 Edpm3 Estrogen-dependent pituitary mass QTL 3 7.05 0.038 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 53184692 89878207 Rat 2302055 Pia30 Pristane induced arthritis QTL 30 3.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 3 27936919 72936919 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2303593 Gluco46 Glucose level QTL 46 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 28468571 73468571 Rat 1354590 Despr11 Despair related QTL 11 0.000031 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 3 28468571 73468571 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 631647 Bp122 Blood pressure QTL 122 6.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2302276 Bw82 Body weight QTL 82 4.32 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 62951183 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 9590136 Scort3 Serum corticosterone level QTL 3 23.37 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 28249687 73249687 Rat 10450804 Scl70 Serum cholesterol level QTL 70 4.7 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 8552950 Pigfal12 Plasma insulin-like growth factor 1 level QTL 12 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 28249687 73249687 Rat 631676 Cm8 Cardiac mass QTL 8 7.03 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 3 16954708 61954708 Rat 10450794 Scl69 Serum cholesterol level QTL 69 6.3 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 8694386 Bw159 Body weight QTL 159 4.52 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 3 28249687 73249687 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 2301400 Cm68 Cardiac mass QTL 68 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 31426403 70668733 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015722 ⟹ ENSRNOP00000015722
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 61,609,419 - 61,623,280 (-) Ensembl Rnor_6.0 Ensembl 3 63,522,403 - 63,535,991 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108707 ⟹ ENSRNOP00000086609
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 61,609,431 - 61,621,396 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112234 ⟹ ENSRNOP00000091197
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 61,608,557 - 61,621,383 (-) Ensembl
RefSeq Acc Id:
NM_001106485 ⟹ NP_001099955
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 82,016,647 - 82,028,573 (-) NCBI mRatBN7.2 3 61,609,427 - 61,621,354 (-) NCBI Rnor_6.0 3 63,522,518 - 63,534,086 (-) NCBI Rnor_5.0 3 70,095,618 - 70,107,822 (-) NCBI RGSC_v3.4 3 59,361,703 - 59,373,382 (-) RGD Celera 3 61,081,934 - 61,106,955 (-) RGD
Sequence:
TGAATTCTGTCCCATCAGCCTGCTAACACGCTGTGGGGCTTGCACTGGGCCTGGGAGTACTGCTTTGGCAAACATGAATCTCCTATTCAGATTATCAGTTTTCCTTGGCCTGTGGGTTTGTTCCGGTG
hide sequence
RefSeq Acc Id:
XM_006234400 ⟹ XP_006234462
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 82,016,650 - 82,030,533 (-) NCBI mRatBN7.2 3 61,609,384 - 61,623,258 (-) NCBI Rnor_6.0 3 63,522,480 - 63,535,835 (-) NCBI Rnor_5.0 3 70,095,618 - 70,107,822 (-) NCBI
Sequence:
GGCAAGGCCTGGTAATCCCCAATACTCTAGAGGCTGAGGCAGGAAGGACAAAAGGCCAGCCTGGGCTACATCCTTCTGTTAAGATAGGAAACGCTCGTCTGACTACTGCAGGCAGAAGAAATCTGCGA
hide sequence
RefSeq Acc Id:
XM_017591547 ⟹ XP_017447036
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 82,016,650 - 82,030,533 (-) NCBI mRatBN7.2 3 61,609,384 - 61,623,252 (-) NCBI Rnor_6.0 3 63,522,480 - 63,535,835 (-) NCBI
Sequence:
GGCAAGGCCTGGTAATCCCCAATACTCTAGAGGCTGAGGCAGGAAGGACAAAAGGCCAGCCTGG
hide sequence
RefSeq Acc Id:
XM_039104495 ⟹ XP_038960423
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 82,016,650 - 82,027,308 (-) NCBI mRatBN7.2 3 61,609,384 - 61,621,266 (-) NCBI
RefSeq Acc Id:
XM_063283276 ⟹ XP_063139346
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 82,028,411 - 82,030,913 (-) NCBI
RefSeq Acc Id:
XM_063283277 ⟹ XP_063139347
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 82,021,160 - 82,030,533 (-) NCBI
RefSeq Acc Id:
XM_063283278 ⟹ XP_063139348
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 82,016,650 - 82,027,308 (-) NCBI
RefSeq Acc Id:
XR_010064576
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 82,016,861 - 82,030,533 (-) NCBI
RefSeq Acc Id:
NP_001099955 ⟸ NM_001106485
- Peptide Label:
precursor
- UniProtKB:
A6HMI1 (UniProtKB/TrEMBL)
- Sequence:
MNLLFRLSVFLGLWVCSGAQGQTKEESTEEVKIEVLHRPENCSKTSRKGDLLNAHYDGYLAKDGSKFYCSRTQDEGHPKWFVLGVGHVIKGLDIAMMDMCPGEKRKVIIPPSLAYGKEGYAEGKIPPN
hide sequence
RefSeq Acc Id:
XP_006234462 ⟸ XM_006234400
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AE14 (UniProtKB/TrEMBL), A6HMI1 (UniProtKB/TrEMBL)
- Sequence:
MNLLFRLSVFLGLWVCSGAQGQTKEESTEEVKIEVLHRPENCSKTSRKGDLLNAHYDGYLAKDGSKFYCSRTQDEGHPKWFVLGVGHVIKGLDIAMMDMCPGEKRKVIIPPSLAYGKEGYEGKIPPNA
hide sequence
RefSeq Acc Id:
XP_017447036 ⟸ XM_017591547
- Peptide Label:
isoform X2
- UniProtKB:
A6HMI1 (UniProtKB/TrEMBL)
- Sequence:
MNLLFRLSVFLGLWVCSGAQGQTKEESTEEVKIEVLHRPENCSKTSRKGDLLNAHYDGYLAKDGSKFYCSRTQDEGHPKWFVLGVGHVIKGLDIAMMDMCPGEKRKVIIPPSLAYGKEGYAEGKIPPN
hide sequence
Ensembl Acc Id:
ENSRNOP00000015722 ⟸ ENSRNOT00000015722
RefSeq Acc Id:
XP_038960423 ⟸ XM_039104495
- Peptide Label:
isoform X6
Ensembl Acc Id:
ENSRNOP00000086609 ⟸ ENSRNOT00000108707
Ensembl Acc Id:
ENSRNOP00000091197 ⟸ ENSRNOT00000112234
RefSeq Acc Id:
XP_063139348 ⟸ XM_063283278
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063139347 ⟸ XM_063283277
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6A5N3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139346 ⟸ XM_063283276
- Peptide Label:
isoform X1
RGD ID: 13692160 Promoter ID: EPDNEW_R2685 Type: initiation region Name: Fkbp7_1 Description: FK506 binding protein 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 63,534,070 - 63,534,130 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-11-09
Fkbp7
FKBP prolyl isomerase 7
Fkbp7
FK506 binding protein 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Fkbp7
FK506 binding protein 7
Fkbp7_predicted
FK506 binding protein 7 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Fkbp7_predicted
FK506 binding protein 7 (predicted)
Symbol and Name status set to approved
70820 APPROVED
