Advanced Search (OLGA)

Gene: P3h2 (prolyl 3-hydroxylase 2) Rattus norvegicus

Analyze

Symbol:

P3h2

Name:

prolyl 3-hydroxylase 2

RGD ID:

1304568

Description:

Enables procollagen-proline 3-dioxygenase activity. Involved in collagen metabolic process and peptidyl-proline hydroxylation. Predicted to be located in several cellular components, including Golgi apparatus; basement membrane; and nucleoplasm. Predicted to be active in endoplasmic reticulum. Orthologous to human P3H2 (prolyl 3-hydroxylase 2); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

leprecan-like 1; leprecan-like protein 1; Leprel1; LOC102554639; LOC288016; MGC116247; prolyl 3-hydroxylase 2-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	P3H2 (prolyl 3-hydroxylase 2)	HGNC	Ensembl, HomoloGene, Panther
Mus musculus (house mouse):	P3h2 (prolyl 3-hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	P3h2 (prolyl 3-hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	P3H2 (prolyl 3-hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	P3H2 (prolyl 3-hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	P3h2 (prolyl 3-hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	P3H2 (prolyl 3-hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	P3H2 (prolyl 3-hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	P3h2 (prolyl 3-hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ELFN1 (extracellular leucine rich repeat and fibronectin type III domain containing 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	P3H2 (prolyl 3-hydroxylase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	P3h2 (prolyl 3-hydroxylase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	p3h2 (prolyl 3-hydroxylase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	p3h2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	88,139,086 - 88,280,221 (+)	NCBI		GRCr8
mRatBN7.2	11	74,634,267 - 74,775,422 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	74,634,267 - 74,775,421 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	83,443,019 - 83,584,372 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	76,078,068 - 76,219,425 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	75,139,871 - 75,281,175 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	78,028,885 - 78,169,746 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	78,029,038 - 78,169,648 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	82,549,554 - 82,690,068 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	76,687,437 - 76,828,785 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	76,745,025 - 76,886,374 (+)	NCBI
Celera	11	73,544,026 - 73,685,131 (+)	NCBI		Celera
Cytogenetic Map	11	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
P3h2	Rat	genetic disease		ISO	RGD:1312081	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868\|PMID:28492532
P3h2	Rat	High Myopia with Cataract and Vitreoretinal Degeneration		ISO	RGD:1312081	8554872	ClinVar Annotator: match by term: Myopia, high, with cataract and vitreoretinal degeneration \| ClinVar Annotator: more ...	ClinVar	PMID:21885030\|PMID:24172257\|PMID:25469533\|PMID:25741868\|PMID:28492532\|PMID:31456290
P3h2	Rat	myopia		ISO	RGD:1312081	8554872	ClinVar Annotator: match by term: Myopia	ClinVar	PMID:25741868
P3h2	Rat	Myopia 23, Autosomal Recessive		ISO	RGD:1312081	8554872	ClinVar Annotator: match by term: Rare isolated myopia	ClinVar	PMID:24172257\|PMID:25469533\|PMID:25741868\|PMID:28492532
P3h2	Rat	retinitis pigmentosa		ISO	RGD:1312081	8554872	ClinVar Annotator: match by term: Retinitis pigmentosa	ClinVar	PMID:24172257\|PMID:25469533\|PMID:25741868\|PMID:28492532\|PMID:31456290
P3h2	Rat	schizophrenia		ISO	RGD:1312081	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106\|PMID:30208311

Imported Disease Annotations - OMIA

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
P3h2	Rat	intestinal disease		ISO	RGD:12184798	9068941	Lundehund syndrome	OMIA	PMID:25860808\|PMID:27485430\|PMID:37405168\|PMID:37582787\|PMID:7946268\|PMID:853728

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
P3h2	Rat	High Myopia with Cataract and Vitreoretinal Degeneration		ISO	RGD:1312081	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
P3h2	Rat	1,1-dichloroethene	decreases expression	ISO	RGD:1312082	6480464	vinylidene chloride results in decreased expression of P3H2 mRNA	CTD	PMID:26682919
P3h2	Rat	17alpha-ethynylestradiol	decreases expression	ISO	RGD:1312081	6480464	Ethinyl Estradiol results in decreased expression of P3H2 mRNA	CTD	PMID:18936297
P3h2	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1312081	6480464	[Estradiol co-treated with Progesterone] results in increased expression of P3H2 mRNA	CTD	PMID:20660070
P3h2	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in decreased expression of P3H2 mRNA	CTD	PMID:26496021
P3h2	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	RGD:1312081	6480464	2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of P3H2 mRNA	CTD	PMID:23146750
P3h2	Rat	2,2',5,5'-tetrachlorobiphenyl	increases expression	ISO	RGD:1312081	6480464	2,5,2',5'-tetrachlorobiphenyl analog results in increased expression of P3H2 mRNA	CTD	PMID:36804509
P3h2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1312082	6480464	Tetrachlorodibenzodioxin results in increased expression of P3H2 mRNA	CTD	PMID:19933214
P3h2	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of P3H2 mRNA	CTD	PMID:32109520
P3h2	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1312082	6480464	Tetrachlorodibenzodioxin results in decreased expression of P3H2 mRNA	CTD	PMID:21354282
P3h2	Rat	3,3',4,4',5-pentachlorobiphenyl	decreases expression	ISO	RGD:1312081	6480464	3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of P3H2 mRNA	CTD	PMID:23146750
P3h2	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1312082	6480464	bisphenol S results in increased expression of P3H2 mRNA	CTD	PMID:30951980
P3h2	Rat	4,4'-sulfonyldiphenol	affects expression	ISO	RGD:1312081	6480464	bisphenol S affects the expression of P3H2 protein	CTD	PMID:31945527
P3h2	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of P3H2 mRNA	CTD	PMID:31881176
P3h2	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of P3H2 mRNA	CTD	PMID:28959563
P3h2	Rat	aflatoxin B1	increases expression	ISO	RGD:1312081	6480464	Aflatoxin B1 results in increased expression of P3H2 mRNA	CTD	PMID:27153756
P3h2	Rat	aflatoxin B1	increases methylation	ISO	RGD:1312081	6480464	Aflatoxin B1 results in increased methylation of P3H2 gene	CTD	PMID:27153756
P3h2	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1312081	6480464	Tretinoin results in increased expression of P3H2 mRNA	CTD	PMID:21934132
P3h2	Rat	antirheumatic drug	increases expression	ISO	RGD:1312081	6480464	Antirheumatic Agents results in increased expression of P3H2 mRNA	CTD	PMID:24449571
P3h2	Rat	arsane	decreases expression	ISO	RGD:1312081	6480464	Arsenic results in decreased expression of P3H2 mRNA	CTD	PMID:36861143
P3h2	Rat	arsenic atom	decreases expression	ISO	RGD:1312081	6480464	Arsenic results in decreased expression of P3H2 mRNA	CTD	PMID:36861143
P3h2	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1312081	6480464	Benzo(a)pyrene results in increased expression of P3H2 mRNA	CTD	PMID:20064835
P3h2	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1312082	6480464	Benzo(a)pyrene results in decreased methylation of P3H2 exon; Benzo(a)pyrene results in decreased methylation of P3H2 more ...	CTD	PMID:27901495
P3h2	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1312081	6480464	Benzo(a)pyrene affects the methylation of P3H2 5' UTR	CTD	PMID:27901495
P3h2	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1312081	6480464	Benzo(a)pyrene results in increased methylation of P3H2 promoter	CTD	PMID:27901495
P3h2	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1312082	6480464	Benzo(a)pyrene results in increased expression of P3H2 mRNA	CTD	PMID:22228805
P3h2	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1312081	6480464	Benzo(a)pyrene results in decreased expression of P3H2 mRNA	CTD	PMID:21871943
P3h2	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:1312081	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of P3H2 mRNA	CTD	PMID:19150397
P3h2	Rat	beta-naphthoflavone	decreases expression	ISO	RGD:1312081	6480464	beta-Naphthoflavone results in decreased expression of P3H2 mRNA	CTD	PMID:32858204
P3h2	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in decreased expression of P3H2 mRNA; [bisphenol A co-treated more ...	CTD	PMID:26496021
P3h2	Rat	bisphenol A	decreases methylation	ISO	RGD:1312081	6480464	bisphenol A results in decreased methylation of P3H2 gene	CTD	PMID:31601247
P3h2	Rat	bisphenol A	decreases expression	ISO	RGD:1312081	6480464	bisphenol A results in decreased expression of P3H2 mRNA	CTD	PMID:29275510
P3h2	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of P3H2 gene	CTD	PMID:28505145
P3h2	Rat	cadmium atom	multiple interactions	ISO	RGD:1312082	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of P3H2 more ...	CTD	PMID:37325564
P3h2	Rat	cadmium dichloride	decreases expression	ISO	RGD:1312081	6480464	Cadmium Chloride results in decreased expression of P3H2 mRNA	CTD	PMID:38568856
P3h2	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1312082	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of P3H2 more ...	CTD	PMID:37325564
P3h2	Rat	cisplatin	affects response to substance	ISO	RGD:1312081	6480464	P3H2 protein affects the susceptibility to Cisplatin	CTD	PMID:16217747
P3h2	Rat	cisplatin	increases expression	ISO	RGD:1312081	6480464	Cisplatin results in increased expression of P3H2 mRNA	CTD	PMID:27392435
P3h2	Rat	cisplatin	multiple interactions	ISO	RGD:1312082	6480464	[Cisplatin co-treated with RELB mutant form co-treated with TNF protein] results in decreased expression of more ...	CTD	PMID:23625948
P3h2	Rat	copper(II) chloride	decreases expression	ISO	RGD:1312081	6480464	cupric chloride results in decreased expression of P3H2 mRNA	CTD	PMID:38568856
P3h2	Rat	cyclosporin A	decreases expression	ISO	RGD:1312081	6480464	Cyclosporine results in decreased expression of P3H2 mRNA	CTD	PMID:20106945
P3h2	Rat	dexamethasone	decreases expression	ISO	RGD:1312081	6480464	Dexamethasone results in decreased expression of P3H2 mRNA	CTD	PMID:25047013
P3h2	Rat	dioxygen	increases expression	ISO	RGD:1312081	6480464	Oxygen deficiency results in increased expression of P3H2 mRNA	CTD	PMID:24236059
P3h2	Rat	dorsomorphin	multiple interactions	ISO	RGD:1312081	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
P3h2	Rat	entinostat	increases expression	ISO	RGD:1312081	6480464	entinostat results in increased expression of P3H2 mRNA	CTD	PMID:26272509
P3h2	Rat	entinostat	multiple interactions	ISO	RGD:1312081	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
P3h2	Rat	ethanol	increases expression	ISO	RGD:1312081	6480464	Ethanol results in increased expression of P3H2 mRNA	CTD	PMID:23378141
P3h2	Rat	ethanol	multiple interactions	ISO	RGD:1312081	6480464	[Ethanol co-treated with Folic Acid] results in increased expression of P3H2 mRNA	CTD	PMID:23378141
P3h2	Rat	folic acid	increases expression	ISO	RGD:1312082	6480464	Folic Acid results in increased expression of P3H2 mRNA	CTD	PMID:25006883
P3h2	Rat	folic acid	multiple interactions	ISO	RGD:1312081	6480464	[Ethanol co-treated with Folic Acid] results in increased expression of P3H2 mRNA	CTD	PMID:23378141
P3h2	Rat	isoprenaline	increases expression	ISO	RGD:1312082	6480464	Isoproterenol results in increased expression of P3H2 mRNA	CTD	PMID:20003209
P3h2	Rat	ivermectin	decreases expression	ISO	RGD:1312081	6480464	Ivermectin results in decreased expression of P3H2 protein	CTD	PMID:32959892
P3h2	Rat	lead(0)	decreases expression	ISO	RGD:1312081	6480464	Lead results in decreased expression of P3H2 mRNA	CTD	PMID:19921347
P3h2	Rat	lipopolysaccharide	increases expression	ISO	RGD:1312081	6480464	Lipopolysaccharides results in increased expression of P3H2 mRNA	CTD	PMID:35811015
P3h2	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1312081	6480464	S-(1,2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of P3H2 mRNA]	CTD	PMID:35811015
P3h2	Rat	N-nitrosodiethylamine	increases expression	ISO	RGD:1312081	6480464	Diethylnitrosamine results in increased expression of P3H2 mRNA	CTD	PMID:21527772
P3h2	Rat	orphenadrine	affects expression	EXP		6480464	Orphenadrine affects the expression of P3H2 mRNA	CTD	PMID:23665939
P3h2	Rat	paracetamol	increases expression	ISO	RGD:1312081	6480464	Acetaminophen results in increased expression of P3H2 mRNA	CTD	PMID:29067470
P3h2	Rat	phenylmercury acetate	increases expression	ISO	RGD:1312081	6480464	Phenylmercuric Acetate results in increased expression of P3H2 mRNA	CTD	PMID:26272509
P3h2	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:1312081	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
P3h2	Rat	progesterone	increases expression	ISO	RGD:1312081	6480464	Progesterone results in increased expression of P3H2 mRNA	CTD	PMID:21540246
P3h2	Rat	progesterone	multiple interactions	ISO	RGD:1312081	6480464	[Estradiol co-treated with Progesterone] results in increased expression of P3H2 mRNA	CTD	PMID:20660070
P3h2	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1312081	6480464	S-(1,2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of P3H2 mRNA]	CTD	PMID:35811015
P3h2	Rat	S-(1,2-dichlorovinyl)-L-cysteine	decreases expression	ISO	RGD:1312081	6480464	S-(1,2-dichlorovinyl)cysteine results in decreased expression of P3H2 mRNA	CTD	PMID:35811015
P3h2	Rat	SB 431542	multiple interactions	ISO	RGD:1312081	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
P3h2	Rat	sodium arsenite	decreases expression	ISO	RGD:1312081	6480464	sodium arsenite results in decreased expression of P3H2 mRNA	CTD	PMID:22714537\|PMID:38568856
P3h2	Rat	sotorasib	multiple interactions	ISO	RGD:1312081	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of P3H2 mRNA	CTD	PMID:36139627
P3h2	Rat	sunitinib	increases expression	ISO	RGD:1312081	6480464	Sunitinib results in increased expression of P3H2 mRNA	CTD	PMID:31533062
P3h2	Rat	temozolomide	increases expression	ISO	RGD:1312081	6480464	Temozolomide results in increased expression of P3H2 mRNA	CTD	PMID:31758290
P3h2	Rat	testosterone	multiple interactions	EXP		6480464	[bisphenol A co-treated with Testosterone] results in increased expression of P3H2 mRNA	CTD	PMID:26496021
P3h2	Rat	tetrachloroethene	increases expression	ISO	RGD:1312082	6480464	Tetrachloroethylene results in increased expression of P3H2 mRNA	CTD	PMID:28973375
P3h2	Rat	thiram	decreases expression	ISO	RGD:1312081	6480464	Thiram results in decreased expression of P3H2 mRNA	CTD	PMID:38568856
P3h2	Rat	titanium dioxide	decreases methylation	ISO	RGD:1312082	6480464	titanium dioxide results in decreased methylation of P3H2 gene	CTD	PMID:35295148
P3h2	Rat	titanium dioxide	increases expression	ISO	RGD:1312082	6480464	titanium dioxide results in increased expression of P3H2 mRNA	CTD	PMID:35295148
P3h2	Rat	trametinib	multiple interactions	ISO	RGD:1312081	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of P3H2 mRNA	CTD	PMID:36139627
P3h2	Rat	trimellitic anhydride	decreases expression	ISO	RGD:1312082	6480464	trimellitic anhydride results in decreased expression of P3H2 mRNA	CTD	PMID:19042947
P3h2	Rat	urethane	affects expression	ISO	RGD:1312081	6480464	Urethane affects the expression of P3H2 mRNA	CTD	PMID:28818685
P3h2	Rat	valproic acid	affects expression	ISO	RGD:1312082	6480464	Valproic Acid affects the expression of P3H2 mRNA	CTD	PMID:17292431
P3h2	Rat	valproic acid	increases expression	ISO	RGD:1312081	6480464	Valproic Acid results in increased expression of P3H2 mRNA	CTD	PMID:23179753\|PMID:24935251\|PMID:28001369
P3h2	Rat	vancomycin	increases expression	ISO	RGD:1312082	6480464	Vancomycin results in increased expression of P3H2 mRNA	CTD	PMID:18930951
P3h2	Rat	zoledronic acid	decreases expression	ISO	RGD:1312081	6480464	zoledronic acid results in decreased expression of P3H2 mRNA	CTD	PMID:24714768

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
P3h2	Rat	collagen metabolic process	involved_in	IEA	InterPro:IPR039575	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
P3h2	Rat	collagen metabolic process	involved_in	IBA	MGI:1315208\|PANTHER:PTN001422087\|RGD:1304568\|UniProtKB:Q6JHU8\|UniProtKB:Q8IVL5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
P3h2	Rat	collagen metabolic process	involved_in	ISO	RGD:1312081	1624291	PMID:18487197	RGD	PMID:18487197
P3h2	Rat	collagen metabolic process	involved_in	ISS	UniProtKB:Q8IVL5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
P3h2	Rat	collagen metabolic process	involved_in	IDA		8553392	PMID:21757687	UniProt
P3h2	Rat	collagen metabolic process	involved_in	IEA	UniProtKB:Q8IVL5\|ensembl:ENSP00000316881	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
P3h2	Rat	negative regulation of cell population proliferation	involved_in	IEA	UniProtKB:Q8IVL5\|ensembl:ENSP00000316881	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
P3h2	Rat	negative regulation of cell population proliferation	involved_in	ISS	UniProtKB:Q8IVL5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
P3h2	Rat	negative regulation of cell population proliferation	involved_in	ISO	RGD:1312081	1624291	PMID:19436308	RGD	PMID:19436308
P3h2	Rat	peptidyl-proline hydroxylation	involved_in	IDA		8553392	PMID:21757687	UniProt
P3h2	Rat	peptidyl-proline hydroxylation	involved_in	ISO	RGD:1312081	1624291	PMID:18487197	RGD	PMID:18487197
P3h2	Rat	peptidyl-proline hydroxylation	involved_in	ISS	UniProtKB:Q8IVL5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
P3h2	Rat	basement membrane	located_in	IEA	UniProtKB:Q8CG71\|ensembl:ENSMUSP00000038056	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
P3h2	Rat	basement membrane	located_in	ISO	RGD:1312082	1624291	PMID:18487197	RGD	PMID:18487197
P3h2	Rat	basement membrane	located_in	ISS	UniProtKB:Q8CG71	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
P3h2	Rat	cytosol	located_in	ISO	RGD:1312081\|UniProtKB:Q8IVL5-1\|UniProtKB:Q8IVL5-2	1624291		RGD	GO_REF:0000052
P3h2	Rat	cytosol	located_in	IEA	UniProtKB:Q8IVL5\|ensembl:ENSP00000316881	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
P3h2	Rat	endoplasmic reticulum	located_in	ISO	RGD:1312081	1624291	PMID:15063763	RGD	PMID:15063763
P3h2	Rat	endoplasmic reticulum	is_active_in	IBA	PANTHER:PTN001422087\|UniProtKB:Q32P28\|UniProtKB:Q6JHU8\|UniProtKB:Q8IVL5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
P3h2	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB:Q8IVL5\|ensembl:ENSP00000316881	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
P3h2	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
P3h2	Rat	endoplasmic reticulum	located_in	ISS	UniProtKB:Q8IVL5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
P3h2	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-SubCell:SL-0095	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
P3h2	Rat	Golgi apparatus	located_in	ISO	RGD:1312081	1624291	PMID:15063763	RGD	PMID:15063763
P3h2	Rat	Golgi apparatus	located_in	IEA	UniProtKB-KW:KW-0333	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
P3h2	Rat	Golgi apparatus	located_in	IEA	UniProtKB-SubCell:SL-0132	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
P3h2	Rat	Golgi apparatus	located_in	ISS	UniProtKB:Q8IVL5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
P3h2	Rat	Golgi apparatus	located_in	IEA	UniProtKB:Q8IVL5\|ensembl:ENSP00000316881	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
P3h2	Rat	Golgi apparatus	located_in	ISO	RGD:1312081\|UniProtKB:Q8IVL5-1\|UniProtKB:Q8IVL5-2	1624291		RGD	GO_REF:0000052
P3h2	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q8IVL5\|ensembl:ENSP00000316881	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
P3h2	Rat	nucleoplasm	located_in	ISO	RGD:1312081\|UniProtKB:Q8IVL5-1\|UniProtKB:Q8IVL5-2	1624291		RGD	GO_REF:0000052
P3h2	Rat	sarcoplasmic reticulum	located_in	IEA	UniProtKB-SubCell:SL-0239	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
P3h2	Rat	sarcoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0703	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
P3h2	Rat	dioxygenase activity	enables	IEA	UniProtKB-KW:KW-0223	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
P3h2	Rat	iron ion binding	enables	IEA	InterPro:IPR006620	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
P3h2	Rat	L-ascorbic acid binding	enables	IEA	UniProtKB-KW:KW-0847	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
P3h2	Rat	L-ascorbic acid binding	enables	IEA	InterPro:IPR006620	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
P3h2	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
P3h2	Rat	oxidoreductase activity	enables	IEA	UniProtKB-KW:KW-0560	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
P3h2	Rat	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	enables	IEA	InterPro:IPR006620	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
P3h2	Rat	procollagen-proline 3-dioxygenase activity	enables	ISS	UniProtKB:Q8IVL5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
P3h2	Rat	procollagen-proline 3-dioxygenase activity	enables	IEA	RHEA:22872	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
P3h2	Rat	procollagen-proline 3-dioxygenase activity	enables	IBA	PANTHER:PTN001422087\|RGD:1304568\|UniProtKB:Q6JHU8\|UniProtKB:Q8IVL5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
P3h2	Rat	procollagen-proline 3-dioxygenase activity	enables	IEA	UniProtKB:Q8IVL5\|ensembl:ENSP00000316881	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
P3h2	Rat	procollagen-proline 3-dioxygenase activity	enables	ISO	RGD:1312081	1624291	PMID:18487197	RGD	PMID:18487197
P3h2	Rat	procollagen-proline 3-dioxygenase activity	enables	IEA	EC:1.14.11.7	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
P3h2	Rat	procollagen-proline 3-dioxygenase activity	enables	IDA		8553392	PMID:21757687	UniProt

Molecular Pathway Annotations Click to see Annotation Detail View

BioCyc Pathways

procollagen hydroxylation and glycosylation

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

High Myopia with Cataract and Vitreoretinal Degeneration (ISO)

intestinal disease (ISO)

myopia (ISO)

Myopia 23, Autosomal Recessive (ISO)

retinitis pigmentosa (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cisplatin (ISO)

copper(II) chloride (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

entinostat (ISO)

ethanol (ISO)

folic acid (ISO)

isoprenaline (ISO)

ivermectin (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

N-nitrosodiethylamine (ISO)

orphenadrine (EXP)

paracetamol (ISO)

phenylmercury acetate (ISO)

progesterone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

sunitinib (ISO)

temozolomide (ISO)

testosterone (EXP)

tetrachloroethene (ISO)

thiram (ISO)

titanium dioxide (ISO)

trametinib (ISO)

trimellitic anhydride (ISO)

urethane (ISO)

valproic acid (ISO)

vancomycin (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

collagen metabolic process (IBA,IDA,IEA,ISO,ISS)

negative regulation of cell population proliferation (IEA,ISO,ISS)

peptidyl-proline hydroxylation (IDA,ISO,ISS)

Cellular Component

basement membrane (IEA,ISO,ISS)

cytosol (IEA,ISO)

endoplasmic reticulum (IBA,IEA,ISO,ISS)

Golgi apparatus (IEA,ISO,ISS)

nucleoplasm (IEA,ISO)

sarcoplasmic reticulum (IEA)

Molecular Function

dioxygenase activity (IEA)

iron ion binding (IEA)

L-ascorbic acid binding (IEA)

metal ion binding (IEA)

oxidoreductase activity (IEA)

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (IEA)

procollagen-proline 3-dioxygenase activity (IBA,IDA,IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	A role for prolyl 3-hydroxylase 2 in post-translational modification of fibril-forming collagens.	Fernandes RJ, etal., J Biol Chem. 2011 Sep 2;286(35):30662-9. doi: 10.1074/jbc.M111.267906. Epub 2011 Jul 11.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15063763	PMID:15489334	PMID:18487197	PMID:19436308

Genomics

Comparative Map Data

P3h2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	88,139,086 - 88,280,221 (+)	NCBI		GRCr8
mRatBN7.2	11	74,634,267 - 74,775,422 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	74,634,267 - 74,775,421 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	83,443,019 - 83,584,372 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	76,078,068 - 76,219,425 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	75,139,871 - 75,281,175 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	78,028,885 - 78,169,746 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	78,029,038 - 78,169,648 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	82,549,554 - 82,690,068 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	76,687,437 - 76,828,785 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	76,745,025 - 76,886,374 (+)	NCBI
Celera	11	73,544,026 - 73,685,131 (+)	NCBI		Celera
Cytogenetic Map	11	q22	NCBI

P3H2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	189,956,728 - 190,122,278 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	189,956,728 - 190,122,437 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	189,674,517 - 189,840,067 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	191,157,316 - 191,321,412 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	191,157,323 - 191,321,420	NCBI
Celera	3	188,102,461 - 188,268,906 (-)	NCBI		Celera
Cytogenetic Map	3	q28	NCBI
HuRef	3	187,072,503 - 187,237,981 (-)	NCBI		HuRef
CHM1_1	3	189,637,377 - 189,803,103 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	192,773,118 - 192,938,644 (-)	NCBI		T2T-CHM13v2.0

P3h2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	25,778,034 - 25,924,563 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	25,778,038 - 25,924,534 (-)	Ensembl		GRCm39 Ensembl
GRCm38	16	25,959,284 - 26,105,813 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	25,959,288 - 26,105,784 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	25,960,409 - 26,105,870 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	25,875,672 - 26,021,133 (-)	NCBI		MGSCv36	mm8
Celera	16	26,503,926 - 26,649,250 (-)	NCBI		Celera
Cytogenetic Map	16	B1	NCBI
cM Map	16	17.63	NCBI

P3h2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	17,964,153 - 18,117,095 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955420	17,964,153 - 18,118,442 (+)	NCBI	ChiLan1.0	ChiLan1.0

P3H2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	187,822,467 - 187,990,737 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	187,827,183 - 187,995,467 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	186,976,926 - 187,141,678 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	195,532,341 - 195,695,510 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	195,533,511 - 195,695,598 (-)	Ensembl	panpan1.1		panPan2

P3H2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	22,035,124 - 22,185,146 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	22,023,068 - 22,185,026 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	26,128,347 - 26,278,616 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	21,969,192 - 22,119,559 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	21,967,663 - 22,119,559 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	21,984,404 - 22,141,097 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	21,977,205 - 22,127,973 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	22,219,915 - 22,370,251 (-)	NCBI		UU_Cfam_GSD_1.0

P3h2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	114,177,035 - 114,339,277 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936578	268,856 - 431,137 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936578	268,815 - 431,123 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

P3H2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	127,414,958 - 127,572,163 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	127,414,955 - 127,572,165 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	136,665,659 - 136,863,053 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

P3H2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	84,185,288 - 84,348,186 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	84,185,299 - 84,348,011 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	57,767,198 - 57,931,651 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

P3h2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	67,072,478 - 67,228,599 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	67,072,389 - 67,228,207 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in P3h2
1456 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
70208	Niddm22	Non-insulin dependent diabetes mellitus QTL 22	3.61		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	59802794	82566553	Rat
70180	BpQTLcluster10	Blood pressure QTL cluster 10	3.19		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	11	34918041	79918041	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	45459323	75190161	Rat
634339	Niddm50	Non-insulin dependent diabetes mellitus QTL 50	3.32		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	66422148	86241447	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	19456205	76331918	Rat
1549848	Bvd6	Brain ventricular dilatation QTL 6	3.1	0.0001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	66113321	82169223	Rat
10058954	Gmadr7	Adrenal mass QTL 7	2.49	0.0049	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	60346590	86241447	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	31239134	78851519	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	40946188	82566702	Rat
1354656	Bvd3	Brain ventricular dilatation QTL 3	3.64	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	69446070	82846715	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	44285759	82566702	Rat
1354593	Stl12	Serum triglyceride level QTL 12	3.36		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	11	66422148	86241447	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	54457534	86241447	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	55136729	82993457	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	56351424	86241447	Rat
631506	Bp104	Blood pressure QTL 104	2.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	59802794	82566545	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat

Markers in Region

D11Got65

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	74,713,769 - 74,713,884 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	78,107,976 - 78,108,092	NCBI	Rnor6.0
Rnor_5.0	11	82,611,208 - 82,611,324	UniSTS	Rnor5.0
RGSC_v3.4	11	76,766,885 - 76,767,002	RGD	RGSC3.4
RGSC_v3.4	11	76,766,886 - 76,767,002	UniSTS	RGSC3.4
RGSC_v3.1	11	76,824,475 - 76,824,591	RGD
Celera	11	73,623,597 - 73,623,713	UniSTS
RH 3.4 Map	11	609.3	RGD
RH 3.4 Map	11	609.3	UniSTS
Cytogenetic Map	11	q22-q23	UniSTS

AU048531

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	74,713,764 - 74,713,885 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	78,107,971 - 78,108,093	NCBI	Rnor6.0
Rnor_5.0	11	82,611,207 - 82,611,329	UniSTS	Rnor5.0
RGSC_v3.4	11	76,766,881 - 76,767,003	UniSTS	RGSC3.4
Celera	11	73,623,592 - 73,623,714	UniSTS
Cytogenetic Map	11	q22-q23	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025627	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC099107	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000089540 ⟹ ENSRNOP00000074673

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	74,634,267 - 74,775,421 (+)	Ensembl
Rnor_6.0 Ensembl	11	78,029,038 - 78,169,648 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095886 ⟹ ENSRNOP00000092914

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	74,634,267 - 74,775,421 (+)	Ensembl

RefSeq Acc Id:

NM_001025627 ⟹ NP_001020798

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	88,139,086 - 88,280,221 (+)	NCBI
mRatBN7.2	11	74,634,267 - 74,775,422 (+)	NCBI
Rnor_6.0	11	78,028,885 - 78,169,746 (+)	NCBI
Rnor_5.0	11	82,549,554 - 82,690,068 (-)	NCBI
RGSC_v3.4	11	76,687,437 - 76,828,785 (+)	RGD
Celera	11	73,544,026 - 73,685,131 (+)	RGD

Sequence:

show sequence

CCGCAGCGCTGCCGGCGGTCACCTGGGACTGTCGTGCAGCAGGACCGCGGCAAGGCAGGCGCGC
TAGCTCTCGGAGCCAGAGCGGGGCTCGAACTCGAGGTGCGGGGGGCAGGCAAGGAGCGCGACTG
TCCCCCTCCACGGGTCCGGCGGAGGATGCGGGAGAGCACGTGGGTGTCGCTGCTGTTGCTGCTG
CTGCTGCCCGCGCCACAGCGGGGCGGCCCCCAGGACGGTCGCGGGTCGCCGGAGCCGGAGCCAG
AGCGCGGCCCGCTGCAGCCCTTCGACCTGCTCTACGCTAGCGGCGTGGCTGCCTACTACAGCGG
CGACTACGAAGGTGCGGTGCGGGACCTAGAAGCCGCGCTGCGCAGCCACCGGCGCCTGCGAGAC
ATCCGCACGCGCTGCGCCCGCCACTGCGCCGCGCGCCGCCCGCTCGCGCCCCCAGGCGCCGGCC
CGGGAGCCGAGCTGCCCTTCTTCCGCGCGGTGCTCGAACGAGCGCGCTGCTCCCGCAGCTGCCA
GAGCCAGCGTCTGGGCGGCCCCGCGTCCCGCCACCGTGTCAGCGAAGACGTGCGCAGCGACTTC
CAGCGCAGAGTGCCCTACAACTACCTGCAGAGGGCCTACATCAAGCTCAACCAGCTCGATAAAG
CCATGGAAGCAGCTCACACATTCTTCATGGCCAACCCCGAGCACATGGAAATGCAGCAGAACAT
AGAAGACTATAAAGCCACAGCAAGAGTGGAAGCCCCGTTAGTAGACAGAGAAGCCAAGCCACAC
CTGGAAAGCTATAATGCTGGAGTTAAACATTATGAGGCGGATGACTTTGAAGCAGCCATCAAGT
ACTTTGAACAAGCTTTAAGAGAATATTTCAATGAAGATATGGTGTGCCGCGCTCTGTGTGAGGG
GCCTCAGAGATTTGAGGAATATGAGTATTTAGGATCTAAGGGCAGTCTTTATGAGGCAATCGCA
GATCACTACATGCAGGTTCTGGTCTGTCAGCATGAGTGTGTGAGGGAACTTGCCACCCGCCCAG
GCCGCCTCTCACCAATCGAGAACTTTCTTCCCTTGCATTATGACTACCTCCAGTTTGCCTACTA
CAGAGTTGGTGAGTATGTGAAAGCCTTGGAGTGTGCCAAAGCCTACCTGATGTTCCACCCAGAC
GACCAGGATGTCCTGGACAATGTAGACTTCTATGAGAGTCTGCTGGATGACAGCACTGACCCAG
CATCCATTGAGGCCCGAGAGGATTTAACAGCATTTGTCAAACGTCATAAACTTGAAGCTGAACT
GATCAAGTCAGCTGCAGAGGGCCTGGGATTTTCATATTCTGAACCAAATTACTGGATCAGTTAT
GGAGGACGGCAGGATGAGAACCGAGTCCCTTCGGGAGTGAATATGGATGGGGCAGAAGTTCACG
GATTGTCCATGGGGAAGAAGTCACCACCCAAGATAGGTCGAGATCTTAGAGAAGGTGGCCCTCT
GCTCTATGAGAACATCACCTTCGTCTACAACTCCGAGCAGCTGAACGGGACTCAGCGGGTTCTC
CTAGATAACGTCCTGTCGGAAGAACAGTGCCGGGAGCTGCACAGTGTGGCCAGTGGAATCATGC
TGGTTGGTGATGGATACCGAGGGAAAACGTCACCCCACACACCCAATGAGAAGTTTGAAGGAGC
AACTGTTTTGAAAGCACTCAAATTTGGTTATGAAGGCCGGGTGCCACTGAAGAGTGCACGGCTG
TTCTATGACATCAGCGAGAAGGCTCGGAAGATTGTGGAGTCCTATTTCATGCTGAACTCAACCC
TGTATTTTTCCTATACACACATGGTCTGCAGAACAGCCCTGTCTGGGCAGCAGGATCGAAGAAA
TGACCTCAGTCACCCCATTCATGCGGACAACTGCTTGCTGGATCCAGAAGCCAACGAATGCTGG
AAGGAGCCTCCTGCTTACACCTTTCGGGACTATAGTGCTCTCCTGTATATGAATGACGACTTTG
AAGGAGGAGAATTCATCTTCACGGAAATGGATGCTAAAACTGTGACTGCCTCTATAAAGCCAAA
ATGTGGGCGAATGATCAGCTTCTCATCTGGTGGCGAGAACCCTCACGGGGTGAAGGCAGTCACC
AGAGGCCAGCGCTGTGCTGTGGCACTGTGGTTCACCCTAGACCCTCTCTACCGAGAATTGGAGC
GGATACAGGCTGATGAAGTGATTGCCATCTTGGATCAAGAACAACACGGGAAGCATGGACTGAA
TATTAACCCCAAAGACGAGCTATAGAAAAGAGAGTATTCTATTGAATATTTATTTAAATAGATA
ATCTTATGAGAACGTTTTTATTTTTGTACAGAGCCGTGGTATAAATTAACAGGATACTAAAAAA
AAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020798	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH99107	(Get FASTA)	NCBI Sequence Viewer
	EDL78114	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000074673
	ENSRNOP00000074673.2
GenBank Protein	Q4KLM6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001020798 ⟸ NM_001025627
- Peptide Label:	precursor
- UniProtKB:	Q4KLM6 (UniProtKB/Swiss-Prot), A0A0G2K8N3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRESTWVSLLLLLLLPAPQRGGPQDGRGSPEPEPERGPLQPFDLLYASGVAAYYSGDYEGAVRD LEAALRSHRRLRDIRTRCARHCAARRPLAPPGAGPGAELPFFRAVLERARCSRSCQSQRLGGPA SRHRVSEDVRSDFQRRVPYNYLQRAYIKLNQLDKAMEAAHTFFMANPEHMEMQQNIEDYKATAR VEAPLVDREAKPHLESYNAGVKHYEADDFEAAIKYFEQALREYFNEDMVCRALCEGPQRFEEYE YLGSKGSLYEAIADHYMQVLVCQHECVRELATRPGRLSPIENFLPLHYDYLQFAYYRVGEYVKA LECAKAYLMFHPDDQDVLDNVDFYESLLDDSTDPASIEAREDLTAFVKRHKLEAELIKSAAEGL GFSYSEPNYWISYGGRQDENRVPSGVNMDGAEVHGLSMGKKSPPKIGRDLREGGPLLYENITFV YNSEQLNGTQRVLLDNVLSEEQCRELHSVASGIMLVGDGYRGKTSPHTPNEKFEGATVLKALKF GYEGRVPLKSARLFYDISEKARKIVESYFMLNSTLYFSYTHMVCRTALSGQQDRRNDLSHPIHA DNCLLDPEANECWKEPPAYTFRDYSALLYMNDDFEGGEFIFTEMDAKTVTASIKPKCGRMISFS SGGENPHGVKAVTRGQRCAVALWFTLDPLYRELERIQADEVIAILDQEQHGKHGLNINPKDEL hide sequence

Ensembl Acc Id:

ENSRNOP00000074673 ⟸ ENSRNOT00000089540

Ensembl Acc Id:

ENSRNOP00000092914 ⟸ ENSRNOT00000095886

Protein Domains

Fe2OG dioxygenase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4KLM6-F1-model_v2	AlphaFold	Q4KLM6	1-703	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304568	AgrOrtholog
BioCyc Gene	G2FUF-20933	BioCyc
BioCyc Pathway	PWY-7894 [procollagen hydroxylation and glycosylation]	BioCyc
BioCyc Pathway Image	PWY-7894	BioCyc
Ensembl Genes	ENSRNOG00000055751	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000089540	ENTREZGENE
	ENSRNOT00000089540.2	UniProtKB/Swiss-Prot
Gene3D-CATH	1.25.40.10	UniProtKB/Swiss-Prot
	q2cbj1_9rhob like domain	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7460856	IMAGE-MGC_LOAD
InterPro	Oxoglu/Fe-dep_dioxygenase	UniProtKB/Swiss-Prot
	P3H	UniProtKB/Swiss-Prot
	Pro_4_hyd_alph	UniProtKB/Swiss-Prot
	Pro_4_hyd_alph_FE2OG_OXY	UniProtKB/Swiss-Prot
	TPR-like_helical_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:288016	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:116247	IMAGE-MGC_LOAD
NCBI Gene	288016	ENTREZGENE
PANTHER	PTHR14049	UniProtKB/Swiss-Prot
	PTHR14049:SF1	UniProtKB/Swiss-Prot
Pfam	2OG-FeII_Oxy_3	UniProtKB/Swiss-Prot
PhenoGen	P3h2	PhenoGen
PROSITE	ER_TARGET	UniProtKB/Swiss-Prot
	FE2OG_OXY	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000055751	RatGTEx
SMART	P4Hc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48452	UniProtKB/Swiss-Prot
UniProt	A0A0G2K8N3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AGJ2_RAT	UniProtKB/TrEMBL
	P3H2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	P3h2	prolyl 3-hydroxylase 2	LOC102554639	prolyl 3-hydroxylase 2-like	Data merged from RGD:7561514	737654	PROVISIONAL
2014-12-17	P3h2	prolyl 3-hydroxylase 2	Leprel1	leprecan-like 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-12-17	LOC102554639	prolyl 3-hydroxylase 2-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-12-06	Leprel1	leprecan-like 1	Leprel1_predicted	leprecan-like 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Leprel1_predicted	leprecan-like 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIA

Imported Disease Annotations - OMIM

BioCyc Pathways