Advanced Search (OLGA)

Gene: Ly6g6c (lymphocyte antigen 6 family member G6C) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Ly6g6c

Name:

lymphocyte antigen 6 family member G6C

RGD ID:

1617542

MGI Page

MGI

Description:

Enables identical protein binding activity. Acts upstream of or within response to bacterium. Part of protein-containing complex. Colocalizes with external side of plasma membrane. Is expressed in several structures, including brain; liver; lung; metanephros; and spleen. Orthologous to human LY6G6C (lymphocyte antigen 6 family member G6C).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1110003M04Rik; AU016360; G6c; lymphocyte antigen 6 complex G6C; lymphocyte antigen 6 complex locus protein G6c; lymphocyte antigen 6 complex, locus G6C; MGC144235; MGC144236; NG2; NG24

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	35,286,301 - 35,289,024 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	35,284,364 - 35,289,026 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	35,067,325 - 35,070,048 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	35,065,388 - 35,070,050 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	35,204,270 - 35,206,993 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	34,675,381 - 34,678,104 (+)	NCBI		MGSCv36	mm8
Celera	17	38,164,006 - 38,166,732 (+)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	18.59	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ly6g6c	Mouse	proteasome-associated autoinflammatory syndrome 1		ISO	LY6G6C (Homo sapiens)	8554872	ClinVar Annotator: match by term: Proteasome-associated autoinflammatory syndrome 1	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ly6g6c	Mouse	1,2-dimethylhydrazine	multiple interactions	EXP		6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of LY6G6C mRNA	CTD	PMID:22206623
Ly6g6c	Mouse	1-naphthyl isothiocyanate	increases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	1-Naphthylisothiocyanate results in increased expression of LY6G6C mRNA	CTD	PMID:30723492
Ly6g6c	Mouse	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of LY6G6C mRNA	CTD	PMID:17942748
Ly6g6c	Mouse	17alpha-ethynylestradiol	multiple interactions	EXP		6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LY6G6C mRNA	CTD	PMID:17942748
Ly6g6c	Mouse	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	EXP		6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LY6G6C mRNA	CTD	PMID:17942748
Ly6g6c	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of LY6G6C mRNA	CTD	PMID:32109520
Ly6g6c	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of LY6G6C mRNA	CTD	PMID:17035482
Ly6g6c	Mouse	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	2 more ...	CTD	PMID:32109520
Ly6g6c	Mouse	3,4-methylenedioxymethamphetamine	decreases expression	EXP		6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of LY6G6C mRNA	CTD	PMID:20188158
Ly6g6c	Mouse	3-chloropropane-1,2-diol	increases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	alpha-Chlorohydrin results in increased expression of LY6G6C mRNA	CTD	PMID:20409345
Ly6g6c	Mouse	4,4'-sulfonyldiphenol	affects methylation	EXP		6480464	bisphenol S affects the methylation of LY6G6C gene	CTD	PMID:31683443
Ly6g6c	Mouse	4-hydroxyphenyl retinamide	decreases expression	EXP		6480464	Fenretinide results in decreased expression of LY6G6C mRNA	CTD	PMID:28973697
Ly6g6c	Mouse	5-fluorouracil	affects response to substance	ISO	LY6G6C (Homo sapiens)	6480464	LY6G6C protein affects the susceptibility to Fluorouracil	CTD	PMID:16217747
Ly6g6c	Mouse	6-propyl-2-thiouracil	increases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	Propylthiouracil results in increased expression of LY6G6C mRNA	CTD	PMID:24780913
Ly6g6c	Mouse	acrylamide	increases expression	ISO	LY6G6C (Homo sapiens)	6480464	Acrylamide results in increased expression of LY6G6C mRNA	CTD	PMID:32763439
Ly6g6c	Mouse	amphetamine	increases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	Amphetamine results in increased expression of LY6G6C mRNA	CTD	PMID:30779732
Ly6g6c	Mouse	aristolochic acid A	increases expression	ISO	LY6G6C (Homo sapiens)	6480464	aristolochic acid I results in increased expression of LY6G6C mRNA	CTD	PMID:33212167
Ly6g6c	Mouse	arsane	multiple interactions	ISO	LY6G6C (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of LY6G6C mRNA	CTD	PMID:32525701
Ly6g6c	Mouse	arsenic atom	multiple interactions	ISO	LY6G6C (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of LY6G6C mRNA	CTD	PMID:32525701
Ly6g6c	Mouse	bisphenol A	decreases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of LY6G6C mRNA	CTD	PMID:25181051
Ly6g6c	Mouse	bisphenol A	decreases methylation	ISO	LY6G6C (Homo sapiens)	6480464	bisphenol A results in decreased methylation of LY6G6C gene	CTD	PMID:31601247
Ly6g6c	Mouse	cadmium atom	decreases expression	ISO	LY6G6C (Homo sapiens)	6480464	Cadmium results in decreased expression of LY6G6C mRNA	CTD	PMID:24376830
Ly6g6c	Mouse	cadmium dichloride	decreases methylation	ISO	Ly6g6c (Rattus norvegicus)	6480464	Cadmium Chloride results in decreased methylation of LY6G6C promoter	CTD	PMID:22457795
Ly6g6c	Mouse	carbon nanotube	affects expression	EXP		6480464	Nanotubes more ...	CTD	PMID:25554681
Ly6g6c	Mouse	CGP 52608	multiple interactions	ISO	LY6G6C (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to LY6G6C gene]	CTD	PMID:28238834
Ly6g6c	Mouse	chromium(6+)	affects expression	EXP		6480464	chromium hexavalent ion affects the expression of LY6G6C mRNA	CTD	PMID:28472532
Ly6g6c	Mouse	cisplatin	multiple interactions	ISO	LY6G6C (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of LY6G6C mRNA	CTD	PMID:27392435
Ly6g6c	Mouse	cisplatin	decreases expression	ISO	LY6G6C (Homo sapiens)	6480464	Cisplatin results in decreased expression of LY6G6C mRNA	CTD	PMID:27392435
Ly6g6c	Mouse	copper atom	increases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	Copper deficiency results in increased expression of LY6G6C mRNA	CTD	PMID:26033743
Ly6g6c	Mouse	copper(0)	increases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	Copper deficiency results in increased expression of LY6G6C mRNA	CTD	PMID:26033743
Ly6g6c	Mouse	crocidolite asbestos	increases expression	ISO	LY6G6C (Homo sapiens)	6480464	Asbestos and Crocidolite results in increased expression of LY6G6C mRNA	CTD	PMID:25351596
Ly6g6c	Mouse	dimethylarsinic acid	multiple interactions	EXP		6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of LY6G6C mRNA	CTD	PMID:34876320
Ly6g6c	Mouse	disodium selenite	increases expression	ISO	LY6G6C (Homo sapiens)	6480464	Sodium Selenite results in increased expression of LY6G6C mRNA	CTD	PMID:18175754
Ly6g6c	Mouse	endosulfan	increases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	Endosulfan results in increased expression of LY6G6C mRNA	CTD	PMID:29391264
Ly6g6c	Mouse	folic acid	decreases expression	EXP		6480464	Folic Acid results in decreased expression of LY6G6C mRNA	CTD	PMID:25629700
Ly6g6c	Mouse	folic acid	multiple interactions	EXP		6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of LY6G6C mRNA	CTD	PMID:22206623
Ly6g6c	Mouse	gentamycin	increases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	Gentamicins results in increased expression of LY6G6C mRNA	CTD	PMID:33387578
Ly6g6c	Mouse	graphite	affects expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	Graphite affects the expression of LY6G6C mRNA	CTD	PMID:29933104
Ly6g6c	Mouse	lead diacetate	increases expression	EXP		6480464	lead acetate results in increased expression of LY6G6C mRNA	CTD	PMID:21829687
Ly6g6c	Mouse	Licochalcone B	increases expression	ISO	LY6G6C (Homo sapiens)	6480464	licochalcone B results in increased expression of LY6G6C mRNA	CTD	PMID:33647349
Ly6g6c	Mouse	methylarsonic acid	multiple interactions	EXP		6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of LY6G6C mRNA	CTD	PMID:34876320
Ly6g6c	Mouse	methylisothiazolinone	increases expression	ISO	LY6G6C (Homo sapiens)	6480464	2-methyl-4-isothiazolin-3-one results in increased expression of LY6G6C mRNA	CTD	PMID:31629900
Ly6g6c	Mouse	ochratoxin A	increases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	ochratoxin A results in increased expression of LY6G6C mRNA	CTD	PMID:30449730
Ly6g6c	Mouse	oxaliplatin	multiple interactions	ISO	Ly6g6c (Rattus norvegicus)	6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of LY6G6C mRNA	CTD	PMID:25729387
Ly6g6c	Mouse	ozone	multiple interactions	EXP		6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of LY6G6C mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of LY6G6C mRNA	CTD	PMID:34911549
Ly6g6c	Mouse	ozone	increases expression	EXP		6480464	Ozone results in increased expression of LY6G6C mRNA	CTD	PMID:33026818
Ly6g6c	Mouse	paracetamol	decreases expression	ISO	LY6G6C (Homo sapiens)	6480464	Acetaminophen results in decreased expression of LY6G6C mRNA	CTD	PMID:22230336
Ly6g6c	Mouse	perfluorohexanesulfonic acid	decreases expression	EXP		6480464	perfluorohexanesulfonic acid results in decreased expression of LY6G6C mRNA	CTD	PMID:37995155
Ly6g6c	Mouse	resveratrol	multiple interactions	ISO	LY6G6C (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of LY6G6C mRNA	CTD	PMID:23557933
Ly6g6c	Mouse	silver atom	increases expression	EXP		6480464	Silver results in increased expression of LY6G6C mRNA	CTD	PMID:27131904
Ly6g6c	Mouse	silver(0)	increases expression	EXP		6480464	Silver results in increased expression of LY6G6C mRNA	CTD	PMID:27131904
Ly6g6c	Mouse	sodium arsenate	multiple interactions	ISO	LY6G6C (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of LY6G6C mRNA	CTD	PMID:32525701
Ly6g6c	Mouse	sodium arsenate	multiple interactions	EXP		6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of LY6G6C mRNA	CTD	PMID:34876320
Ly6g6c	Mouse	sodium arsenite	decreases expression	ISO	LY6G6C (Homo sapiens)	6480464	sodium arsenite results in decreased expression of LY6G6C mRNA	CTD	PMID:21457566
Ly6g6c	Mouse	sodium arsenite	multiple interactions	EXP		6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of LY6G6C mRNA	CTD	PMID:34876320
Ly6g6c	Mouse	topotecan	multiple interactions	ISO	Ly6g6c (Rattus norvegicus)	6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of LY6G6C mRNA	CTD	PMID:25729387
Ly6g6c	Mouse	trichloroethene	decreases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	Trichloroethylene results in decreased expression of LY6G6C mRNA	CTD	PMID:33387578
Ly6g6c	Mouse	vinclozolin	decreases expression	ISO	Ly6g6c (Rattus norvegicus)	6480464	vinclozolin results in decreased expression of LY6G6C mRNA	CTD	PMID:23869203

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ly6g6c	Mouse	response to bacterium	acts_upstream_of_or_within	IEP		2290270	PMID:23012479	MGI	PMID:23012479

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ly6g6c	Mouse	external side of plasma membrane	located_in	IBA	PANTHER:PTN001282106 more ...	2290270		GO_Central	GO_REF:0000033
Ly6g6c	Mouse	external side of plasma membrane	located_in	ISO	UniProtKB:O95867	2290270		GO_Central	GO_REF:0000119
Ly6g6c	Mouse	external side of plasma membrane	located_in	IDA		2290270	PMID:17008713	UniProt	PMID:17008713
Ly6g6c	Mouse	protein-containing complex	part_of	IDA		2290270	PMID:17008713	UniProt	PMID:17008713
Ly6g6c	Mouse	protein-containing complex	part_of	ISO	UniProtKB:O95867	2290270		GO_Central	GO_REF:0000119
Ly6g6c	Mouse	protein-containing complex	part_of	IBA	PANTHER:PTN001282106 more ...	2290270		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ly6g6c	Mouse	identical protein binding	enables	ISO	UniProtKB:O95867	2290270		GO_Central	GO_REF:0000119
Ly6g6c	Mouse	identical protein binding	enables	IDA		2290270	PMID:17008713	UniProt	PMID:17008713
Ly6g6c	Mouse	protein binding	enables	ISO	UniProtKB:Q8WVX3-2 more ...	9068941	PMID:32296183	IntAct	PMID:32296183

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10349636	PMID:10725249	PMID:10871872	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12079290	PMID:12466851	PMID:12477932	PMID:14610273	PMID:16141072	PMID:16141073
PMID:16170054	PMID:16705022	PMID:17008713	PMID:21873635	PMID:23012479	PMID:27098205

Ly6g6c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	35,286,301 - 35,289,024 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	35,284,364 - 35,289,026 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	35,067,325 - 35,070,048 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	35,065,388 - 35,070,050 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	35,204,270 - 35,206,993 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	34,675,381 - 34,678,104 (+)	NCBI		MGSCv36	mm8
Celera	17	38,164,006 - 38,166,732 (+)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	18.59	NCBI

LY6G6C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	31,718,648 - 31,721,746 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	31,718,648 - 31,721,746 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	31,686,425 - 31,689,523 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	31,794,404 - 31,797,489 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	31,794,403 - 31,797,489	NCBI
Celera	6	33,284,651 - 33,287,736 (-)	NCBI		Celera
Cytogenetic Map	6	p21.33	NCBI
HuRef	6	31,472,653 - 31,475,739 (-)	NCBI		HuRef
CHM1_1	6	31,688,542 - 31,691,628 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	31,571,681 - 31,575,898 (-)	NCBI		T2T-CHM13v2.0

Ly6g6c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	3,758,290 - 3,760,987 (-)	NCBI		GRCr8
mRatBN7.2	20	3,753,632 - 3,757,205 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,753,632 - 3,758,867 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,453,106 - 4,455,802 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,815,160 - 3,817,856 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,353,045 - 4,355,741 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,056,851 - 5,060,398 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,057,701 - 5,059,933 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	7,130,631 - 7,133,328 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	3,817,976 - 3,820,673 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	3,818,202 - 3,820,900 (-)	NCBI
Celera	20	4,269,727 - 4,272,424 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

Ly6g6c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955437	257,942 - 261,054 (-)	NCBI	ChiLan1.0	ChiLan1.0

LY6G6C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	46,195,925 - 46,199,038 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	42,157,381 - 42,160,527 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	31,380,026 - 31,383,190 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	32,268,752 - 32,271,926 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	32,268,752 - 32,271,809 (-)	Ensembl	panpan1.1		panPan2

LY6G6C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	1,197,828 - 1,201,660 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	1,198,301 - 1,201,102 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	1,334,395 - 1,338,249 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	1,343,212 - 1,347,065 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	1,343,199 - 1,346,484 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	1,202,508 - 1,206,353 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	1,269,715 - 1,273,576 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	1,337,345 - 1,341,201 (-)	NCBI		UU_Cfam_GSD_1.0

Ly6g6c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	35,746,096 - 35,749,845 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936727	1,810,340 - 1,815,251 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936727	1,812,328 - 1,815,242 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LY6G6C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	23,829,791 - 23,833,196 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	23,829,790 - 23,833,610 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

LY6G6C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	40,300,918 - 40,304,891 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	40,301,880 - 40,304,464 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	31,631,084 - 31,634,985 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ly6g6c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	24,490,422 - 24,493,555 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	24,490,361 - 24,493,619 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Predicted Target Of

	Summary Value
Count of predictions:	1450
Count of miRNA genes:	603
Interacting mature miRNAs:	703
Transcripts:	ENSMUST00000173207, ENSMUST00000173478, ENSMUST00000174876
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10045977	Tir9_m	trypanosome infection response 9 (mouse)			Not determined		17	27878119	43885114	Mouse
26884379	Skwq5_m	skull length QTL 5, 5 week (mouse)					17	33118974	54107028	Mouse
1300885	Mbis4_m	Mycobacterium bovis-induced systemic lupus erythematosus 4 (mouse)			Not determined		17	35175817	70165926	Mouse
1300890	Bhr3_m	bronchial hyperresponsiveness 3 (mouse)			Not determined		17	3974890	48866091	Mouse
11075105	Modc1_m	modifier of Odc1 (mouse)					17	27715792	45622654	Mouse
1300995	Fembrs4_m	femur breaking strength 4 (mouse)			Not determined		17	15061652	49061760	Mouse
15039348	Nmrs37_m	NAFLD-associated magnetic resonance shift 37 (mouse)					17	27815209	61815209	Mouse
4141357	Mrdq1_m	modifier of retinal degeneration QTL 1 (mouse)			Not determined			30987903	48039703	Mouse
1302152	Skull25_m	skull morphology 25 (mouse)			Not determined		17	16819721	50819843	Mouse
1302028	Asbb3_m	autoimmune susceptibility in C57BL/6J and BALB/c 3 (mouse)			Not determined		17	10878119	44878219	Mouse
15039354	Nmrs36_m	NAFLD-associated magnetic resonance shift 36 (mouse)					17	19145025	53145025	Mouse
4141215	Mnic1_m	macronutrient intake, carbohydrate 1 (mouse)			Not determined			4854752	45670266	Mouse
1300787	Cd8mts5_m	CD8 memory T cell subset 5 (mouse)			Not determined		17	8584914	42585149	Mouse
13524847	Asrq8a_m	acoustic startle response 8a (mouse)					17	12646961	46646961	Mouse
1300914	Pcir4_m	periosteal circumference 4 (mouse)			Not determined		17	15061652	49061760	Mouse
13452396	Leusq3_m	leucocytosis susceptibility QTL 3 (mouse)					17	17462208	51462345	Mouse
13452399	Leusq6_m	leucocytosis susceptibility QTL 6 (mouse)					17	17462208	51462345	Mouse
1300535	Char3_m	P. chabaudi malaria resistance QTL 3 (mouse)			Not determined		17	17462208	51462345	Mouse
4140955	Plgr1_m	plague resistance locus 1 (mouse)			Not determined			31033500	65033630	Mouse
1302070	Tbbmd7_m	total body bone mineral density 7 (mouse)			Not determined		17	15061652	49061760	Mouse
10412214	Sxbq3_m	SGC/Knj cross B6 QTL 3 (mouse)			Not determined		17	17462208	51462345	Mouse
10412083	Sm2_m	susceptibility to Schistosoma mansoni infection 2 (mouse)			Not determined		17	17029943	51030078	Mouse
10412204	Bbaa29_m	B.burgdorferi-associated arthritis 29 (mouse)			Not determined		17	26051185	60051352	Mouse
10043949	Pbft7_m	percent body fat 7 (mouse)			Not determined		17	6893936	40893936	Mouse
4141067	Hbnr2_m	Heligmosomoides bakeri nematode resistance 2 (mouse)			Not determined			11885971	45886119	Mouse
12904946	Tammq8_m	tibialis anterior muscle mass QTL 8 (mouse)					17	12451787	46451787	Mouse
10412198	Sst5_m	susceptibility to tuberculosis 5 (mouse)			Not determined		17	25076583	55712970	Mouse
4142342	Lfnq4_m	lung function QTL 4 (mouse)			Not determined			11206484	39364059	Mouse
10412196	Bbaa28_m	B.burgdorferi-associated arthritis 28 (mouse)			Not determined		17	25584914	43976235	Mouse
1301935	Skull24_m	skull morphology 24 (mouse)			Not determined		17	8584914	42585149	Mouse
1302189	Dps3_m	delta power in slow-wave sleep 3 (mouse)			Not determined		17	33819721	36250180	Mouse
1301331	Lbw1_m	lupus NZB x NZW 1 (mouse)			Not determined		17	18418357	52420983	Mouse
1301840	Ssial4_m	susceptibility to sialadenitiss 4 (mouse)			Not determined		17	18175412	52178214	Mouse
1300692	Blmpf1_m	bleomycin-induced pulmonary fibrosis 1 (mouse)			Not determined		17	32061652	37644775	Mouse
1357789	Kdnw3_m	kidney weight 3 (mouse)			Not determined		17	4854752	47885665	Mouse
1301338	Lmr1_m	leishmaniasis resistance 1 (mouse)			Not determined		17	10081340	86996400	Mouse
1300703	Uvbi2_m	UVB induced immunosuppression 2 (mouse)			Not determined		17	28622406	62622654	Mouse
1301056	Pas2_m	pulmonary adenoma susceptibility 2 (mouse)			Not determined		17	18422141	52424327	Mouse
1301454	Eae5_m	susceptibility to experimental allergic encephalomyelitis 5 (mouse)			Not determined		17	24612750	58612864	Mouse
14747010	Mancz14_m	mandible centroid size 14 (mouse)					17	11998184	45998184	Mouse
1302005	Loco2_m	locomotor activity 2 (mouse)			Not determined		17	26884972	60885114	Mouse
4141272	Tfv1_m	total food volume 1 (mouse)			Not determined			4854752	65637357	Mouse
1300602	Eye2_m	eye weight 2 (mouse)			Not determined		17	26505337	41105037	Mouse
25394538	Skmw84_m	skeletal muscle weight 84, TA (mouse)					17	32660426	35520036	Mouse
10412276	Leci2_m	leukocyte endothelial cell interactions 2 (mouse)			Not determined		17	3348175	37348299	Mouse
1302140	Wta4_m	weight adult 4 (mouse)			Not determined		17	16819721	50819843	Mouse
1300706	Alan1_m	alloantigen response 1 (mouse)			Not determined		17	4854752	46469702	Mouse
1558886	Lgth9_m	body length 9 (mouse)			Not determined		17	15061652	49061760	Mouse
1558758	Kcal2_m	kilocalorie 2 (mouse)			Not determined		17	26401012	52911704	Mouse
4142150	Stheal11_m	soft tissue heal 11 (mouse)			Not determined		17	12286211	83361768	Mouse
11081168	Tir7_m	trypanosome infection response 7 (mouse)					17	14123372	48123496	Mouse
1300589	Myaa2_m	modifier of Yaa 2 (mouse)			Not determined		17	30132555	64132666	Mouse

AU016360

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	17	35,069,715 - 35,069,830	UniSTS	GRCm38
MGSCv37	17	35,206,660 - 35,206,775	UniSTS	GRCm37
Celera	17	38,166,399 - 38,166,514	UniSTS
Cytogenetic Map	17	B1	UniSTS
Whitehead/MRC_RH	17	475.84	UniSTS

Ly6g6c

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
cM Map	17		UniSTS

Ly6g6c

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	17	B1	UniSTS

Ly6g6c

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	17	B1	UniSTS
cM Map	17		UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_023463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA061950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC087117	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF109905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ315546	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ315547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK003375	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC116365	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC116366	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466666	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CU406961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CU463845	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000173207 ⟹ ENSMUSP00000134194

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	17	35,284,364 - 35,288,601 (+)	Ensembl
GRCm38.p6 Ensembl	17	35,065,388 - 35,069,625 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000173478 ⟹ ENSMUSP00000133510

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	17	35,286,301 - 35,289,026 (+)	Ensembl
GRCm38.p6 Ensembl	17	35,067,325 - 35,070,050 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000174876 ⟹ ENSMUSP00000133838

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	17	35,286,366 - 35,288,510 (+)	Ensembl
GRCm38.p6 Ensembl	17	35,067,390 - 35,069,534 (+)	Ensembl

RefSeq Acc Id:

NM_023463 ⟹ NP_075952

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	17	35,286,301 - 35,289,024 (+)	NCBI
GRCm38	17	35,067,325 - 35,070,048 (+)	ENTREZGENE
MGSCv37	17	35,204,270 - 35,206,993 (+)	RGD
Celera	17	38,164,006 - 38,166,732 (+)	RGD
cM Map	17		ENTREZGENE

Sequence:

show sequence

AGAGCTGGAGACCTGGGAATCTGCTGTCAACTGCTGGGGCTGTGGACATTCTCAGGACCCTCACCATGAAACACCTCCTGTTGCTCACCCTGTCTGCCCTACTCTACTGCTGGGTCTCAGCTGATACT
CGATGTCACTCCTGCTACAAAGTCCCTGTGCTGGGCTGTGTGGATCGCCAGTCCTGCCGCCTGGAGCCGGGCCACAAATGCCTGACAACAAACGTGTACCTTGGGAAGATGTGGGTTTTCTCTAACCT
GCGCTGCGGCACACCAGAAGAGCCTTGTCGGGAGGTCTTCAACGAAACCAACCATAAGCTGGGCCTGAACTACAACACCACCTGCTGTGACAAGGATAACTGTAACAGCCCGGCTCCACGGCCCACAC
CCGCACTGGCCCTCATCTCCCTCACCTCCTTGGCTGGCCTCGGCCTCTGGTTATTGCATTGAGACTAGCTCCATGGCTACAATCTTACCACCTGCTATAGCCTGAGCCTTTCTCCCTGTGTCCTCAGA
GCTCCAGCTTTCCAGAATCTTCTCTCCTCCCACCCCCTTCTTCTGAAGATCATGTCCCTAGTCCTATACCATTTATTTCATGGGACTGTACCTGGAGTGGCCTTTCTAGCCACCGCTCCTCTCCCTCA
CTTGTCACCTTCCACTCCATTCCACCCACACACAGACACACAGACACACAGACACAAAGACACACACACACACACACACACACACACACACCCAGTCCTTTCCCATTTCCTTCTAGAACACTCTACCT
CCTCCACTGGCCACTGAAAGGCTCCCCTCCTTGGACGCACACTGCTGTGCCTCTGGGATCTAAGTCTGGAAGAACTCCTGTCTTGTCTCCAGGGAGTGATTCCAAAAGGCGCTGGCCTCATTGCATGG
GCCTGGCTTACCAGACCCTCTGCTTGTCCCCTTCTATCTTGAGAAATAAACATCAGTGTCTAAT

hide sequence


Protein RefSeqs	NP_075952	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC84157	(Get FASTA)	NCBI Sequence Viewer
	AAI16366	(Get FASTA)	NCBI Sequence Viewer
	AAI16367	(Get FASTA)	NCBI Sequence Viewer
	BAB22748	(Get FASTA)	NCBI Sequence Viewer
	CAC85544	(Get FASTA)	NCBI Sequence Viewer
	EDL26673	(Get FASTA)	NCBI Sequence Viewer
	EDL26674	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000133510
	ENSMUSP00000133510.2
GenBank Protein	Q9Z1Q4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_075952 ⟸ NM_023463
- Peptide Label:	precursor
- UniProtKB:	Q9Z1Q4 (UniProtKB/Swiss-Prot), Q545T2 (UniProtKB/TrEMBL), G3UYS0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKHLLLLTLSALLYCWVSADTRCHSCYKVPVLGCVDRQSCRLEPGHKCLTTNVYLGKMWVFSNLRCGTPEEPCREVFNETNHKLGLNYNTTCCDKDNCNSPAPRPTPALALISLTSLAGLGLWLLH hide sequence

Ensembl Acc Id:

ENSMUSP00000133838 ⟸ ENSMUST00000174876

Ensembl Acc Id:

ENSMUSP00000134194 ⟸ ENSMUST00000173207

Ensembl Acc Id:

ENSMUSP00000133510 ⟸ ENSMUST00000173478

Protein Domains

UPAR/Ly6

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9Z1Q4-F1-model_v2	AlphaFold	Q9Z1Q4	1-126	view protein structure

RGD ID:

13675798

Promoter ID:

EPDNEW_M22048

Type:

multiple initiation site

Name:

Ly6g6c_1

Description:

Mus musculus lymphocyte antigen 6 complex, locus G6C , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	17	35,067,325 - 35,067,385	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000092586	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000173478	ENTREZGENE
	ENSMUST00000173478.2	UniProtKB/Swiss-Prot
InterPro	LY6G6C	UniProtKB/Swiss-Prot
	Snake_toxin-like_sf	UniProtKB/Swiss-Prot
KEGG Report	mmu:68468	UniProtKB/Swiss-Prot
MGD	MGI:2148930	ENTREZGENE
NCBI Gene	68468	ENTREZGENE
PANTHER	LYMPHOCYTE ANTIGEN 6 COMPLEX LOCUS PROTEIN G6C	UniProtKB/Swiss-Prot
	PTHR32149	UniProtKB/Swiss-Prot
PhenoGen	Ly6g6c	PhenoGen
Superfamily-SCOP	SSF57302	UniProtKB/Swiss-Prot
UniProt	G3UXV4_MOUSE	UniProtKB/TrEMBL
	G3UYS0	ENTREZGENE, UniProtKB/TrEMBL
	LY66C_MOUSE	UniProtKB/Swiss-Prot
	Q545T2	ENTREZGENE, UniProtKB/TrEMBL
	Q9Z1Q4	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-06-06	Ly6g6c	lymphocyte antigen 6 family member G6C	Ly6g6c	lymphocyte antigen 6 complex, locus G6C	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar