Symbol:
P3h2
Name:
prolyl 3-hydroxylase 2
RGD ID:
1304568
Description:
Enables procollagen-proline 3-dioxygenase activity. Involved in collagen metabolic process and peptidyl-proline hydroxylation. Predicted to be located in several cellular components, including Golgi apparatus; basement membrane; and nucleoplasm. Predicted to be active in endoplasmic reticulum. Orthologous to human P3H2 (prolyl 3-hydroxylase 2); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
leprecan-like 1; leprecan-like protein 1; Leprel1; LOC102554639; LOC288016; MGC116247; prolyl 3-hydroxylase 2-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 88,139,086 - 88,280,221 (+) NCBI GRCr8 mRatBN7.2 11 74,634,267 - 74,775,422 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 74,634,267 - 74,775,421 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 83,443,019 - 83,584,372 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 76,078,068 - 76,219,425 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 75,139,871 - 75,281,175 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 78,028,885 - 78,169,746 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 78,029,038 - 78,169,648 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 82,549,554 - 82,690,068 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 76,687,437 - 76,828,785 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 76,745,025 - 76,886,374 (+) NCBI Celera 11 73,544,026 - 73,685,131 (+) NCBI Celera Cytogenetic Map 11 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
P3h2 Rat 1,1-dichloroethene decreases expression ISO P3h2 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of P3H2 mRNA CTD PMID:26682919 P3h2 Rat 17alpha-ethynylestradiol decreases expression ISO P3H2 (Homo sapiens) 6480464 Ethinyl Estradiol results in decreased expression of P3H2 mRNA CTD PMID:18936297 P3h2 Rat 17beta-estradiol multiple interactions ISO P3H2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of P3H2 mRNA CTD PMID:20660070 P3h2 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of P3H2 mRNA CTD PMID:26496021 P3h2 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO P3H2 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 P3h2 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO P3H2 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 P3h2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO P3h2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of P3H2 mRNA CTD PMID:19933214 P3h2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of P3H2 mRNA CTD PMID:32109520 P3h2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO P3h2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of P3H2 mRNA CTD PMID:21354282 P3h2 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO P3H2 (Homo sapiens) 6480464 3 more ... CTD PMID:23146750 P3h2 Rat 4,4'-sulfonyldiphenol increases expression ISO P3h2 (Mus musculus) 6480464 bisphenol S results in increased expression of P3H2 mRNA CTD PMID:30951980 P3h2 Rat 4,4'-sulfonyldiphenol affects expression ISO P3H2 (Homo sapiens) 6480464 bisphenol S affects the expression of P3H2 protein CTD PMID:31945527 P3h2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of P3H2 mRNA CTD PMID:31881176 P3h2 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of P3H2 mRNA CTD PMID:28959563 P3h2 Rat aflatoxin B1 increases expression ISO P3H2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of P3H2 mRNA CTD PMID:27153756 P3h2 Rat aflatoxin B1 increases methylation ISO P3H2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of P3H2 gene CTD PMID:27153756 P3h2 Rat all-trans-retinoic acid increases expression ISO P3H2 (Homo sapiens) 6480464 Tretinoin results in increased expression of P3H2 mRNA CTD PMID:21934132 P3h2 Rat antirheumatic drug increases expression ISO P3H2 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of P3H2 mRNA CTD PMID:24449571 P3h2 Rat arsane decreases expression ISO P3H2 (Homo sapiens) 6480464 Arsenic results in decreased expression of P3H2 mRNA CTD PMID:36861143 P3h2 Rat arsenic atom decreases expression ISO P3H2 (Homo sapiens) 6480464 Arsenic results in decreased expression of P3H2 mRNA CTD PMID:36861143 P3h2 Rat benzo[a]pyrene increases expression ISO P3H2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of P3H2 mRNA CTD PMID:20064835 P3h2 Rat benzo[a]pyrene decreases methylation ISO P3h2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of P3H2 exon and Benzo(a)pyrene results in decreased methylation of P3H2 intron CTD PMID:27901495 P3h2 Rat benzo[a]pyrene affects methylation ISO P3H2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of P3H2 5' UTR CTD PMID:27901495 P3h2 Rat benzo[a]pyrene increases methylation ISO P3H2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of P3H2 promoter CTD PMID:27901495 P3h2 Rat benzo[a]pyrene increases expression ISO P3h2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of P3H2 mRNA CTD PMID:22228805 P3h2 Rat benzo[a]pyrene decreases expression ISO P3H2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of P3H2 mRNA CTD PMID:21871943 P3h2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO P3H2 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 P3h2 Rat beta-naphthoflavone decreases expression ISO P3H2 (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of P3H2 mRNA CTD PMID:32858204 P3h2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of P3H2 mRNA and [bisphenol A co-treated with Testosterone] results in increased expression of P3H2 mRNA CTD PMID:26496021 P3h2 Rat bisphenol A decreases methylation ISO P3H2 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of P3H2 gene CTD PMID:31601247 P3h2 Rat bisphenol A decreases expression ISO P3H2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of P3H2 mRNA CTD PMID:29275510 P3h2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of P3H2 gene CTD PMID:28505145 P3h2 Rat cadmium atom multiple interactions ISO P3h2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of P3H2 mRNA CTD PMID:37325564 P3h2 Rat cadmium dichloride decreases expression ISO P3H2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of P3H2 mRNA CTD PMID:38568856 P3h2 Rat cadmium dichloride multiple interactions ISO P3h2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of P3H2 mRNA CTD PMID:37325564 P3h2 Rat cisplatin affects response to substance ISO P3H2 (Homo sapiens) 6480464 P3H2 protein affects the susceptibility to Cisplatin CTD PMID:16217747 P3h2 Rat cisplatin increases expression ISO P3H2 (Homo sapiens) 6480464 Cisplatin results in increased expression of P3H2 mRNA CTD PMID:27392435 P3h2 Rat cisplatin multiple interactions ISO P3h2 (Mus musculus) 6480464 [Cisplatin co-treated with RELB mutant form co-treated with TNF protein] results in decreased expression of P3H2 mRNA CTD PMID:23625948 P3h2 Rat copper(II) chloride decreases expression ISO P3H2 (Homo sapiens) 6480464 cupric chloride results in decreased expression of P3H2 mRNA CTD PMID:38568856 P3h2 Rat cyclosporin A decreases expression ISO P3H2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of P3H2 mRNA CTD PMID:20106945 P3h2 Rat dexamethasone decreases expression ISO P3H2 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of P3H2 mRNA CTD PMID:25047013 P3h2 Rat dioxygen increases expression ISO P3H2 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of P3H2 mRNA CTD PMID:24236059 P3h2 Rat dorsomorphin multiple interactions ISO P3H2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 P3h2 Rat entinostat increases expression ISO P3H2 (Homo sapiens) 6480464 entinostat results in increased expression of P3H2 mRNA CTD PMID:26272509 P3h2 Rat entinostat multiple interactions ISO P3H2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of P3H2 mRNA CTD PMID:27188386 P3h2 Rat ethanol increases expression ISO P3H2 (Homo sapiens) 6480464 Ethanol results in increased expression of P3H2 mRNA CTD PMID:23378141 P3h2 Rat ethanol multiple interactions ISO P3H2 (Homo sapiens) 6480464 [Ethanol co-treated with Folic Acid] results in increased expression of P3H2 mRNA CTD PMID:23378141 P3h2 Rat folic acid increases expression ISO P3h2 (Mus musculus) 6480464 Folic Acid results in increased expression of P3H2 mRNA CTD PMID:25006883 P3h2 Rat folic acid multiple interactions ISO P3H2 (Homo sapiens) 6480464 [Ethanol co-treated with Folic Acid] results in increased expression of P3H2 mRNA CTD PMID:23378141 P3h2 Rat isoprenaline increases expression ISO P3h2 (Mus musculus) 6480464 Isoproterenol results in increased expression of P3H2 mRNA CTD PMID:20003209 P3h2 Rat ivermectin decreases expression ISO P3H2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of P3H2 protein CTD PMID:32959892 P3h2 Rat lead(0) decreases expression ISO P3H2 (Homo sapiens) 6480464 Lead results in decreased expression of P3H2 mRNA CTD PMID:19921347 P3h2 Rat lipopolysaccharide increases expression ISO P3H2 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of P3H2 mRNA CTD PMID:35811015 P3h2 Rat lipopolysaccharide multiple interactions ISO P3H2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of P3H2 mRNA] CTD PMID:35811015 P3h2 Rat N-nitrosodiethylamine increases expression ISO P3H2 (Homo sapiens) 6480464 Diethylnitrosamine results in increased expression of P3H2 mRNA CTD PMID:21527772 P3h2 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of P3H2 mRNA CTD PMID:23665939 P3h2 Rat paracetamol increases expression ISO P3H2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of P3H2 mRNA CTD PMID:29067470 P3h2 Rat phenylmercury acetate increases expression ISO P3H2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of P3H2 mRNA CTD PMID:26272509 P3h2 Rat phenylmercury acetate multiple interactions ISO P3H2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of P3H2 mRNA CTD PMID:27188386 P3h2 Rat progesterone increases expression ISO P3H2 (Homo sapiens) 6480464 Progesterone results in increased expression of P3H2 mRNA CTD PMID:21540246 P3h2 Rat progesterone multiple interactions ISO P3H2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of P3H2 mRNA CTD PMID:20660070 P3h2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO P3H2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of P3H2 mRNA] CTD PMID:35811015 P3h2 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO P3H2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of P3H2 mRNA CTD PMID:35811015 P3h2 Rat SB 431542 multiple interactions ISO P3H2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 P3h2 Rat sodium arsenite decreases expression ISO P3H2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of P3H2 mRNA CTD PMID:22714537 and PMID:38568856 P3h2 Rat sotorasib multiple interactions ISO P3H2 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of P3H2 mRNA CTD PMID:36139627 P3h2 Rat sunitinib increases expression ISO P3H2 (Homo sapiens) 6480464 Sunitinib results in increased expression of P3H2 mRNA CTD PMID:31533062 P3h2 Rat temozolomide increases expression ISO P3H2 (Homo sapiens) 6480464 Temozolomide results in increased expression of P3H2 mRNA CTD PMID:31758290 P3h2 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of P3H2 mRNA CTD PMID:26496021 P3h2 Rat tetrachloroethene increases expression ISO P3h2 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of P3H2 mRNA CTD PMID:28973375 P3h2 Rat thiram decreases expression ISO P3H2 (Homo sapiens) 6480464 Thiram results in decreased expression of P3H2 mRNA CTD PMID:38568856 P3h2 Rat titanium dioxide decreases methylation ISO P3h2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of P3H2 gene CTD PMID:35295148 P3h2 Rat titanium dioxide increases expression ISO P3h2 (Mus musculus) 6480464 titanium dioxide results in increased expression of P3H2 mRNA CTD PMID:35295148 P3h2 Rat trametinib multiple interactions ISO P3H2 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of P3H2 mRNA CTD PMID:36139627 P3h2 Rat trimellitic anhydride decreases expression ISO P3h2 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of P3H2 mRNA CTD PMID:19042947 P3h2 Rat urethane affects expression ISO P3H2 (Homo sapiens) 6480464 Urethane affects the expression of P3H2 mRNA CTD PMID:28818685 P3h2 Rat valproic acid affects expression ISO P3h2 (Mus musculus) 6480464 Valproic Acid affects the expression of P3H2 mRNA CTD PMID:17292431 P3h2 Rat valproic acid increases expression ISO P3H2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of P3H2 mRNA CTD PMID:23179753 more ... P3h2 Rat vancomycin increases expression ISO P3h2 (Mus musculus) 6480464 Vancomycin results in increased expression of P3H2 mRNA CTD PMID:18930951 P3h2 Rat zoledronic acid decreases expression ISO P3H2 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of P3H2 mRNA CTD PMID:24714768
1,1-dichloroethene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-naphthoflavone (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) cisplatin (ISO) copper(II) chloride (ISO) cyclosporin A (ISO) dexamethasone (ISO) dioxygen (ISO) dorsomorphin (ISO) entinostat (ISO) ethanol (ISO) folic acid (ISO) isoprenaline (ISO) ivermectin (ISO) lead(0) (ISO) lipopolysaccharide (ISO) N-nitrosodiethylamine (ISO) orphenadrine (EXP) paracetamol (ISO) phenylmercury acetate (ISO) progesterone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenite (ISO) sotorasib (ISO) sunitinib (ISO) temozolomide (ISO) testosterone (EXP) tetrachloroethene (ISO) thiram (ISO) titanium dioxide (ISO) trametinib (ISO) trimellitic anhydride (ISO) urethane (ISO) valproic acid (ISO) vancomycin (ISO) zoledronic acid (ISO)
Cellular Component
basement membrane (IEA,ISO,ISS) cytosol (IEA,ISO) endoplasmic reticulum (IBA,IEA,ISO,ISS) Golgi apparatus (IEA,ISO,ISS) intracellular membrane-bounded organelle (IEA,ISO) nucleoplasm (IEA,ISO) sarcoplasmic reticulum (IEA)
P3h2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 88,139,086 - 88,280,221 (+) NCBI GRCr8 mRatBN7.2 11 74,634,267 - 74,775,422 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 74,634,267 - 74,775,421 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 83,443,019 - 83,584,372 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 76,078,068 - 76,219,425 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 75,139,871 - 75,281,175 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 78,028,885 - 78,169,746 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 78,029,038 - 78,169,648 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 82,549,554 - 82,690,068 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 76,687,437 - 76,828,785 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 76,745,025 - 76,886,374 (+) NCBI Celera 11 73,544,026 - 73,685,131 (+) NCBI Celera Cytogenetic Map 11 q22 NCBI
P3H2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 189,956,728 - 190,122,278 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 189,956,728 - 190,122,437 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 189,674,517 - 189,840,067 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 191,157,316 - 191,321,412 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 191,157,323 - 191,321,420 NCBI Celera 3 188,102,461 - 188,268,906 (-) NCBI Celera Cytogenetic Map 3 q28 NCBI HuRef 3 187,072,503 - 187,237,981 (-) NCBI HuRef CHM1_1 3 189,637,377 - 189,803,103 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 192,773,118 - 192,938,644 (-) NCBI T2T-CHM13v2.0
P3h2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 25,778,034 - 25,924,563 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 25,778,038 - 25,924,534 (-) Ensembl GRCm39 Ensembl GRCm38 16 25,959,284 - 26,105,813 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 25,959,288 - 26,105,784 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 25,960,409 - 26,105,870 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 25,875,672 - 26,021,133 (-) NCBI MGSCv36 mm8 Celera 16 26,503,926 - 26,649,250 (-) NCBI Celera Cytogenetic Map 16 B1 NCBI cM Map 16 17.63 NCBI
P3h2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955420 17,964,153 - 18,117,095 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955420 17,964,153 - 18,118,442 (+) NCBI ChiLan1.0 ChiLan1.0
P3H2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 187,822,467 - 187,990,737 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 187,827,183 - 187,995,467 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 186,976,926 - 187,141,678 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 195,532,341 - 195,695,510 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 195,533,511 - 195,695,598 (-) Ensembl panpan1.1 panPan2
P3H2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 34 22,035,124 - 22,185,146 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 34 22,023,068 - 22,185,026 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 34 26,128,347 - 26,278,616 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 34 21,969,192 - 22,119,559 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 34 21,967,663 - 22,119,559 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 34 21,984,404 - 22,141,097 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 34 21,977,205 - 22,127,973 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 34 22,219,915 - 22,370,251 (-) NCBI UU_Cfam_GSD_1.0
P3h2
P3H2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 127,414,958 - 127,572,163 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 127,414,955 - 127,572,165 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 136,665,659 - 136,863,053 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
P3H2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 84,185,288 - 84,348,186 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 84,185,299 - 84,348,011 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 57,767,198 - 57,931,651 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
P3h2
.
724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 70208 Niddm22 Non-insulin dependent diabetes mellitus QTL 22 3.61 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 11 59802794 82566553 Rat 70180 BpQTLcluster10 Blood pressure QTL cluster 10 3.19 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 11 34918041 79918041 Rat 1581565 Pur10 Proteinuria QTL 10 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 4889859 Pur28 Proteinuria QTL 28 19.5 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 11 45459323 75190161 Rat 634339 Niddm50 Non-insulin dependent diabetes mellitus QTL 50 3.32 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 11 66422148 86241447 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 1549848 Bvd6 Brain ventricular dilatation QTL 6 3.1 0.0001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 11 66113321 82169223 Rat 10058954 Gmadr7 Adrenal mass QTL 7 2.49 0.0049 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 60346590 86241447 Rat 2298551 Neuinf10 Neuroinflammation QTL 10 3.7 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 11 31239134 78851519 Rat 1300135 Rf19 Renal function QTL 19 3.38 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 11 40946188 82566702 Rat 1354656 Bvd3 Brain ventricular dilatation QTL 3 3.64 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 11 69446070 82846715 Rat 2312566 Glom20 Glomerulus QTL 20 3.6 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 44285759 82566702 Rat 1354593 Stl12 Serum triglyceride level QTL 12 3.36 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 11 66422148 86241447 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 724561 Plsm4 Polydactyly-luxate syndrome (PLS) morphotypes QTL 4 0.0003 forelimb integrity trait (VT:0010562) front foot phalanges count (CMO:0001947) 11 54457534 86241447 Rat 4889521 Gluco62 Glucose level QTL 62 2.82 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 55136729 82993457 Rat 7411658 Foco27 Food consumption QTL 27 16.2 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 11 56351424 86241447 Rat 631506 Bp104 Blood pressure QTL 104 2.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 59802794 82566545 Rat 1581572 Uae35 Urinary albumin excretion QTL 35 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat
D11Got65
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 74,713,769 - 74,713,884 (+) MAPPER mRatBN7.2 Rnor_6.0 11 78,107,976 - 78,108,092 NCBI Rnor6.0 Rnor_5.0 11 82,611,208 - 82,611,324 UniSTS Rnor5.0 RGSC_v3.4 11 76,766,885 - 76,767,002 RGD RGSC3.4 RGSC_v3.4 11 76,766,886 - 76,767,002 UniSTS RGSC3.4 RGSC_v3.1 11 76,824,475 - 76,824,591 RGD Celera 11 73,623,597 - 73,623,713 UniSTS RH 3.4 Map 11 609.3 RGD RH 3.4 Map 11 609.3 UniSTS Cytogenetic Map 11 q22-q23 UniSTS
AU048531
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 74,713,764 - 74,713,885 (+) MAPPER mRatBN7.2 Rnor_6.0 11 78,107,971 - 78,108,093 NCBI Rnor6.0 Rnor_5.0 11 82,611,207 - 82,611,329 UniSTS Rnor5.0 RGSC_v3.4 11 76,766,881 - 76,767,003 UniSTS RGSC3.4 Celera 11 73,623,592 - 73,623,714 UniSTS Cytogenetic Map 11 q22-q23 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000089540 ⟹ ENSRNOP00000074673
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 74,634,267 - 74,775,421 (+) Ensembl Rnor_6.0 Ensembl 11 78,029,038 - 78,169,648 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095886 ⟹ ENSRNOP00000092914
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 74,634,267 - 74,775,421 (+) Ensembl
RefSeq Acc Id:
NM_001025627 ⟹ NP_001020798
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 88,139,086 - 88,280,221 (+) NCBI mRatBN7.2 11 74,634,267 - 74,775,422 (+) NCBI Rnor_6.0 11 78,028,885 - 78,169,746 (+) NCBI Rnor_5.0 11 82,549,554 - 82,690,068 (-) NCBI RGSC_v3.4 11 76,687,437 - 76,828,785 (+) RGD Celera 11 73,544,026 - 73,685,131 (+) RGD
Sequence:
CCGCAGCGCTGCCGGCGGTCACCTGGGACTGTCGTGCAGCAGGACCGCGGCAAGGCAGGCGCGCTAGCTCTCGGAGCCAGAGCGGGGCTCGAACTCGAGGTGCGGGGGGCAGGCAAGGAGCGCGACTG
hide sequence
RefSeq Acc Id:
NP_001020798 ⟸ NM_001025627
- Peptide Label:
precursor
- UniProtKB:
Q4KLM6 (UniProtKB/Swiss-Prot), A0A0G2K8N3 (UniProtKB/TrEMBL)
- Sequence:
MRESTWVSLLLLLLLPAPQRGGPQDGRGSPEPEPERGPLQPFDLLYASGVAAYYSGDYEGAVRDLEAALRSHRRLRDIRTRCARHCAARRPLAPPGAGPGAELPFFRAVLERARCSRSCQSQRLGGPA
hide sequence
Ensembl Acc Id:
ENSRNOP00000074673 ⟸ ENSRNOT00000089540
Ensembl Acc Id:
ENSRNOP00000092914 ⟸ ENSRNOT00000095886
BioCyc Gene G2FUF-20933 BioCyc
BioCyc Pathway PWY-7894 [procollagen hydroxylation and glycosylation] BioCyc
BioCyc Pathway Image PWY-7894 BioCyc
Ensembl Genes ENSRNOG00000055751 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000089540 ENTREZGENE, UniProtKB/TrEMBL
ENSRNOT00000089540.2 UniProtKB/Swiss-Prot
ENSRNOT00000095886.1 UniProtKB/TrEMBL
Gene3D-CATH 1.25.40.10 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
q2cbj1_9rhob like domain UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7460856 IMAGE-MGC_LOAD
InterPro Oxoglu/Fe-dep_dioxygenase UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
P3H UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pro_4_hyd_alph UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pro_4_hyd_alph_FE2OG_OXY UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TPR-like_helical_dom_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:288016 UniProtKB/Swiss-Prot
MGC_CLONE MGC:116247 IMAGE-MGC_LOAD
NCBI Gene 288016 ENTREZGENE
PANTHER PTHR14049 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PTHR14049:SF1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam 2OG-FeII_Oxy_3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen P3h2 PhenoGen
PROSITE ER_TARGET UniProtKB/Swiss-Prot
FE2OG_OXY UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000055751 RatGTEx
SMART P4Hc UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP SSF48452 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A0G2K8N3 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AGJ2_RAT UniProtKB/TrEMBL
P3H2_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
P3h2
prolyl 3-hydroxylase 2
LOC102554639
prolyl 3-hydroxylase 2-like
Data merged from RGD:7561514
737654 PROVISIONAL
2014-12-17
P3h2
prolyl 3-hydroxylase 2
Leprel1
leprecan-like 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-12-17
LOC102554639
prolyl 3-hydroxylase 2-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-12-06
Leprel1
leprecan-like 1
Leprel1_predicted
leprecan-like 1 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Leprel1_predicted
leprecan-like 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
