Symbol:
Scgn
Name:
secretagogin, EF-hand calcium binding protein
RGD ID:
1303281
Description:
Predicted to enable calcium ion binding activity. Predicted to be located in extracellular region and transport vesicle membrane. Predicted to be active in several cellular components, including cytosol; dendrite; and terminal bouton. Orthologous to human SCGN (secretagogin, EF-hand calcium binding protein); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; amitrole.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
secretagogin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SCGN (secretagogin, EF-hand calcium binding protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Scgn (secretagogin, EF-hand calcium binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Scgn (secretagogin, EF-hand calcium binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SCGN (secretagogin, EF-hand calcium binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SCGN (secretagogin, EF-hand calcium binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Scgn (secretagogin, EF-hand calcium binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SCGN (secretagogin, EF-hand calcium binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SCGN (secretagogin, EF-hand calcium binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Scgn (secretagogin, EF-hand calcium binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
STBD1 (starch binding domain 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
SCGN (secretagogin, EF-hand calcium binding protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Scgn (secretagogin, EF-hand calcium binding protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
scgn (secretagogin, EF-hand calcium binding protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Cbp53E
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
scgn
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 41,534,558 - 41,576,525 (+) NCBI GRCr8 mRatBN7.2 17 41,106,681 - 41,148,656 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 41,106,467 - 41,148,667 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 41,174,261 - 41,215,631 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 42,778,305 - 42,819,675 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 41,062,609 - 41,103,976 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 43,357,888 - 43,399,321 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 43,357,888 - 43,399,321 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 45,214,579 - 45,256,809 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 48,225,075 - 48,266,508 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 48,227,915 - 48,269,349 (+) NCBI Celera 17 40,739,598 - 40,779,916 (+) NCBI Celera Cytogenetic Map 17 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Scgn Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1616585 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SCGN mRNA CTD PMID:17942748 Scgn Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1616585 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SCGN mRNA CTD PMID:17942748 Scgn Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1347901 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of SCGN mRNA CTD PMID:26159488 Scgn Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1347901 6480464 Tetrachlorodibenzodioxin results in decreased expression of SCGN mRNA CTD PMID:20106945|PMID:21632981 Scgn Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1347901 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Scgn Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1347901 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Scgn Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SCGN mRNA CTD PMID:24780913 Scgn Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SCGN mRNA CTD PMID:30047161 Scgn Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of SCGN mRNA CTD PMID:28959563 Scgn Rat aflatoxin B1 affects expression ISO RGD:1347901 6480464 Aflatoxin B1 affects the expression of SCGN protein CTD PMID:20106945 Scgn Rat aflatoxin B1 decreases methylation ISO RGD:1347901 6480464 Aflatoxin B1 results in decreased methylation of SCGN gene CTD PMID:27153756 Scgn Rat aflatoxin B1 decreases expression ISO RGD:1347901 6480464 Aflatoxin B1 results in decreased expression of SCGN mRNA CTD PMID:22100608|PMID:32234424 Scgn Rat aflatoxin M1 decreases expression ISO RGD:1347901 6480464 Aflatoxin M1 results in decreased expression of SCGN mRNA CTD PMID:30928695 Scgn Rat all-trans-retinoic acid increases expression ISO RGD:1347901 6480464 Tretinoin results in increased expression of SCGN mRNA CTD PMID:23724009 Scgn Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SCGN mRNA CTD PMID:30047161 Scgn Rat arsane affects methylation ISO RGD:1347901 6480464 Arsenic affects the methylation of SCGN gene CTD PMID:25304211 Scgn Rat arsenic atom affects methylation ISO RGD:1347901 6480464 Arsenic affects the methylation of SCGN gene CTD PMID:25304211 Scgn Rat benzo[a]pyrene increases expression ISO RGD:1347901 6480464 Benzo(a)pyrene results in increased expression of SCGN mRNA CTD PMID:21632981 Scgn Rat benzo[a]pyrene decreases expression ISO RGD:1347901 6480464 Benzo(a)pyrene results in decreased expression of SCGN mRNA CTD PMID:32234424 Scgn Rat benzo[a]pyrene increases methylation ISO RGD:1347901 6480464 Benzo(a)pyrene results in increased methylation of SCGN exon; Benzo(a)pyrene results in increased methylation of SCGN more ... CTD PMID:27901495 Scgn Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:1347901 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated more ... CTD PMID:32949613 Scgn Rat bisphenol A decreases methylation ISO RGD:1347901 6480464 bisphenol A results in decreased methylation of SCGN gene CTD PMID:31601247 Scgn Rat Butylbenzyl phthalate multiple interactions ISO RGD:1347901 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated more ... CTD PMID:32949613 Scgn Rat cyclosporin A decreases expression ISO RGD:1347901 6480464 Cyclosporine results in decreased expression of SCGN mRNA CTD PMID:20106945|PMID:25562108 Scgn Rat cyclosporin A increases expression ISO RGD:1347901 6480464 Cyclosporine results in increased expression of SCGN mRNA CTD PMID:27989131 Scgn Rat dexamethasone multiple interactions ISO RGD:1347901 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Scgn Rat dicrotophos decreases expression ISO RGD:1347901 6480464 dicrotophos results in decreased expression of SCGN mRNA CTD PMID:28302478 Scgn Rat diisononyl phthalate multiple interactions ISO RGD:1347901 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated more ... CTD PMID:32949613 Scgn Rat dorsomorphin multiple interactions ISO RGD:1347901 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Scgn Rat endosulfan multiple interactions ISO RGD:1347901 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of SCGN mRNA CTD PMID:26159488 Scgn Rat epoxiconazole affects expression ISO RGD:1616585 6480464 epoxiconazole affects the expression of SCGN mRNA CTD PMID:35436446 Scgn Rat hydrogen peroxide affects expression ISO RGD:1347901 6480464 Hydrogen Peroxide affects the expression of SCGN mRNA CTD PMID:20044591 Scgn Rat indometacin multiple interactions ISO RGD:1347901 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Scgn Rat ivermectin decreases expression ISO RGD:1347901 6480464 Ivermectin results in decreased expression of SCGN protein CTD PMID:32959892 Scgn Rat lead nitrate multiple interactions ISO RGD:1347901 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated more ... CTD PMID:32949613 Scgn Rat mercury atom multiple interactions ISO RGD:1347901 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated more ... CTD PMID:32949613 Scgn Rat mercury(0) multiple interactions ISO RGD:1347901 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated more ... CTD PMID:32949613 Scgn Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SCGN mRNA CTD PMID:30047161 Scgn Rat O-methyleugenol decreases expression ISO RGD:1347901 6480464 methyleugenol results in decreased expression of SCGN mRNA CTD PMID:32234424 Scgn Rat okadaic acid decreases expression ISO RGD:1347901 6480464 Okadaic Acid results in decreased expression of SCGN mRNA CTD PMID:38832940 Scgn Rat panobinostat multiple interactions ISO RGD:1347901 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Scgn Rat paracetamol decreases expression ISO RGD:1347901 6480464 Acetaminophen results in decreased expression of SCGN mRNA CTD PMID:29067470 Scgn Rat perfluorohexanesulfonic acid increases expression ISO RGD:1616585 6480464 perfluorohexanesulfonic acid results in increased expression of SCGN mRNA CTD PMID:37315490 Scgn Rat SB 431542 multiple interactions ISO RGD:1347901 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Scgn Rat silicon dioxide decreases expression ISO RGD:1347901 6480464 Silicon Dioxide analog results in decreased expression of SCGN mRNA CTD PMID:25895662 Scgn Rat silicon dioxide increases expression ISO RGD:1347901 6480464 Silicon Dioxide analog results in increased expression of SCGN mRNA CTD PMID:23806026 Scgn Rat sodium arsenite affects methylation ISO RGD:1347901 6480464 sodium arsenite affects the methylation of SCGN gene CTD PMID:28589171 Scgn Rat sodium arsenite multiple interactions ISO RGD:1347901 6480464 sodium arsenite promotes the reaction [SCGN protein binds to CAPRIN1 protein] CTD PMID:33939924 Scgn Rat sodium arsenite decreases expression ISO RGD:1616585 6480464 sodium arsenite results in decreased expression of SCGN mRNA CTD PMID:37682722 Scgn Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of SCGN mRNA CTD PMID:30047161 Scgn Rat troglitazone increases expression ISO RGD:1347901 6480464 troglitazone results in increased expression of SCGN mRNA CTD PMID:28934090 Scgn Rat urethane decreases expression ISO RGD:1347901 6480464 Urethane results in decreased expression of SCGN mRNA CTD PMID:28818685 Scgn Rat valproic acid increases expression ISO RGD:1347901 6480464 Valproic Acid results in increased expression of SCGN mRNA CTD PMID:28001369 Scgn Rat vorinostat multiple interactions ISO RGD:1347901 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386
Scgn Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 41,534,558 - 41,576,525 (+) NCBI GRCr8 mRatBN7.2 17 41,106,681 - 41,148,656 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 41,106,467 - 41,148,667 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 41,174,261 - 41,215,631 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 42,778,305 - 42,819,675 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 41,062,609 - 41,103,976 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 43,357,888 - 43,399,321 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 43,357,888 - 43,399,321 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 45,214,579 - 45,256,809 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 48,225,075 - 48,266,508 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 48,227,915 - 48,269,349 (+) NCBI Celera 17 40,739,598 - 40,779,916 (+) NCBI Celera Cytogenetic Map 17 p11 NCBI
SCGN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 25,652,215 - 25,701,783 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 25,652,201 - 25,701,783 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 25,652,443 - 25,702,011 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 25,760,408 - 25,809,990 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 25,760,407 - 25,809,985 NCBI Celera 6 26,879,633 - 26,929,216 (+) NCBI Celera Cytogenetic Map 6 p22.2 NCBI HuRef 6 25,595,416 - 25,644,987 (+) NCBI HuRef CHM1_1 6 25,654,627 - 25,704,213 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 25,518,025 - 25,567,550 (+) NCBI T2T-CHM13v2.0
Scgn Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 24,137,439 - 24,175,310 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 24,137,439 - 24,175,197 (-) Ensembl GRCm39 Ensembl GRCm38 13 23,953,456 - 23,991,327 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 23,953,456 - 23,991,214 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 24,045,325 - 24,083,083 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 23,960,921 - 23,998,679 (-) NCBI MGSCv36 mm8 Celera 13 24,185,142 - 24,222,913 (-) NCBI Celera Cytogenetic Map 13 A3.1 NCBI cM Map 13 10.01 NCBI
Scgn Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955483 1,392,770 - 1,429,594 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955483 1,392,772 - 1,429,563 (-) NCBI ChiLan1.0 ChiLan1.0
SCGN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 40,299,097 - 40,367,239 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 36,300,454 - 36,350,030 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 25,486,599 - 25,571,272 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 25,812,650 - 25,862,236 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 25,812,443 - 25,862,227 (+) Ensembl panpan1.1 panPan2
SCGN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 23,602,244 - 23,638,108 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 23,602,343 - 23,638,055 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 35 23,531,684 - 23,540,559 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 35 23,717,908 - 23,753,767 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 35 23,717,868 - 23,753,765 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 35 23,527,247 - 23,563,304 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 23,577,972 - 23,614,023 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 25,015,623 - 25,051,501 (+) NCBI UU_Cfam_GSD_1.0
Scgn Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 1,929,640 - 1,965,364 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936671 1,655,978 - 1,693,175 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936671 1,656,179 - 1,696,580 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SCGN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 20,389,493 - 20,432,978 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 20,389,156 - 20,432,985 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 21,689,440 - 21,732,931 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SCGN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 46,554,759 - 46,605,282 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 46,565,302 - 46,604,710 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 25,585,367 - 25,635,700 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Scgn
.
Predicted Target Of
Count of predictions: 55 Count of miRNA genes: 51 Interacting mature miRNAs: 55 Transcripts: ENSRNOT00000022329 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 1358295 Aocep1 Aortic cell protein QTL 1 6.1 7e-07 thoracic aorta cellular protein amount (VT:0010598) aortic cell percentage 17 40990005 85990005 Rat 1354640 Scl32 Serum cholesterol level QTL 32 5.4 blood HDL cholesterol amount (VT:0000184) blood high density lipoprotein cholesterol level (CMO:0000052) 17 15781592 60781592 Rat 152023626 Bp403 Blood pressure QTL 403 3.86 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 2301412 Kidm40 Kidney mass QTL 40 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 37479847 82479847 Rat 9590107 Sffal7 Serum free fatty acids level QTL 7 4.81 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 17 28409147 73409147 Rat 2302377 Scl61 Serum cholesterol level QTL 61 4.36 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 17 27389946 53481766 Rat 70157 Niddm32 Non-insulin dependent diabetes mellitus QTL 32 4.34 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 22454924 50909196 Rat 724549 Niddm56 Non-insulin dependent diabetes mellitus QTL 56 0.03 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 31990784 76990784 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 1598871 Memor5 Memory QTL 5 5.3 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 17 40540041 80387013 Rat 1354628 Stl13 Serum triglyceride level QTL 13 3.8 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 21293039 60781592 Rat 1581512 Cm55 Cardiac mass QTL 55 2.8 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 27027949 56836890 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 61394 Bp8 Blood pressure QTL 8 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 23080567 59555013 Rat 1559055 Bp278 Blood pressure QTL 278 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 68653184 Rat 10450503 Bp386 Blood pressure QTL 386 0.28 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 31368391 62109574 Rat 152025238 Slep14 Serum leptin concentration QTL 14 4.62 blood leptin amount (VT:0005667) 17 24184890 79524188 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 2313854 Bp343 Blood pressure QTL 343 3.9 life span trait (VT:0005372) age at time of death (CMO:0001193) 17 31990784 50909196 Rat 2317054 Aia12 Adjuvant induced arthritis QTL 12 4.24 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 17 38281509 83281509 Rat 1331765 Hrtrt15 Heart rate QTL 15 4.094 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 17 15330613 55836425 Rat 8552928 Pigfal9 Plasma insulin-like growth factor 1 level QTL 9 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 17 28409147 73409147 Rat 1300148 Bp192 Blood pressure QTL 192 3.47 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 17 34550843 73951021 Rat 2317060 Aia26 Adjuvant induced arthritis QTL 26 3.22 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 17 38281509 83281509 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 12903980 Cm120 Cardiac mass QTL 120 0.002 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 17 23653184 68653184 Rat 12903981 Am17 Aortic mass QTL 17 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 17 23653184 68653184 Rat 4889955 Bss93 Bone structure and strength QTL 93 4.4 tibia size trait (VT:0100001) tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727) 17 27027949 60463643 Rat 2303561 Bw91 Body weight QTL 91 2 body mass (VT:0001259) body weight (CMO:0000012) 17 8868462 53868462 Rat 12903982 Kidm70 Kidney mass QTL 70 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 23653184 70974005 Rat 12903978 Cm118 Cardiac mass QTL 118 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 17 23653184 68653184 Rat 2324621 Coatc5 Coat color QTL 5 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 17 31368391 73951021 Rat 12903979 Cm119 Cardiac mass QTL 119 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 23653184 68653184 Rat 1354619 Bp242 Blood pressure QTL 242 6.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 24599340 69599340 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 152023740 Bp406 Blood pressure QTL 406 6.06 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 1354663 Bvd5 Brain ventricular dilatation QTL 5 3.51 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 17 31990784 81292925 Rat 7488966 Bp370 Blood pressure QTL 370 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 57246843 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 152023737 Bp405 Blood pressure QTL 405 5.06 arterial blood pressure trait (VT:2000000) 23930421 79524188 Rat 1354659 Scl68 Serum cholesterol level QTL 68 3.9 blood VLDL cholesterol amount (VT:0005144) blood very low density lipoprotein cholesterol level (CMO:0000648) 17 15781592 60781592 Rat 152023736 Bp404 Blood pressure QTL 404 3.78 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 724528 Uae4 Urinary albumin excretion QTL 4 4.9 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 17 35837085 69599340 Rat
AU048822
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 41,109,833 - 41,110,115 (+) MAPPER mRatBN7.2 Rnor_6.0 17 43,360,912 - 43,361,195 NCBI Rnor6.0 Rnor_5.0 17 45,217,995 - 45,218,278 UniSTS Rnor5.0 Rnor_5.0 17 45,217,803 - 45,218,278 UniSTS Rnor5.0 RGSC_v3.4 17 48,228,099 - 48,228,382 UniSTS RGSC3.4 Celera 17 40,741,497 - 40,741,768 UniSTS Cytogenetic Map 17 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
12
104
50
48
24
18
24
2
100
45
91
15
44
24
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022329 ⟹ ENSRNOP00000022329
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 41,106,467 - 41,148,667 (+) Ensembl Rnor_6.0 Ensembl 17 43,357,888 - 43,399,321 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107254 ⟹ ENSRNOP00000094214
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 41,106,467 - 41,148,667 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113807 ⟹ ENSRNOP00000097747
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 41,106,467 - 41,148,667 (+) Ensembl
RefSeq Acc Id:
NM_201561 ⟹ NP_963855
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 41,534,558 - 41,576,525 (+) NCBI mRatBN7.2 17 41,106,681 - 41,148,656 (+) NCBI Rnor_6.0 17 43,357,888 - 43,399,321 (+) NCBI Rnor_5.0 17 45,214,579 - 45,256,809 (+) NCBI RGSC_v3.4 17 48,225,075 - 48,266,508 (+) RGD Celera 17 40,739,598 - 40,779,916 (+) RGD
Sequence:
ATGGACAACGCACACAGACAAACTCAAGCTCATTTGGATGCTGCCTGCTTCTGGCAGATCTGGCAGCGCTTCGACAAGGATGAAAAAGGTTACATAAAAGAGACAGAGCTGGATGCCTTTTTTGACGA
hide sequence
RefSeq Acc Id:
NP_963855 ⟸ NM_201561
- UniProtKB:
Q6R556 (UniProtKB/Swiss-Prot), F1LN07 (UniProtKB/TrEMBL)
- Sequence:
MDNAHRQTQAHLDAACFWQIWQRFDKDEKGYIKETELDAFFDDLLAKFGIEDTLMEENVQKMKEQLMVGHDISKEGRILMKELASMFLSEDENFLLFFRLETPLDNSVEFMQIWRKYDADSSGFISAA
hide sequence
Ensembl Acc Id:
ENSRNOP00000022329 ⟸ ENSRNOT00000022329
Ensembl Acc Id:
ENSRNOP00000094214 ⟸ ENSRNOT00000107254
Ensembl Acc Id:
ENSRNOP00000097747 ⟸ ENSRNOT00000113807
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Scgn
secretagogin, EF-hand calcium binding protein
Symbol and Name status set to approved
1299863 APPROVED
2005-07-14
Scgn
secretagogin, EF-hand calcium binding protein
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_disease
elevated levels are associated with neuronal damage in humans
1303949
