Symbol:
SCGN
Name:
secretagogin, EF-hand calcium binding protein
RGD ID:
1347901
HGNC Page
HGNC:16941
Description:
Predicted to enable calcium ion binding activity. Predicted to be located in cytoplasm. Predicted to be active in several cellular components, including cytosol; dendrite; and terminal bouton.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
calbindin-like; CALBL; DJ501N12.8; SECRET; secretagogin; SEGN; setagin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Scgn (secretagogin, EF-hand calcium binding protein) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Scgn (secretagogin, EF-hand calcium binding protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Scgn (secretagogin, EF-hand calcium binding protein) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
SCGN (secretagogin, EF-hand calcium binding protein) NCBI
Ortholog
Canis lupus familiaris (dog):
SCGN (secretagogin, EF-hand calcium binding protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Scgn (secretagogin, EF-hand calcium binding protein) NCBI
Ortholog
Sus scrofa (pig):
SCGN (secretagogin, EF-hand calcium binding protein) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
SCGN (secretagogin, EF-hand calcium binding protein) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Scgn (secretagogin, EF-hand calcium binding protein) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Adamtsl2 (ADAMTS-like 2) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Scgn (secretagogin, EF-hand calcium binding protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Scgn (secretagogin, EF-hand calcium binding protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
scgn (secretagogin, EF-hand calcium binding protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Cbp53E
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
scgn
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
scgn.S
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
scgn.L
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 25,652,215 - 25,701,783 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 25,652,201 - 25,701,783 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 25,652,443 - 25,702,011 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 25,760,408 - 25,809,990 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 25,760,407 - 25,809,985 NCBI Celera 6 26,879,633 - 26,929,216 (+) NCBI Celera Cytogenetic Map 6 p22.2 NCBI HuRef 6 25,595,416 - 25,644,987 (+) NCBI HuRef CHM1_1 6 25,654,627 - 25,704,213 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 25,518,025 - 25,567,550 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
SCGN Human 17alpha-ethynylestradiol multiple interactions ISO Scgn (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SCGN mRNA CTD PMID:17942748 SCGN Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Scgn (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SCGN mRNA CTD PMID:17942748 SCGN Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of SCGN mRNA CTD PMID:26159488 SCGN Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SCGN mRNA CTD PMID:20106945 and PMID:21632981 SCGN Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of SCGN mRNA CTD PMID:28628672 SCGN Human 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of SCGN mRNA CTD PMID:28628672 SCGN Human 6-propyl-2-thiouracil increases expression ISO Scgn (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of SCGN mRNA CTD PMID:24780913 SCGN Human 6-propyl-2-thiouracil decreases expression ISO Scgn (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of SCGN mRNA CTD PMID:30047161 SCGN Human acrylamide increases expression ISO Scgn (Rattus norvegicus) 6480464 Acrylamide results in increased expression of SCGN mRNA CTD PMID:28959563 SCGN Human aflatoxin B1 affects expression EXP 6480464 Aflatoxin B1 affects the expression of SCGN protein CTD PMID:20106945 SCGN Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of SCGN gene CTD PMID:27153756 SCGN Human aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of SCGN mRNA CTD PMID:22100608 and PMID:32234424 SCGN Human aflatoxin M1 decreases expression EXP 6480464 Aflatoxin M1 results in decreased expression of SCGN mRNA CTD PMID:30928695 SCGN Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of SCGN mRNA CTD PMID:23724009 SCGN Human amitrole decreases expression ISO Scgn (Rattus norvegicus) 6480464 Amitrole results in decreased expression of SCGN mRNA CTD PMID:30047161 SCGN Human arsane affects methylation EXP 6480464 Arsenic affects the methylation of SCGN gene CTD PMID:25304211 SCGN Human arsenic atom affects methylation EXP 6480464 Arsenic affects the methylation of SCGN gene CTD PMID:25304211 SCGN Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SCGN mRNA CTD PMID:21632981 SCGN Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of SCGN mRNA CTD PMID:32234424 SCGN Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of SCGN exon and Benzo(a)pyrene results in increased methylation of SCGN promoter CTD PMID:27901495 SCGN Human bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in increased expression of SCGN mRNA CTD PMID:32949613 SCGN Human bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of SCGN gene CTD PMID:31601247 SCGN Human Butylbenzyl phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in increased expression of SCGN mRNA CTD PMID:32949613 SCGN Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of SCGN mRNA CTD PMID:20106945 and PMID:25562108 SCGN Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of SCGN mRNA CTD PMID:27989131 SCGN Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of SCGN mRNA CTD PMID:28628672 SCGN Human dicrotophos decreases expression EXP 6480464 dicrotophos results in decreased expression of SCGN mRNA CTD PMID:28302478 SCGN Human diisononyl phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in increased expression of SCGN mRNA CTD PMID:32949613 SCGN Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 SCGN Human endosulfan multiple interactions EXP 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of SCGN mRNA CTD PMID:26159488 SCGN Human epoxiconazole affects expression ISO Scgn (Mus musculus) 6480464 epoxiconazole affects the expression of SCGN mRNA CTD PMID:35436446 SCGN Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of SCGN mRNA CTD PMID:20044591 SCGN Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of SCGN mRNA CTD PMID:28628672 SCGN Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of SCGN protein CTD PMID:32959892 SCGN Human lead nitrate multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in increased expression of SCGN mRNA CTD PMID:32949613 SCGN Human mercury atom multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in increased expression of SCGN mRNA CTD PMID:32949613 SCGN Human mercury(0) multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in increased expression of SCGN mRNA CTD PMID:32949613 SCGN Human methimazole decreases expression ISO Scgn (Rattus norvegicus) 6480464 Methimazole results in decreased expression of SCGN mRNA CTD PMID:30047161 SCGN Human O-methyleugenol decreases expression EXP 6480464 methyleugenol results in decreased expression of SCGN mRNA CTD PMID:32234424 SCGN Human panobinostat multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SCGN mRNA CTD PMID:27188386 SCGN Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SCGN mRNA CTD PMID:29067470 SCGN Human perfluorohexanesulfonic acid increases expression ISO Scgn (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of SCGN mRNA CTD PMID:37315490 SCGN Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 SCGN Human silicon dioxide decreases expression EXP 6480464 Silicon Dioxide analog results in decreased expression of SCGN mRNA CTD PMID:25895662 SCGN Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of SCGN mRNA CTD PMID:23806026 SCGN Human sodium arsenite affects methylation EXP 6480464 sodium arsenite affects the methylation of SCGN gene CTD PMID:28589171 SCGN Human sodium arsenite decreases expression ISO Scgn (Mus musculus) 6480464 sodium arsenite results in decreased expression of SCGN mRNA CTD PMID:37682722 SCGN Human sodium arsenite multiple interactions EXP 6480464 sodium arsenite promotes the reaction [SCGN protein binds to CAPRIN1 protein] CTD PMID:33939924 SCGN Human sulfadimethoxine decreases expression ISO Scgn (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of SCGN mRNA CTD PMID:30047161 SCGN Human troglitazone increases expression EXP 6480464 troglitazone results in increased expression of SCGN mRNA CTD PMID:28934090 SCGN Human urethane decreases expression EXP 6480464 Urethane results in decreased expression of SCGN mRNA CTD PMID:28818685 SCGN Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of SCGN mRNA CTD PMID:28001369 SCGN Human vorinostat multiple interactions EXP 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SCGN mRNA CTD PMID:27188386
SCGN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 25,652,215 - 25,701,783 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 25,652,201 - 25,701,783 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 25,652,443 - 25,702,011 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 25,760,408 - 25,809,990 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 25,760,407 - 25,809,985 NCBI Celera 6 26,879,633 - 26,929,216 (+) NCBI Celera Cytogenetic Map 6 p22.2 NCBI HuRef 6 25,595,416 - 25,644,987 (+) NCBI HuRef CHM1_1 6 25,654,627 - 25,704,213 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 25,518,025 - 25,567,550 (+) NCBI T2T-CHM13v2.0
Scgn Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 24,137,439 - 24,175,310 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 24,137,439 - 24,175,197 (-) Ensembl GRCm39 Ensembl GRCm38 13 23,953,456 - 23,991,327 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 23,953,456 - 23,991,214 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 24,045,325 - 24,083,083 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 23,960,921 - 23,998,679 (-) NCBI MGSCv36 mm8 Celera 13 24,185,142 - 24,222,913 (-) NCBI Celera Cytogenetic Map 13 A3.1 NCBI cM Map 13 10.01 NCBI
Scgn Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 41,534,558 - 41,576,525 (+) NCBI GRCr8 mRatBN7.2 17 41,106,681 - 41,148,656 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 41,106,467 - 41,148,667 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 41,174,261 - 41,215,631 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 42,778,305 - 42,819,675 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 41,062,609 - 41,103,976 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 43,357,888 - 43,399,321 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 43,357,888 - 43,399,321 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 45,214,579 - 45,256,809 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 48,225,075 - 48,266,508 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 48,227,915 - 48,269,349 (+) NCBI Celera 17 40,739,598 - 40,779,916 (+) NCBI Celera Cytogenetic Map 17 p11 NCBI
Scgn Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955483 1,392,770 - 1,429,594 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955483 1,392,772 - 1,429,563 (-) NCBI ChiLan1.0 ChiLan1.0
SCGN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 40,299,097 - 40,367,239 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 36,300,454 - 36,350,030 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 25,486,599 - 25,571,272 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 25,812,650 - 25,862,236 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 25,812,443 - 25,862,227 (+) Ensembl panpan1.1 panPan2
SCGN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 23,602,244 - 23,638,108 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 23,602,343 - 23,638,055 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 35 23,531,684 - 23,540,559 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 35 23,717,908 - 23,753,767 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 35 23,717,868 - 23,753,765 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 35 23,527,247 - 23,563,304 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 23,577,972 - 23,614,023 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 25,015,623 - 25,051,501 (+) NCBI UU_Cfam_GSD_1.0
Scgn Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 1,929,640 - 1,965,364 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936671 1,655,978 - 1,693,175 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936671 1,656,179 - 1,696,580 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SCGN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 20,389,493 - 20,432,978 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 20,389,156 - 20,432,985 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 21,689,440 - 21,732,931 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SCGN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 46,554,759 - 46,605,282 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 46,565,302 - 46,604,710 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 25,585,367 - 25,635,700 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Scgn
.
Predicted Target Of
Count of predictions: 495 Count of miRNA genes: 362 Interacting mature miRNAs: 382 Transcripts: ENST00000334979, ENST00000377961 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597117141 GWAS1213215_H mathematical ability QTL GWAS1213215 (human) 5e-09 mathematical ability 6 25690708 25690709 Human 597191952 GWAS1288026_H systemic lupus erythematosus QTL GWAS1288026 (human) 1e-08 systemic lupus erythematosus 6 25684051 25684052 Human 597061790 GWAS1157864_H lung carcinoma QTL GWAS1157864 (human) 0.0000001 lung carcinoma 6 25684378 25684379 Human 1298458 BW9_H Body weight QTL 9 (human) 2.7 0.0002 Body fat amount 6 6911960 32911960 Human 597103390 GWAS1199464_H platelet crit QTL GWAS1199464 (human) 1e-09 platelet quantity (VT:0003179) plateletcrit (CMO:0001349) 6 25676169 25676170 Human 597175698 GWAS1271772_H non-alcoholic fatty liver disease, type 2 diabetes mellitus QTL GWAS1271772 (human) 4e-09 non-alcoholic fatty liver disease, type 2 diabetes mellitus 6 25673045 25673046 Human 597208087 GWAS1304161_H vitamin D measurement QTL GWAS1304161 (human) 4e-11 vitamin D measurement 6 25662645 25662646 Human 597204744 GWAS1300818_H upper aerodigestive tract neoplasm QTL GWAS1300818 (human) 6e-11 upper aerodigestive tract neoplasm 6 25684378 25684379 Human 597224009 GWAS1320083_H BMI-adjusted waist circumference QTL GWAS1320083 (human) 2e-08 body size trait (VT:0100005) 6 25683052 25683053 Human 1358854 MULTSCL4_H Multiple sclerosis susceptibility QTL 4 (human) Multiple sclerosis susceptibility 6 6911960 32911960 Human 597425097 GWAS1521171_H systolic blood pressure QTL GWAS1521171 (human) 4e-10 systolic blood pressure systolic blood pressure (CMO:0000004) 6 25684051 25684052 Human 597078148 GWAS1174222_H cortisol measurement, response to corticosteroid, response to synacthen QTL GWAS1174222 (human) 8e-08 cortisol measurement, response to corticosteroid, response to synacthen urine cortisol level (CMO:0000282) 6 25701739 25701740 Human 597224011 GWAS1320085_H BMI-adjusted waist circumference QTL GWAS1320085 (human) 4e-09 body size trait (VT:0100005) 6 25684177 25684178 Human 597191819 GWAS1287893_H systemic lupus erythematosus QTL GWAS1287893 (human) 2e-10 systemic lupus erythematosus 6 25684177 25684178 Human 597141891 GWAS1237965_H X-13866 measurement QTL GWAS1237965 (human) 3e-13 X-13866 measurement 6 25684425 25684426 Human 597463620 GWAS1559694_H diastolic blood pressure QTL GWAS1559694 (human) 1e-20 diastolic blood pressure diastolic blood pressure (CMO:0000005) 6 25684051 25684052 Human 597270209 GWAS1366283_H rheumatoid arthritis, type 1 diabetes mellitus QTL GWAS1366283 (human) 9e-11 rheumatoid arthritis, type 1 diabetes mellitus 6 25684177 25684178 Human 597196737 GWAS1292811_H lean body mass QTL GWAS1292811 (human) 9e-09 body lean mass (VT:0010483) total body lean mass (CMO:0003950) 6 25685264 25685265 Human 597163598 GWAS1259672_H factor VIII measurement, coronary artery disease QTL GWAS1259672 (human) 2e-09 factor VIII measurement, coronary artery disease 6 25691923 25691924 Human 1358857 MULTSCL19_H Multiple sclerosis susceptibility QTL 19 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 1643399 BMD5_H Bone mineral density QTL 5 (human) 2.32 0.0005 Bone mineral density 6 6911960 32911960 Human 597190151 GWAS1286225_H systemic lupus erythematosus QTL GWAS1286225 (human) 1e-13 systemic lupus erythematosus 6 25683052 25683053 Human 1358839 MULTSCL5_H Multiple sclerosis susceptibility QTL 5 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 597268349 GWAS1364423_H diastolic blood pressure QTL GWAS1364423 (human) 9e-12 diastolic blood pressure diastolic blood pressure (CMO:0000005) 6 25675140 25675141 Human 597068595 GWAS1164669_H squamous cell lung carcinoma QTL GWAS1164669 (human) 3e-10 squamous cell lung carcinoma 6 25684378 25684379 Human 597052211 GWAS1148285_H white matter microstructure measurement QTL GWAS1148285 (human) 4e-08 white matter microstructure measurement 6 25685650 25685651 Human 597347581 GWAS1443655_H nephrolithiasis QTL GWAS1443655 (human) 4e-08 nephrolithiasis 6 25684378 25684379 Human 597433723 GWAS1529797_H protein measurement QTL GWAS1529797 (human) 8e-94 protein measurement 6 25693046 25693047 Human 1643377 BW325_H Body weight QTL 325 (human) 2.32 0.0005 Body fat amount 6 6911960 32911960 Human 1643569 GLUCO21_H Glucose level QTL 21 (human) 0.021 Glucose level non-insulin-dependent 6 6911960 32911960 Human 1298431 RA11_H Rheumatoid arthritis QTL 11 (human) 0.0000024 Joint/bone inflammation rheumatoid arthritis 6 19911883 40191709 Human 597065255 GWAS1161329_H response to simvastatin, total cholesterol change measurement, response to fenofibrate QTL GWAS1161329 (human) 0.0000005 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 6 25667803 25667804 Human 596965921 GWAS1085440_H rheumatoid arthritis, type 1 diabetes mellitus QTL GWAS1085440 (human) 9e-11 rheumatoid arthritis, type 1 diabetes mellitus 6 25684177 25684178 Human 597044968 GWAS1141042_H aging, epigenetic status QTL GWAS1141042 (human) 4e-09 aging, epigenetic status 6 25671618 25671619 Human
RH99089
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 25,701,700 - 25,701,840 UniSTS GRCh37 Build 36 6 25,809,679 - 25,809,819 RGD NCBI36 Celera 6 26,928,904 - 26,929,044 RGD Cytogenetic Map 6 p22.3-p22.1 UniSTS HuRef 6 25,644,675 - 25,644,815 UniSTS GeneMap99-GB4 RH Map 6 104.59 UniSTS
SCGN_9148
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 25,701,504 - 25,702,087 UniSTS GRCh37 Build 36 6 25,809,483 - 25,810,066 RGD NCBI36 Celera 6 26,928,708 - 26,929,292 RGD HuRef 6 25,644,479 - 25,645,063 UniSTS
D6S1468
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 25,650,714 - 25,650,841 UniSTS GRCh37 Build 36 6 25,758,693 - 25,758,820 RGD NCBI36 Celera 6 26,877,918 - 26,878,045 RGD Cytogenetic Map 6 p22.3-p22.1 UniSTS HuRef 6 25,593,701 - 25,593,828 UniSTS
AL021842
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 25,654,747 - 25,654,878 UniSTS GRCh37 Build 36 6 25,762,726 - 25,762,857 RGD NCBI36 Celera 6 26,881,951 - 26,882,082 RGD Cytogenetic Map 6 p22.3-p22.1 UniSTS HuRef 6 25,597,734 - 25,597,865 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1187
2310
1757
2006
4155
1661
1940
4
595
796
449
1649
5254
4978
13
3342
1
724
1381
1227
148
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000334979 ⟹ ENSP00000333933
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 25,652,404 - 25,701,335 (+) Ensembl
Ensembl Acc Id:
ENST00000377961 ⟹ ENSP00000367197
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 25,652,215 - 25,701,783 (+) Ensembl
Ensembl Acc Id:
ENST00000612225 ⟹ ENSP00000484392
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 25,652,201 - 25,701,774 (+) Ensembl
RefSeq Acc Id:
NM_006998 ⟹ NP_008929
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 25,652,215 - 25,701,783 (+) NCBI GRCh37 6 25,652,429 - 25,702,011 (+) ENTREZGENE Build 36 6 25,760,408 - 25,809,990 (+) NCBI Archive HuRef 6 25,595,416 - 25,644,987 (+) ENTREZGENE CHM1_1 6 25,654,627 - 25,704,213 (+) NCBI T2T-CHM13v2.0 6 25,518,025 - 25,567,550 (+) NCBI
Sequence:
GCTGAGGGCTGAGGGACGGCTCAGCGACGCCACGGCCAGCAGCGCTCGCGTCCTCCCCAGCAACAGTTACTCAAAGCTAATCAGATAGCGAAAGAAGCAGGAGAGCAAGTCAAGAAATACGGTGAAGG
hide sequence
RefSeq Acc Id:
XM_054354044 ⟹ XP_054210019
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 25,527,119 - 25,567,550 (+) NCBI
RefSeq Acc Id:
NP_008929 ⟸ NM_006998
- UniProtKB:
Q96QV7 (UniProtKB/Swiss-Prot), Q5VV44 (UniProtKB/Swiss-Prot), A8K0B2 (UniProtKB/Swiss-Prot), Q9UJF6 (UniProtKB/Swiss-Prot), O76038 (UniProtKB/Swiss-Prot), A0A994J4C2 (UniProtKB/TrEMBL)
- Sequence:
MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAA
hide sequence
Ensembl Acc Id:
ENSP00000333933 ⟸ ENST00000334979
Ensembl Acc Id:
ENSP00000484392 ⟸ ENST00000612225
Ensembl Acc Id:
ENSP00000367197 ⟸ ENST00000377961
RefSeq Acc Id:
XP_054210019 ⟸ XM_054354044
- Peptide Label:
isoform X1
RGD ID: 6872224 Promoter ID: EPDNEW_H9277 Type: initiation region Name: SCGN_1 Description: secretagogin, EF-hand calcium binding protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 6 25,652,225 - 25,652,285 EPDNEW
