Symbol:
Ly6g6c
Name:
lymphocyte antigen 6 family member G6C
RGD ID:
1302999
Description:
Predicted to enable identical protein binding activity. Predicted to act upstream of or within response to bacterium. Predicted to be part of protein-containing complex. Predicted to colocalize with external side of plasma membrane. Orthologous to human LY6G6C (lymphocyte antigen 6 family member G6C); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
lymphocyte antigen 6 complex G6C; lymphocyte antigen 6 complex locus protein G6c; lymphocyte antigen 6 complex, locus G6C
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 3,758,290 - 3,760,987 (-) NCBI GRCr8 mRatBN7.2 20 3,753,632 - 3,757,205 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 3,753,632 - 3,758,867 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 4,453,106 - 4,455,802 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 3,815,160 - 3,817,856 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 4,353,045 - 4,355,741 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 5,056,851 - 5,060,398 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 5,057,701 - 5,059,933 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 7,130,631 - 7,133,328 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 3,817,976 - 3,820,673 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 3,818,202 - 3,820,900 (-) NCBI Celera 20 4,269,727 - 4,272,424 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ly6g6c Rat 1,2-dimethylhydrazine multiple interactions ISO Ly6g6c (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of LY6G6C mRNA CTD PMID:22206623 Ly6g6c Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of LY6G6C mRNA CTD PMID:30723492 Ly6g6c Rat 17alpha-ethynylestradiol increases expression ISO Ly6g6c (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of LY6G6C mRNA CTD PMID:17942748 Ly6g6c Rat 17alpha-ethynylestradiol multiple interactions ISO Ly6g6c (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LY6G6C mRNA CTD PMID:17942748 Ly6g6c Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ly6g6c (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LY6G6C mRNA CTD PMID:17942748 Ly6g6c Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of LY6G6C mRNA CTD PMID:32109520 Ly6g6c Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ly6g6c (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of LY6G6C mRNA CTD PMID:17035482 Ly6g6c Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Ly6g6c Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Ly6g6c (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of LY6G6C mRNA CTD PMID:20188158 Ly6g6c Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of LY6G6C mRNA CTD PMID:20409345 Ly6g6c Rat 4,4'-sulfonyldiphenol affects methylation ISO Ly6g6c (Mus musculus) 6480464 bisphenol S affects the methylation of LY6G6C gene CTD PMID:31683443 Ly6g6c Rat 4-hydroxyphenyl retinamide decreases expression ISO Ly6g6c (Mus musculus) 6480464 Fenretinide results in decreased expression of LY6G6C mRNA CTD PMID:28973697 Ly6g6c Rat 5-fluorouracil affects response to substance ISO LY6G6C (Homo sapiens) 6480464 LY6G6C protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Ly6g6c Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of LY6G6C mRNA CTD PMID:24780913 Ly6g6c Rat acrylamide increases expression ISO LY6G6C (Homo sapiens) 6480464 Acrylamide results in increased expression of LY6G6C mRNA CTD PMID:32763439 Ly6g6c Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of LY6G6C mRNA CTD PMID:30779732 Ly6g6c Rat aristolochic acid A increases expression ISO LY6G6C (Homo sapiens) 6480464 aristolochic acid I results in increased expression of LY6G6C mRNA CTD PMID:33212167 Ly6g6c Rat arsane multiple interactions ISO LY6G6C (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of LY6G6C mRNA CTD PMID:32525701 Ly6g6c Rat arsenic atom multiple interactions ISO LY6G6C (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of LY6G6C mRNA CTD PMID:32525701 Ly6g6c Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LY6G6C mRNA CTD PMID:25181051 Ly6g6c Rat bisphenol A decreases methylation ISO LY6G6C (Homo sapiens) 6480464 bisphenol A results in decreased methylation of LY6G6C gene CTD PMID:31601247 Ly6g6c Rat cadmium atom decreases expression ISO LY6G6C (Homo sapiens) 6480464 Cadmium results in decreased expression of LY6G6C mRNA CTD PMID:24376830 Ly6g6c Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of LY6G6C promoter CTD PMID:22457795 Ly6g6c Rat carbon nanotube affects expression ISO Ly6g6c (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Ly6g6c Rat CGP 52608 multiple interactions ISO LY6G6C (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to LY6G6C gene] CTD PMID:28238834 Ly6g6c Rat chromium(6+) affects expression ISO Ly6g6c (Mus musculus) 6480464 chromium hexavalent ion affects the expression of LY6G6C mRNA CTD PMID:28472532 Ly6g6c Rat cisplatin decreases expression ISO LY6G6C (Homo sapiens) 6480464 Cisplatin results in decreased expression of LY6G6C mRNA CTD PMID:27392435 Ly6g6c Rat cisplatin multiple interactions ISO LY6G6C (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of LY6G6C mRNA CTD PMID:27392435 Ly6g6c Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of LY6G6C mRNA CTD PMID:26033743 Ly6g6c Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of LY6G6C mRNA CTD PMID:26033743 Ly6g6c Rat crocidolite asbestos increases expression ISO LY6G6C (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of LY6G6C mRNA CTD PMID:25351596 Ly6g6c Rat dimethylarsinic acid multiple interactions ISO Ly6g6c (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of LY6G6C mRNA CTD PMID:34876320 Ly6g6c Rat disodium selenite increases expression ISO LY6G6C (Homo sapiens) 6480464 Sodium Selenite results in increased expression of LY6G6C mRNA CTD PMID:18175754 Ly6g6c Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of LY6G6C mRNA CTD PMID:29391264 Ly6g6c Rat folic acid decreases expression ISO Ly6g6c (Mus musculus) 6480464 Folic Acid results in decreased expression of LY6G6C mRNA CTD PMID:25629700 Ly6g6c Rat folic acid multiple interactions ISO Ly6g6c (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of LY6G6C mRNA CTD PMID:22206623 Ly6g6c Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of LY6G6C mRNA CTD PMID:33387578 Ly6g6c Rat graphite affects expression EXP 6480464 Graphite affects the expression of LY6G6C mRNA CTD PMID:29933104 Ly6g6c Rat lead diacetate increases expression ISO Ly6g6c (Mus musculus) 6480464 lead acetate results in increased expression of LY6G6C mRNA CTD PMID:21829687 Ly6g6c Rat Licochalcone B increases expression ISO LY6G6C (Homo sapiens) 6480464 licochalcone B results in increased expression of LY6G6C mRNA CTD PMID:33647349 Ly6g6c Rat methylarsonic acid multiple interactions ISO Ly6g6c (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of LY6G6C mRNA CTD PMID:34876320 Ly6g6c Rat methylisothiazolinone increases expression ISO LY6G6C (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of LY6G6C mRNA CTD PMID:31629900 Ly6g6c Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of LY6G6C mRNA CTD PMID:30449730 Ly6g6c Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of LY6G6C mRNA CTD PMID:25729387 Ly6g6c Rat ozone multiple interactions ISO Ly6g6c (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of LY6G6C mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of LY6G6C mRNA CTD PMID:34911549 Ly6g6c Rat ozone increases expression ISO Ly6g6c (Mus musculus) 6480464 Ozone results in increased expression of LY6G6C mRNA CTD PMID:33026818 Ly6g6c Rat paracetamol decreases expression ISO LY6G6C (Homo sapiens) 6480464 Acetaminophen results in decreased expression of LY6G6C mRNA CTD PMID:22230336 Ly6g6c Rat perfluorohexanesulfonic acid decreases expression ISO Ly6g6c (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of LY6G6C mRNA CTD PMID:37995155 Ly6g6c Rat resveratrol multiple interactions ISO LY6G6C (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of LY6G6C mRNA CTD PMID:23557933 Ly6g6c Rat silver atom increases expression ISO Ly6g6c (Mus musculus) 6480464 Silver results in increased expression of LY6G6C mRNA CTD PMID:27131904 Ly6g6c Rat silver(0) increases expression ISO Ly6g6c (Mus musculus) 6480464 Silver results in increased expression of LY6G6C mRNA CTD PMID:27131904 Ly6g6c Rat sodium arsenate multiple interactions ISO LY6G6C (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of LY6G6C mRNA CTD PMID:32525701 Ly6g6c Rat sodium arsenate multiple interactions ISO Ly6g6c (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of LY6G6C mRNA CTD PMID:34876320 Ly6g6c Rat sodium arsenite decreases expression ISO LY6G6C (Homo sapiens) 6480464 sodium arsenite results in decreased expression of LY6G6C mRNA CTD PMID:21457566 Ly6g6c Rat sodium arsenite multiple interactions ISO Ly6g6c (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of LY6G6C mRNA CTD PMID:34876320 Ly6g6c Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of LY6G6C mRNA CTD PMID:25729387 Ly6g6c Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of LY6G6C mRNA CTD PMID:33387578 Ly6g6c Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of LY6G6C mRNA CTD PMID:23869203
1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chromium(6+) (ISO) cisplatin (ISO) copper atom (EXP) copper(0) (EXP) crocidolite asbestos (ISO) dimethylarsinic acid (ISO) disodium selenite (ISO) endosulfan (EXP) folic acid (ISO) gentamycin (EXP) graphite (EXP) lead diacetate (ISO) Licochalcone B (ISO) methylarsonic acid (ISO) methylisothiazolinone (ISO) ochratoxin A (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) resveratrol (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) topotecan (EXP) trichloroethene (EXP) vinclozolin (EXP)
Ly6g6c Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 3,758,290 - 3,760,987 (-) NCBI GRCr8 mRatBN7.2 20 3,753,632 - 3,757,205 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 3,753,632 - 3,758,867 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 4,453,106 - 4,455,802 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 3,815,160 - 3,817,856 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 4,353,045 - 4,355,741 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 5,056,851 - 5,060,398 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 5,057,701 - 5,059,933 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 7,130,631 - 7,133,328 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 3,817,976 - 3,820,673 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 3,818,202 - 3,820,900 (-) NCBI Celera 20 4,269,727 - 4,272,424 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
LY6G6C Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 31,718,648 - 31,721,746 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 31,718,648 - 31,721,746 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 31,686,425 - 31,689,523 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 31,794,404 - 31,797,489 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 31,794,403 - 31,797,489 NCBI Celera 6 33,284,651 - 33,287,736 (-) NCBI Celera Cytogenetic Map 6 p21.33 NCBI HuRef 6 31,472,653 - 31,475,739 (-) NCBI HuRef CHM1_1 6 31,688,542 - 31,691,628 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 31,571,681 - 31,575,898 (-) NCBI T2T-CHM13v2.0
Ly6g6c Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 35,286,301 - 35,289,024 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 35,284,364 - 35,289,026 (+) Ensembl GRCm39 Ensembl GRCm38 17 35,067,325 - 35,070,048 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 35,065,388 - 35,070,050 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 35,204,270 - 35,206,993 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 34,675,381 - 34,678,104 (+) NCBI MGSCv36 mm8 Celera 17 38,164,006 - 38,166,732 (+) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 18.59 NCBI
Ly6g6c Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955437 257,942 - 261,054 (-) NCBI ChiLan1.0 ChiLan1.0
LY6G6C Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 46,195,925 - 46,199,038 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 42,157,381 - 42,160,527 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 31,380,026 - 31,383,190 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 32,268,752 - 32,271,926 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 32,268,752 - 32,271,809 (-) Ensembl panpan1.1 panPan2
LY6G6C Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 1,197,828 - 1,201,660 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 1,198,301 - 1,201,102 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 1,334,395 - 1,338,249 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 1,343,212 - 1,347,065 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 1,343,199 - 1,346,484 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 1,202,508 - 1,206,353 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 1,269,715 - 1,273,576 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 1,337,345 - 1,341,201 (-) NCBI UU_Cfam_GSD_1.0
Ly6g6c Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 35,746,096 - 35,749,845 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936727 1,810,340 - 1,815,251 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936727 1,812,328 - 1,815,242 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LY6G6C
LY6G6C Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 40,300,918 - 40,304,891 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 40,301,880 - 40,304,464 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 31,631,084 - 31,634,985 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ly6g6c
.
Predicted Target Of
Count of predictions: 62 Count of miRNA genes: 51 Interacting mature miRNAs: 59 Transcripts: ENSRNOT00000001119 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61472 Aia1 Adjuvant induced arthritis QTL 1 18 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 2646395 4597031 Rat 2306850 Pia40 Pristane induced arthritis QTL 40 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 1527959 5304575 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 61448 Ciaa1 CIA Autoantibody QTL 1 30 0.001 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 20 2646395 4597031 Rat 1331772 Cdexp2 CD45RC expression in CD8 T cells QTL 2 5.7 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 20 3621649 10078919 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 1300152 Bp195 Blood pressure QTL 195 3.46 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 3621649 9243559 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat 737973 Pia21 Pristane induced arthritis QTL 21 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 4606812 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
4
49
110
77
76
45
25
45
6
197
95
90
45
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001119 ⟹ ENSRNOP00000001119
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 3,753,632 - 3,758,271 (-) Ensembl Rnor_6.0 Ensembl 20 5,057,701 - 5,059,933 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116480 ⟹ ENSRNOP00000097186
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 3,753,632 - 3,758,867 (-) Ensembl
RefSeq Acc Id:
NM_001001969 ⟹ NP_001001969
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,758,290 - 3,760,987 (-) NCBI mRatBN7.2 20 3,753,632 - 3,756,329 (-) NCBI Rnor_6.0 20 5,057,701 - 5,060,398 (+) NCBI Rnor_5.0 20 7,130,631 - 7,133,328 (+) NCBI RGSC_v3.4 20 3,817,976 - 3,820,673 (-) RGD Celera 20 4,269,727 - 4,272,424 (+) RGD
Sequence:
ATGAAACACCTCTTGCTGCTCACCTTGTCTGCTGTGCTCTGCTGCTGGGTCTCAGCTGACACTCGATGTCACTCCTGCTACAAGGTGCCTGTGCTGGGCTGTGTGGATCGACAGTCCTGCCGCCTGGA
hide sequence
RefSeq Acc Id:
NP_001001969 ⟸ NM_001001969
- Peptide Label:
precursor
- UniProtKB:
D3ZX79 (UniProtKB/TrEMBL), A0A8I6AS77 (UniProtKB/TrEMBL), A6KTS4 (UniProtKB/TrEMBL)
- Sequence:
MKHLLLLTLSAVLCCWVSADTRCHSCYKVPVLGCVDRQSCRLEPGHKCLTTNVYLGKMWVFSNLRCGTPEEPCREVFNETNHKLGLSYNTTCCDKDNCNSPAPRPTPTLALISLTSLAGLGLWLLH
hide sequence
Ensembl Acc Id:
ENSRNOP00000001119 ⟸ ENSRNOT00000001119
Ensembl Acc Id:
ENSRNOP00000097186 ⟸ ENSRNOT00000116480
RGD ID: 13701388 Promoter ID: EPDNEW_R11912 Type: single initiation site Name: Ly6g6c_1 Description: lymphocyte antigen 6 family member G6C SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 5,057,636 - 5,057,696 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-02-01
Ly6g6c
lymphocyte antigen 6 family member G6C
Ly6g6c
lymphocyte antigen 6 complex, locus G6C
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Ly6g6c
lymphocyte antigen 6 complex, locus G6C
Symbol and Name status set to approved
1299863 APPROVED
2005-02-14
Ly6g6c
lymphocyte antigen 6 complex, locus G6C
Symbol and Name status set to provisional
70820 PROVISIONAL
