Symbol:
Lmo7
Name:
LIM domain 7
RGD ID:
1302984
Description:
Enables actinin binding activity. Involved in positive regulation of transcription by RNA polymerase II. Located in adherens junction and apical plasma membrane. Orthologous to human LMO7 (LIM domain 7); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LIM domain only 7; LIM domain only protein 7; TGF-beta induced protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LMO7 (LIM domain 7) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Lmo7 (LIM domain only 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lmo7 (LIM domain 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LMO7 (LIM domain 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LMO7 (LIM domain 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lmo7 (LIM domain 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LMO7 (LIM domain 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LMO7 (LIM domain 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lmo7 (LIM domain 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
LMO7 (LIM domain 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Lmo7 (LIM domain only 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
lmo7a (LIM domain 7a)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
lim-8
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):
lmo7
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 84,981,689 - 85,184,554 (+) NCBI GRCr8 mRatBN7.2 15 78,566,999 - 78,769,833 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 78,567,023 - 78,769,783 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 82,584,378 - 82,786,313 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 83,660,934 - 83,862,788 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 80,581,526 - 80,790,426 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 86,242,911 - 86,458,512 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 86,243,148 - 86,457,739 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 87,780,294 - 87,997,103 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 85,710,975 - 85,928,469 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 85,726,754 - 85,944,249 (+) NCBI Celera 15 77,758,335 - 77,960,326 (+) NCBI Celera Cytogenetic Map 15 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lmo7 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of LMO7 mRNA] CTD PMID:31150632 Lmo7 Rat (S)-nicotine decreases expression ISO Lmo7 (Mus musculus) 6480464 Nicotine results in decreased expression of LMO7 mRNA CTD PMID:21955143 Lmo7 Rat 1,2-dichloroethane decreases expression ISO Lmo7 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of LMO7 mRNA CTD PMID:28960355 Lmo7 Rat 1,2-dimethylhydrazine multiple interactions ISO Lmo7 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of LMO7 mRNA CTD PMID:22206623 Lmo7 Rat 1,2-dimethylhydrazine decreases expression ISO Lmo7 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of LMO7 mRNA CTD PMID:22206623 Lmo7 Rat 17beta-estradiol multiple interactions ISO LMO7 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of LMO7 mRNA and EGF protein inhibits the reaction [Estradiol results in decreased expression of LMO7 mRNA] CTD PMID:24758408 and PMID:30165855 Lmo7 Rat 17beta-estradiol decreases expression ISO Lmo7 (Mus musculus) 6480464 Estradiol results in decreased expression of LMO7 mRNA CTD PMID:39298647 Lmo7 Rat 17beta-estradiol decreases expression ISO LMO7 (Homo sapiens) 6480464 Estradiol results in decreased expression of LMO7 mRNA CTD PMID:24758408 Lmo7 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Lmo7 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Lmo7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO LMO7 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of LMO7 mRNA] CTD PMID:11007951 Lmo7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Lmo7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of LMO7 mRNA CTD PMID:18343893 and PMID:26377647 Lmo7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of LMO7 mRNA CTD PMID:23238561 Lmo7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Lmo7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of LMO7 mRNA CTD PMID:18796159 more ... Lmo7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO LMO7 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of LMO7 mRNA CTD PMID:11007951 more ... Lmo7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO LMO7 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of LMO7 mRNA CTD PMID:22298810 Lmo7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Lmo7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of LMO7 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to LMO7 gene] CTD PMID:16214954 and PMID:21762485 Lmo7 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Lmo7 (Mus musculus) 6480464 2 more ... CTD PMID:18343893 Lmo7 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Lmo7 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Lmo7 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of LMO7 mRNA CTD PMID:21346803 Lmo7 Rat 2,6-dimethoxyphenol multiple interactions ISO LMO7 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Lmo7 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of LMO7 mRNA CTD PMID:21346803 Lmo7 Rat 2-hydroxypropanoic acid decreases expression ISO LMO7 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of LMO7 mRNA CTD PMID:30851411 Lmo7 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Lmo7 Rat 4,4'-diaminodiphenylmethane affects expression ISO Lmo7 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of LMO7 mRNA CTD PMID:18648102 Lmo7 Rat 4,4'-sulfonyldiphenol increases expression ISO Lmo7 (Mus musculus) 6480464 bisphenol S results in increased expression of LMO7 mRNA CTD PMID:30951980 Lmo7 Rat 4,4'-sulfonyldiphenol affects methylation ISO Lmo7 (Mus musculus) 6480464 bisphenol S affects the methylation of LMO7 gene CTD PMID:31683443 Lmo7 Rat 4,4'-sulfonyldiphenol affects expression ISO LMO7 (Homo sapiens) 6480464 bisphenol S affects the expression of LMO7 protein CTD PMID:31945527 Lmo7 Rat 4,4'-sulfonyldiphenol multiple interactions ISO LMO7 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of LMO7 gene CTD PMID:31601247 Lmo7 Rat 4,4'-sulfonyldiphenol decreases expression ISO Lmo7 (Mus musculus) 6480464 bisphenol S results in decreased expression of LMO7 mRNA CTD PMID:33297965 and PMID:39298647 Lmo7 Rat 4-hydroxyphenyl retinamide increases expression ISO Lmo7 (Mus musculus) 6480464 Fenretinide results in increased expression of LMO7 mRNA CTD PMID:28973697 Lmo7 Rat acetylsalicylic acid increases expression ISO LMO7 (Homo sapiens) 6480464 Aspirin results in increased expression of LMO7 mRNA CTD PMID:15456535 Lmo7 Rat acrolein multiple interactions ISO LMO7 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of LMO7 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of LMO7 mRNA CTD PMID:32699268 Lmo7 Rat actinomycin D multiple interactions ISO LMO7 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of and results in increased secretion of LMO7 protein CTD PMID:38460933 Lmo7 Rat aflatoxin B1 increases expression ISO Lmo7 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of LMO7 mRNA CTD PMID:19770486 Lmo7 Rat aflatoxin B1 decreases methylation ISO LMO7 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of LMO7 gene CTD PMID:27153756 Lmo7 Rat Aflatoxin B2 alpha decreases methylation ISO LMO7 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of LMO7 promoter CTD PMID:30157460 Lmo7 Rat all-trans-retinoic acid decreases expression ISO LMO7 (Homo sapiens) 6480464 Tretinoin results in decreased expression of LMO7 mRNA CTD PMID:23724009 Lmo7 Rat all-trans-retinoic acid multiple interactions ISO Lmo7 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of LMO7 mRNA CTD PMID:30951980 Lmo7 Rat alpha-pinene multiple interactions ISO LMO7 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of LMO7 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of LMO7 mRNA CTD PMID:32699268 Lmo7 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of LMO7 mRNA CTD PMID:30779732 Lmo7 Rat aristolochic acid A decreases expression ISO LMO7 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of LMO7 mRNA CTD PMID:33212167 Lmo7 Rat arsane multiple interactions ISO LMO7 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of LMO7 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of LMO7 mRNA CTD PMID:32525701 and PMID:39836092 Lmo7 Rat arsenic atom multiple interactions ISO LMO7 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of LMO7 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of LMO7 mRNA CTD PMID:32525701 and PMID:39836092 Lmo7 Rat arsenite(3-) multiple interactions ISO LMO7 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to LMO7 mRNA] CTD PMID:32406909 Lmo7 Rat benzo[a]pyrene increases expression ISO Lmo7 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of LMO7 mRNA CTD PMID:19770486 Lmo7 Rat benzo[a]pyrene affects methylation ISO LMO7 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of LMO7 5' UTR CTD PMID:27901495 Lmo7 Rat benzo[a]pyrene decreases methylation ISO LMO7 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of LMO7 exon CTD PMID:27901495 Lmo7 Rat benzo[a]pyrene diol epoxide I decreases expression ISO LMO7 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Lmo7 Rat Benzo[k]fluoranthene increases expression ISO Lmo7 (Mus musculus) 6480464 benzo(k)fluoranthene results in increased expression of LMO7 mRNA CTD PMID:26377693 Lmo7 Rat beta-lapachone decreases expression ISO LMO7 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of LMO7 mRNA CTD PMID:38218311 Lmo7 Rat beta-lapachone increases expression ISO LMO7 (Homo sapiens) 6480464 beta-lapachone results in increased expression of LMO7 mRNA CTD PMID:38218311 Lmo7 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of LMO7 mRNA CTD PMID:18164116 Lmo7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of LMO7 mRNA CTD PMID:25181051 Lmo7 Rat bisphenol A increases methylation ISO LMO7 (Homo sapiens) 6480464 bisphenol A results in increased methylation of LMO7 gene CTD PMID:31601247 Lmo7 Rat bisphenol A multiple interactions ISO LMO7 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of LMO7 gene CTD PMID:31601247 Lmo7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LMO7 mRNA CTD PMID:32145629 Lmo7 Rat bisphenol A increases expression ISO Lmo7 (Mus musculus) 6480464 bisphenol A results in increased expression of LMO7 mRNA CTD PMID:30951980 and PMID:32156529 Lmo7 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of LMO7 gene CTD PMID:28505145 Lmo7 Rat bisphenol AF increases expression ISO LMO7 (Homo sapiens) 6480464 bisphenol AF results in increased expression of LMO7 protein CTD PMID:34186270 Lmo7 Rat bisphenol F increases expression ISO Lmo7 (Mus musculus) 6480464 bisphenol F results in increased expression of LMO7 mRNA CTD PMID:30951980 Lmo7 Rat bisphenol F multiple interactions ISO Lmo7 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of LMO7 mRNA CTD PMID:30951980 Lmo7 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of LMO7 mRNA CTD PMID:33453195 Lmo7 Rat caffeine affects phosphorylation ISO LMO7 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of LMO7 protein CTD PMID:35688186 Lmo7 Rat calcium silicate decreases expression ISO Lmo7 (Mus musculus) 6480464 calcium silicate results in decreased expression of LMO7 mRNA CTD PMID:29279043 Lmo7 Rat carbon nanotube affects expression ISO Lmo7 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of LMO7 mRNA CTD PMID:25554681 Lmo7 Rat chlordecone increases expression ISO Lmo7 (Mus musculus) 6480464 Chlordecone results in increased expression of LMO7 mRNA CTD PMID:33711761 Lmo7 Rat choline multiple interactions ISO Lmo7 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of LMO7 gene CTD PMID:20938992 Lmo7 Rat chromium(6+) affects expression ISO Lmo7 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of LMO7 mRNA CTD PMID:28472532 Lmo7 Rat cisplatin multiple interactions ISO LMO7 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of LMO7 mRNA CTD PMID:27392435 Lmo7 Rat cisplatin increases expression ISO LMO7 (Homo sapiens) 6480464 Cisplatin results in increased expression of LMO7 mRNA CTD PMID:27392435 Lmo7 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of LMO7 mRNA CTD PMID:17898221 Lmo7 Rat copper(II) sulfate increases expression ISO LMO7 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of LMO7 mRNA CTD PMID:19549813 Lmo7 Rat coumarin affects phosphorylation ISO LMO7 (Homo sapiens) 6480464 coumarin affects the phosphorylation of LMO7 protein CTD PMID:35688186 Lmo7 Rat crocidolite asbestos decreases expression ISO Lmo7 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of LMO7 mRNA CTD PMID:29279043 Lmo7 Rat cycloheximide multiple interactions ISO LMO7 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of LMO7 mRNA] CTD PMID:11007951 Lmo7 Rat cyclosporin A decreases expression ISO LMO7 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of LMO7 mRNA CTD PMID:20106945 and PMID:25562108 Lmo7 Rat dibenzofurans increases expression ISO Lmo7 (Mus musculus) 6480464 Dibenzofurans results in increased expression of LMO7 mRNA CTD PMID:34254344 Lmo7 Rat Dibutyl phosphate affects expression ISO LMO7 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of LMO7 mRNA CTD PMID:37042841 Lmo7 Rat diethyl maleate decreases expression EXP 6480464 diethyl maleate results in decreased expression of LMO7 mRNA CTD PMID:21161181 Lmo7 Rat dorsomorphin multiple interactions ISO LMO7 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Lmo7 Rat doxorubicin decreases expression ISO LMO7 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of LMO7 mRNA CTD PMID:29803840 Lmo7 Rat entinostat increases expression ISO LMO7 (Homo sapiens) 6480464 entinostat results in increased expression of LMO7 mRNA CTD PMID:26272509 Lmo7 Rat entinostat multiple interactions ISO LMO7 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LMO7 mRNA CTD PMID:27188386 Lmo7 Rat epoxiconazole decreases expression ISO Lmo7 (Mus musculus) 6480464 epoxiconazole results in decreased expression of LMO7 mRNA CTD PMID:35436446 Lmo7 Rat ethanol decreases expression ISO Lmo7 (Mus musculus) 6480464 Ethanol results in decreased expression of LMO7 mRNA CTD PMID:21955143 Lmo7 Rat ethanol affects splicing ISO Lmo7 (Mus musculus) 6480464 Ethanol affects the splicing of LMO7 mRNA CTD PMID:30319688 Lmo7 Rat flurbiprofen increases expression ISO Lmo7 (Mus musculus) 6480464 Flurbiprofen results in increased expression of LMO7 mRNA CTD PMID:16949054 Lmo7 Rat folic acid multiple interactions ISO Lmo7 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Lmo7 Rat FR900359 affects phosphorylation ISO LMO7 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of LMO7 protein CTD PMID:37730182 Lmo7 Rat fulvestrant multiple interactions ISO LMO7 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of LMO7 gene and [bisphenol S co-treated with Fulvestrant] results in increased methylation of LMO7 gene CTD PMID:31601247 Lmo7 Rat furfural multiple interactions ISO LMO7 (Homo sapiens) 6480464 [pyrogallol 1 and 3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization of LMO7 protein CTD PMID:38598786 Lmo7 Rat geldanamycin increases expression ISO LMO7 (Homo sapiens) 6480464 geldanamycin results in increased expression of LMO7 mRNA CTD PMID:26705709 Lmo7 Rat hexadecanoic acid decreases phosphorylation ISO LMO7 (Homo sapiens) 6480464 Palmitic Acid results in decreased phosphorylation of LMO7 protein CTD PMID:28073184 Lmo7 Rat hydrogen peroxide affects expression ISO LMO7 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of LMO7 mRNA CTD PMID:20044591 Lmo7 Rat irinotecan affects expression EXP 6480464 Irinotecan affects the expression of LMO7 mRNA CTD PMID:20097248 Lmo7 Rat ivermectin decreases expression ISO LMO7 (Homo sapiens) 6480464 Ivermectin results in decreased expression of LMO7 protein CTD PMID:32959892 Lmo7 Rat L-methionine multiple interactions ISO Lmo7 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of LMO7 gene CTD PMID:20938992 Lmo7 Rat levofloxacin decreases expression EXP 6480464 Levofloxacin results in decreased expression of LMO7 mRNA CTD PMID:24136188 Lmo7 Rat mercury dibromide increases expression ISO LMO7 (Homo sapiens) 6480464 mercuric bromide results in increased expression of LMO7 mRNA CTD PMID:26272509 Lmo7 Rat mercury dibromide multiple interactions ISO LMO7 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LMO7 mRNA CTD PMID:27188386 Lmo7 Rat methamphetamine increases expression ISO Lmo7 (Mus musculus) 6480464 Methamphetamine results in increased expression of LMO7 mRNA CTD PMID:26307267 Lmo7 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of LMO7 gene CTD PMID:35440735 Lmo7 Rat methylmercury chloride increases expression ISO LMO7 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of LMO7 mRNA CTD PMID:28001369 Lmo7 Rat morphine increases expression ISO Lmo7 (Mus musculus) 6480464 Morphine results in increased expression of LMO7 mRNA CTD PMID:21955143 Lmo7 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of LMO7 gene CTD PMID:33148267 Lmo7 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO Lmo7 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of LMO7 mRNA CTD PMID:25566086 Lmo7 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Lmo7 (Mus musculus) 6480464 MYBPC3 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of LMO7 mRNA] CTD PMID:25566086 Lmo7 Rat N-nitrosodiethylamine increases expression ISO Lmo7 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of LMO7 mRNA CTD PMID:17854601 Lmo7 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of LMO7 mRNA CTD PMID:18164116 Lmo7 Rat N-nitrosodiethylamine multiple interactions ISO Lmo7 (Mus musculus) 6480464 RB1 protein inhibits the reaction [Diethylnitrosamine results in increased expression of LMO7 mRNA] CTD PMID:17854601 Lmo7 Rat nicotine decreases expression ISO Lmo7 (Mus musculus) 6480464 Nicotine results in decreased expression of LMO7 mRNA CTD PMID:21955143 Lmo7 Rat Nutlin-3 multiple interactions ISO LMO7 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of and results in increased secretion of LMO7 protein CTD PMID:38460933 Lmo7 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of LMO7 mRNA CTD PMID:25729387 Lmo7 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of LMO7 mRNA CTD PMID:25729387 Lmo7 Rat ozone multiple interactions ISO LMO7 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of LMO7 mRNA more ... CTD PMID:32699268 Lmo7 Rat ozone multiple interactions ISO Lmo7 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of LMO7 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of LMO7 mRNA CTD PMID:34911549 Lmo7 Rat p-chloromercuribenzoic acid increases expression ISO LMO7 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of LMO7 mRNA CTD PMID:26272509 Lmo7 Rat p-chloromercuribenzoic acid multiple interactions ISO LMO7 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LMO7 mRNA CTD PMID:27188386 Lmo7 Rat panobinostat multiple interactions ISO LMO7 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LMO7 mRNA CTD PMID:27188386 Lmo7 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of LMO7 gene CTD PMID:33148267 Lmo7 Rat phenobarbital multiple interactions ISO Lmo7 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of LMO7 mRNA] CTD PMID:19482888 Lmo7 Rat phenobarbital increases expression ISO Lmo7 (Mus musculus) 6480464 Phenobarbital results in increased expression of LMO7 mRNA CTD PMID:19482888 Lmo7 Rat phenylmercury acetate increases expression ISO LMO7 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of LMO7 mRNA CTD PMID:26272509 Lmo7 Rat phenylmercury acetate multiple interactions ISO LMO7 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LMO7 mRNA CTD PMID:27188386 Lmo7 Rat phorbol 13-acetate 12-myristate multiple interactions ISO LMO7 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of LMO7 mRNA CTD PMID:16979875 Lmo7 Rat quercetin decreases expression ISO LMO7 (Homo sapiens) 6480464 Quercetin results in decreased expression of LMO7 mRNA CTD PMID:21632981 Lmo7 Rat rac-lactic acid decreases expression ISO LMO7 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of LMO7 mRNA CTD PMID:30851411 Lmo7 Rat SB 431542 multiple interactions ISO LMO7 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Lmo7 Rat serpentine asbestos increases methylation ISO LMO7 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased methylation of LMO7 exon CTD PMID:29523930 Lmo7 Rat sodium arsenate multiple interactions ISO LMO7 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of LMO7 mRNA CTD PMID:32525701 Lmo7 Rat sodium arsenite increases stability ISO LMO7 (Homo sapiens) 6480464 sodium arsenite results in increased stability of LMO7 mRNA CTD PMID:25493608 Lmo7 Rat sodium arsenite multiple interactions ISO LMO7 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of LMO7 mRNA CTD PMID:39836092 Lmo7 Rat sodium arsenite decreases expression ISO LMO7 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of LMO7 mRNA CTD PMID:28595984 and PMID:34032870 Lmo7 Rat sodium arsenite affects methylation ISO LMO7 (Homo sapiens) 6480464 sodium arsenite affects the methylation of LMO7 gene CTD PMID:28589171 Lmo7 Rat sodium chloride multiple interactions ISO LMO7 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of LMO7 protein CTD PMID:38598786 Lmo7 Rat Soman increases expression EXP 6480464 Soman results in increased expression of LMO7 mRNA CTD PMID:19281266 Lmo7 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of LMO7 mRNA CTD PMID:19281266 Lmo7 Rat sunitinib decreases expression ISO LMO7 (Homo sapiens) 6480464 Sunitinib results in decreased expression of LMO7 mRNA CTD PMID:31533062 Lmo7 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of LMO7 mRNA CTD PMID:31150632 Lmo7 Rat tetrachloromethane decreases expression ISO Lmo7 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of LMO7 mRNA CTD PMID:31919559 Lmo7 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of LMO7 mRNA] CTD PMID:31150632 Lmo7 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of LMO7 mRNA CTD PMID:23411599 Lmo7 Rat titanium dioxide increases expression ISO Lmo7 (Mus musculus) 6480464 titanium dioxide results in increased expression of LMO7 mRNA CTD PMID:27760801 and PMID:29264374 Lmo7 Rat titanium dioxide increases methylation ISO Lmo7 (Mus musculus) 6480464 titanium dioxide results in increased methylation of LMO7 promoter CTD PMID:35295148 Lmo7 Rat titanium dioxide decreases methylation ISO Lmo7 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of LMO7 promoter CTD PMID:35295148 Lmo7 Rat toluene increases expression EXP 6480464 Toluene results in increased expression of LMO7 mRNA CTD PMID:22967744 Lmo7 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of LMO7 mRNA CTD PMID:25729387 Lmo7 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of LMO7 mRNA CTD PMID:25729387 Lmo7 Rat tremolite asbestos decreases expression ISO Lmo7 (Mus musculus) 6480464 tremolite results in decreased expression of LMO7 mRNA CTD PMID:29279043 Lmo7 Rat trichostatin A increases expression ISO LMO7 (Homo sapiens) 6480464 trichostatin A results in increased expression of LMO7 mRNA CTD PMID:24935251 and PMID:26705709 Lmo7 Rat triclosan decreases expression ISO LMO7 (Homo sapiens) 6480464 Triclosan results in decreased expression of LMO7 mRNA CTD PMID:30510588 Lmo7 Rat triphenyl phosphate affects expression ISO LMO7 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of LMO7 mRNA CTD PMID:37042841 Lmo7 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of LMO7 mRNA CTD PMID:24136188 Lmo7 Rat valproic acid increases expression ISO Lmo7 (Mus musculus) 6480464 Valproic Acid results in increased expression of LMO7 mRNA CTD PMID:19136453 and PMID:21427059 Lmo7 Rat valproic acid multiple interactions ISO LMO7 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LMO7 mRNA CTD PMID:27188386 Lmo7 Rat valproic acid increases expression ISO LMO7 (Homo sapiens) 6480464 Valproic Acid results in increased expression of LMO7 mRNA CTD PMID:24383497 more ... Lmo7 Rat valproic acid decreases methylation ISO LMO7 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of LMO7 gene CTD PMID:29154799 Lmo7 Rat valproic acid affects expression ISO LMO7 (Homo sapiens) 6480464 Valproic Acid affects the expression of LMO7 mRNA CTD PMID:25979313 Lmo7 Rat vancomycin decreases expression ISO Lmo7 (Mus musculus) 6480464 Vancomycin results in decreased expression of LMO7 mRNA CTD PMID:18930951 Lmo7 Rat venlafaxine hydrochloride decreases expression ISO LMO7 (Homo sapiens) 6480464 Venlafaxine Hydrochloride results in decreased expression of LMO7 mRNA CTD PMID:16341940 Lmo7 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of LMO7 mRNA CTD PMID:19015723 Lmo7 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of LMO7 gene CTD PMID:31079544 Lmo7 Rat zinc atom multiple interactions ISO LMO7 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of LMO7 mRNA CTD PMID:16979875 Lmo7 Rat zinc(0) multiple interactions ISO LMO7 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of LMO7 mRNA CTD PMID:16979875
(+)-schisandrin B (EXP) (S)-nicotine (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acetylsalicylic acid (ISO) acrolein (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) Benzo[k]fluoranthene (ISO) beta-lapachone (ISO) beta-naphthoflavone (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) cadmium dichloride (EXP) caffeine (ISO) calcium silicate (ISO) carbon nanotube (ISO) chlordecone (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) cocaine (EXP) copper(II) sulfate (ISO) coumarin (ISO) crocidolite asbestos (ISO) cycloheximide (ISO) cyclosporin A (ISO) dibenzofurans (ISO) Dibutyl phosphate (ISO) diethyl maleate (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) flurbiprofen (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) geldanamycin (ISO) hexadecanoic acid (ISO) hydrogen peroxide (ISO) irinotecan (EXP) ivermectin (ISO) L-methionine (ISO) levofloxacin (EXP) mercury dibromide (ISO) methamphetamine (ISO) methoxychlor (EXP) methylmercury chloride (ISO) morphine (ISO) N,N-diethyl-m-toluamide (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosodiethylamine (EXP,ISO) nicotine (ISO) Nutlin-3 (ISO) oxaliplatin (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) permethrin (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) quercetin (ISO) rac-lactic acid (ISO) SB 431542 (ISO) serpentine asbestos (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) Soman (EXP) sunitinib (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) toluene (EXP) topotecan (EXP) tremolite asbestos (ISO) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) valdecoxib (EXP) valproic acid (ISO) vancomycin (ISO) venlafaxine hydrochloride (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO)
Lmo7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 84,981,689 - 85,184,554 (+) NCBI GRCr8 mRatBN7.2 15 78,566,999 - 78,769,833 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 78,567,023 - 78,769,783 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 82,584,378 - 82,786,313 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 83,660,934 - 83,862,788 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 80,581,526 - 80,790,426 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 86,242,911 - 86,458,512 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 86,243,148 - 86,457,739 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 87,780,294 - 87,997,103 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 85,710,975 - 85,928,469 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 85,726,754 - 85,944,249 (+) NCBI Celera 15 77,758,335 - 77,960,326 (+) NCBI Celera Cytogenetic Map 15 q21 NCBI
LMO7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 75,620,434 - 75,859,870 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 75,620,434 - 75,859,870 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 76,194,570 - 76,434,006 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 75,092,571 - 75,332,003 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 75,092,570 - 75,332,002 NCBI Celera 13 57,092,445 - 57,331,882 (+) NCBI Celera Cytogenetic Map 13 q22.2 NCBI HuRef 13 56,891,721 - 57,131,153 (+) NCBI HuRef CHM1_1 13 76,162,285 - 76,401,623 (+) NCBI CHM1_1 T2T-CHM13v2.0 13 74,844,083 - 75,083,598 (+) NCBI T2T-CHM13v2.0
Lmo7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 101,967,353 - 102,172,144 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 101,967,386 - 102,172,146 (+) Ensembl GRCm39 Ensembl GRCm38 14 101,729,928 - 101,934,708 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 101,729,957 - 101,934,710 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 102,129,145 - 102,333,910 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 100,616,519 - 100,821,316 (+) NCBI MGSCv36 mm8 Celera 14 100,369,410 - 100,570,067 (+) NCBI Celera Cytogenetic Map 14 E2.3 NCBI cM Map 14 50.9 NCBI
Lmo7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955404 31,196,312 - 31,388,258 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955404 31,197,156 - 31,388,571 (-) NCBI ChiLan1.0 ChiLan1.0
LMO7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 77,191,658 - 77,435,684 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 75,797,434 - 76,033,129 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 56,846,724 - 57,084,178 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 75,893,269 - 76,130,080 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 75,894,529 - 76,130,080 (+) Ensembl panpan1.1 panPan2
LMO7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 22 29,415,374 - 29,619,215 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 22 29,415,337 - 29,618,667 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 22 29,276,170 - 29,479,940 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 22 29,750,469 - 29,947,955 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 22 29,750,520 - 29,947,968 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 22 29,401,034 - 29,598,351 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 22 29,444,631 - 29,641,926 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 22 29,513,289 - 29,710,649 (+) NCBI UU_Cfam_GSD_1.0
Lmo7
LMO7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 48,072,159 - 48,133,446 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 47,911,076 - 48,133,449 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 52,681,961 - 52,709,628 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LMO7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 54,647,783 - 54,954,970 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 54,736,294 - 54,957,721 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666046 10,866,306 - 11,099,634 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lmo7
.
Predicted Target Of
Count of predictions: 95 Count of miRNA genes: 87 Interacting mature miRNAs: 90 Transcripts: ENSRNOT00000032917 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1549844 Bss7 Bone structure and strength QTL 7 6.4 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 15 75788062 101769107 Rat 2300326 Plaw1 Placental weight QTL 1 15 0.005 placenta mass (VT:0004257) placenta wet weight (CMO:0002088) 15 68327165 100062518 Rat 70155 Gcs1 Gastric cancer susceptibility QTL1 3.8 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 15 76306099 101769107 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 631516 Gluco31 Glucose level QTL 31 7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 55596089 95018120 Rat 1331724 Bp223 Blood pressure QTL 223 3.53715 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 73690518 95018228 Rat 2317055 Aia10 Adjuvant induced arthritis QTL 10 3.41 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 15 75788062 101769107 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat 731177 Uae26 Urinary albumin excretion QTL 26 2.4 0.025 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 15 67588667 101769107 Rat 1300144 Rf23 Renal function QTL 23 3.61 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 15 40631268 98288169 Rat 1576315 Schws6 Schwannoma susceptibility QTL 6 0.0069 nervous system integrity trait (VT:0010566) post-insult time of death (CMO:0002005) 15 53806152 98806152 Rat 61477 Aia4 Adjuvant induced arthritis QTL 4 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 15 55596089 91365858 Rat 70182 BpQTLcluster12 Blood pressure QTL cluster 12 3.53 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 15 73690657 95018120 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 1581555 Eae19 Experimental allergic encephalomyelitis QTL 19 4.7 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 15 76306099 90088744 Rat 631655 Bp126 Blood pressure QTL 126 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 58156477 101769107 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 1598828 Glom14 Glomerulus QTL 14 2.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 15 34054139 79054139 Rat 1641889 Colcr6 Colorectal carcinoma resistance QTL 6 2.9 0.0126 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 15 73690518 99794247 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat
BF413319
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 78,727,873 - 78,727,965 (+) MAPPER mRatBN7.2 Rnor_6.0 15 86,416,552 - 86,416,643 NCBI Rnor6.0 Rnor_5.0 15 87,955,155 - 87,955,246 UniSTS Rnor5.0 RGSC_v3.4 15 85,887,282 - 85,887,373 UniSTS RGSC3.4 Celera 15 77,919,087 - 77,919,178 UniSTS RH 3.4 Map 15 545.6 UniSTS Cytogenetic Map 15 q21 UniSTS
AI008211
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 78,735,787 - 78,735,979 (+) MAPPER mRatBN7.2 Rnor_6.0 15 86,424,465 - 86,424,656 NCBI Rnor6.0 Rnor_5.0 15 87,963,068 - 87,963,259 UniSTS Rnor5.0 RGSC_v3.4 15 85,895,195 - 85,895,386 UniSTS RGSC3.4 Celera 15 77,927,000 - 77,927,191 UniSTS RH 3.4 Map 15 504.1 UniSTS Cytogenetic Map 15 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000084471 ⟹ ENSRNOP00000074706
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 78,567,023 - 78,768,201 (+) Ensembl Rnor_6.0 Ensembl 15 86,243,148 - 86,457,739 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000090727 ⟹ ENSRNOP00000071726
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 78,567,023 - 78,768,201 (+) Ensembl Rnor_6.0 Ensembl 15 86,243,148 - 86,457,739 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095601 ⟹ ENSRNOP00000096784
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 78,656,479 - 78,769,783 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117839 ⟹ ENSRNOP00000081200
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 78,672,218 - 78,769,783 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118677 ⟹ ENSRNOP00000090858
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 78,656,479 - 78,769,783 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000120161 ⟹ ENSRNOP00000083331
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 78,567,023 - 78,769,783 (+) Ensembl
RefSeq Acc Id:
NM_001001515 ⟹ NP_001001515
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,735 - 85,184,551 (+) NCBI mRatBN7.2 15 78,566,999 - 78,769,833 (+) NCBI Rnor_6.0 15 86,243,148 - 86,457,739 (+) NCBI Rnor_5.0 15 87,780,294 - 87,997,103 (+) NCBI RGSC_v3.4 15 85,710,975 - 85,928,469 (+) RGD Celera 15 77,758,335 - 77,960,326 (+) RGD
Sequence:
ATGGAAGGGATGGAGGACGCTGAGGCCGATTGCTCCATTGCATTCGCGGAGGCTCAGAGATGGGTGGAGGCTGTAACTGAGAAGAATTTTGAAACAAGGGATTTTCGAGCCTCTCTGGAAAATGGTGT
hide sequence
RefSeq Acc Id:
NM_001415119 ⟹ NP_001402048
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,782 - 85,184,539 (+) NCBI mRatBN7.2 15 78,567,046 - 78,769,821 (+) NCBI
RefSeq Acc Id:
XM_006252397 ⟹ XP_006252459
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI mRatBN7.2 15 78,567,033 - 78,769,821 (+) NCBI Rnor_6.0 15 86,242,911 - 86,458,512 (+) NCBI Rnor_5.0 15 87,780,294 - 87,997,103 (+) NCBI
Sequence:
AGTTCCCAGGAGTCCCGGCTCCCTCTGCTCACCGCTTCCAGTTGCCTCTTCACCTCCTCCTGCTCCAGTCCTGCTGGATTTGAGCGGATTTCAGGAGTTTCGAGAAAGCAACTCCCGCAAGTTCTCCT
hide sequence
RefSeq Acc Id:
XM_006252400 ⟹ XP_006252462
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI mRatBN7.2 15 78,567,043 - 78,769,821 (+) NCBI Rnor_6.0 15 86,242,914 - 86,458,512 (+) NCBI Rnor_5.0 15 87,780,294 - 87,997,103 (+) NCBI
Sequence:
TCCCAGGAGTCCCGGCTCCCTCTGCTCACCGCTTCCAGTTGCCTCTTCACCTCCTCCTGCTCCA
hide sequence
RefSeq Acc Id:
XM_017599750 ⟹ XP_017455239
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI mRatBN7.2 15 78,567,032 - 78,769,821 (+) NCBI Rnor_6.0 15 86,242,911 - 86,458,512 (+) NCBI
Sequence:
AGTTCCCAGGAGTCCCGGCTCCCTCTGCTCACCGCTTCCAGTTGCCTCTTCACCTCCTCCTGCT
hide sequence
RefSeq Acc Id:
XM_017599751 ⟹ XP_017455240
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,086,414 - 85,184,554 (+) NCBI mRatBN7.2 15 78,672,343 - 78,769,833 (+) NCBI Rnor_6.0 15 86,360,544 - 86,458,512 (+) NCBI
Sequence:
ATCTTCAGGGCCAACTTACTTCAAATGATGCAAACATTTCAGTTCCTGGCTAGTTCATTCATGT
hide sequence
RefSeq Acc Id:
XM_017599752 ⟹ XP_017455241
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,071,192 - 85,184,554 (+) NCBI mRatBN7.2 15 78,656,475 - 78,769,833 (+) NCBI Rnor_6.0 15 86,345,190 - 86,458,512 (+) NCBI
Sequence:
CTACCTCGAGGTCAGGCCACTTTCTCACACTTGGGACAAGGCTACAAAGAAGGCTGAGAAAGTT
hide sequence
RefSeq Acc Id:
XM_017599753 ⟹ XP_017455242
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,115,882 - 85,184,554 (+) NCBI mRatBN7.2 15 78,701,340 - 78,769,833 (+) NCBI Rnor_6.0 15 86,390,025 - 86,458,512 (+) NCBI
Sequence:
CTGCAGTTGTTCTGGGAGCAGAGGGAGCCAAGGAAACTTATTCTGGTAGCAAGGAGGAGCCTGA
hide sequence
RefSeq Acc Id:
XM_017599754 ⟹ XP_017455243
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI mRatBN7.2 15 78,567,042 - 78,769,821 (+) NCBI Rnor_6.0 15 86,242,914 - 86,458,512 (+) NCBI
Sequence:
TCCCAGGAGTCCCGGCTCCCTCTGCTCACCGCTTCCAGTTGCCTCTTCACCTCCTCCTGCTCCAGTCCTGCTGGATTTGAGCGGATTTCAGGAGTTTCGAGAAAGCAACTCCCGCAAGTTCTCCTAGG
hide sequence
RefSeq Acc Id:
XM_039093520 ⟹ XP_038949448
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI mRatBN7.2 15 78,567,029 - 78,769,821 (+) NCBI
RefSeq Acc Id:
XM_039093521 ⟹ XP_038949449
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI mRatBN7.2 15 78,567,029 - 78,769,821 (+) NCBI
RefSeq Acc Id:
XM_039093522 ⟹ XP_038949450
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI mRatBN7.2 15 78,567,030 - 78,769,821 (+) NCBI
RefSeq Acc Id:
XM_039093523 ⟹ XP_038949451
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI mRatBN7.2 15 78,567,032 - 78,769,821 (+) NCBI
RefSeq Acc Id:
XM_039093524 ⟹ XP_038949452
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI mRatBN7.2 15 78,567,030 - 78,769,821 (+) NCBI
RefSeq Acc Id:
XM_039093525 ⟹ XP_038949453
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI mRatBN7.2 15 78,567,031 - 78,769,821 (+) NCBI
RefSeq Acc Id:
XM_039093527 ⟹ XP_038949455
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI mRatBN7.2 15 78,567,033 - 78,769,821 (+) NCBI
RefSeq Acc Id:
XM_039093528 ⟹ XP_038949456
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,086,414 - 85,184,554 (+) NCBI mRatBN7.2 15 78,672,347 - 78,769,833 (+) NCBI
RefSeq Acc Id:
XM_039093530 ⟹ XP_038949458
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,086,414 - 85,184,554 (+) NCBI mRatBN7.2 15 78,672,346 - 78,769,833 (+) NCBI
RefSeq Acc Id:
XM_063274443 ⟹ XP_063130513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,733 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274444 ⟹ XP_063130514
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274445 ⟹ XP_063130515
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274446 ⟹ XP_063130516
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274447 ⟹ XP_063130517
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274448 ⟹ XP_063130518
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274449 ⟹ XP_063130519
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,087,546 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274450 ⟹ XP_063130520
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,085,348 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274451 ⟹ XP_063130521
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,089,199 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274453 ⟹ XP_063130523
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,718 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274454 ⟹ XP_063130524
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,725 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274455 ⟹ XP_063130525
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,086,414 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274456 ⟹ XP_063130526
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,689 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274457 ⟹ XP_063130527
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274458 ⟹ XP_063130528
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,086,414 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274459 ⟹ XP_063130529
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,696 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274460 ⟹ XP_063130530
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,689 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274461 ⟹ XP_063130531
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,086,414 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274462 ⟹ XP_063130532
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,086,414 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274463 ⟹ XP_063130533
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,071,183 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274464 ⟹ XP_063130534
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274465 ⟹ XP_063130535
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,071,198 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274466 ⟹ XP_063130536
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,071,183 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XM_063274467 ⟹ XP_063130537
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 85,087,692 - 85,184,554 (+) NCBI
RefSeq Acc Id:
XR_010057841
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 84,981,706 - 85,167,880 (+) NCBI
RefSeq Acc Id:
NP_001001515 ⟸ NM_001001515
- Peptide Label:
isoform 1
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
- Sequence:
MEGMEDAEADCSIAFAEAQRWVEAVTEKNFETRDFRASLENGVLLCDLINKLKPGVVRKINRLSTPIAGLDNINVFLKACEQIGLKEAQLFHPGDLQDLSNRVTVKQEETDRRLKNVLITLYWLGRKA
hide sequence
RefSeq Acc Id:
XP_006252459 ⟸ XM_006252397
- Peptide Label:
isoform X16
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
- Sequence:
MEGMEDAEADCSVAFAEAQRWVEAVTEKNFETRDFRASLENGVLLCDLINKLKPGVVRKINRLSTPIAGLDNINVFLKACEQIGLKEAQLFHPGDLQDLSNRVTVKQEETDRRLKNVLITLYWLGRKA
hide sequence
RefSeq Acc Id:
XP_006252462 ⟸ XM_006252400
- Peptide Label:
isoform X23
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
- Sequence:
MEGMEDAEADCSVAFAEAQRWVEAVTEKNFETRDFRASLENGVLLCDLINKLKPGVVRKINRLSTPIAGLDNINVFLKACEQIGLKEAQLFHPGDLQDLSNRVTVKQEETDRRLKNVLITLYWLGRKA
hide sequence
RefSeq Acc Id:
XP_017455239 ⟸ XM_017599750
- Peptide Label:
isoform X5
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
- Sequence:
MEGMEDAEADCSVAFAEAQRWVEAVTEKNFETRDFRASLENGVLLCDLINKLKPGVVRKINRLS
hide sequence
RefSeq Acc Id:
XP_017455243 ⟸ XM_017599754
- Peptide Label:
isoform X20
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
- Sequence:
MEGMEDAEADCSVAFAEAQRWVEAVTEKNFETRDFRASLENGVLLCDLINKLKPGVVRKINRLSTPIAGLDNINVFLKACEQIGLKEAQLFHPGDLQDLSNRVTVKQEETDRRLKNVLITLYWLGRKA
hide sequence
RefSeq Acc Id:
XP_017455241 ⟸ XM_017599752
- Peptide Label:
isoform X14
- UniProtKB:
A0A8I6AMI4 (UniProtKB/TrEMBL)
- Sequence:
MKNDNINVFLKACEQIGLKEAQLFHPGDLQDLSNRVTVKQEETDRRLKNVLITLYWLGRKAQNN
hide sequence
RefSeq Acc Id:
XP_017455240 ⟸ XM_017599751
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6AMI4 (UniProtKB/TrEMBL)
- Sequence:
MSNMPLPNGTAQPISTRLLPGRIAWSLCLSRAGSATKPRFQDNINVFLKACEQIGLKEAQLFHP
hide sequence
RefSeq Acc Id:
XP_017455242 ⟸ XM_017599753
- Peptide Label:
isoform X19
- UniProtKB:
A0A8I6AMI4 (UniProtKB/TrEMBL)
- Sequence:
MQDYNKDDMSYRRISAIEPKSALPFNRFLPNKSKQPSYVPAPLRKKRPDKNEDNRRSWASPVYTETEGTFSSTQRRAWGPKMENWHTVQETSTSSWCLEEEEEKVTRLPNVVKDDLYVRKLSPVMPSP
hide sequence
Ensembl Acc Id:
ENSRNOP00000074706 ⟸ ENSRNOT00000084471
Ensembl Acc Id:
ENSRNOP00000071726 ⟸ ENSRNOT00000090727
RefSeq Acc Id:
XP_038949449 ⟸ XM_039093521
- Peptide Label:
isoform X3
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038949448 ⟸ XM_039093520
- Peptide Label:
isoform X2
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038949450 ⟸ XM_039093522
- Peptide Label:
isoform X4
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038949452 ⟸ XM_039093524
- Peptide Label:
isoform X9
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038949453 ⟸ XM_039093525
- Peptide Label:
isoform X10
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038949451 ⟸ XM_039093523
- Peptide Label:
isoform X6
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038949455 ⟸ XM_039093527
- Peptide Label:
isoform X15
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038949458 ⟸ XM_039093530
- Peptide Label:
isoform X36
- UniProtKB:
A0A8I6AMI4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038949456 ⟸ XM_039093528
- Peptide Label:
isoform X17
- UniProtKB:
A0A8I6AMI4 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000083331 ⟸ ENSRNOT00000120161
Ensembl Acc Id:
ENSRNOP00000096784 ⟸ ENSRNOT00000095601
Ensembl Acc Id:
ENSRNOP00000081200 ⟸ ENSRNOT00000117839
Ensembl Acc Id:
ENSRNOP00000090858 ⟸ ENSRNOT00000118677
RefSeq Acc Id:
NP_001402048 ⟸ NM_001415119
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I5ZWT3 (UniProtKB/TrEMBL), Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130526 ⟸ XM_063274456
- Peptide Label:
isoform X25
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130530 ⟸ XM_063274460
- Peptide Label:
isoform X28
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130529 ⟸ XM_063274459
- Peptide Label:
isoform X26
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130514 ⟸ XM_063274444
- Peptide Label:
isoform X8
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130515 ⟸ XM_063274445
- Peptide Label:
isoform X11
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130516 ⟸ XM_063274446
- Peptide Label:
isoform X12
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130517 ⟸ XM_063274447
- Peptide Label:
isoform X13
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130518 ⟸ XM_063274448
- Peptide Label:
isoform X18
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130527 ⟸ XM_063274457
- Peptide Label:
isoform X26
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130534 ⟸ XM_063274464
- Peptide Label:
isoform X32
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130523 ⟸ XM_063274453
- Peptide Label:
isoform X21
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130524 ⟸ XM_063274454
- Peptide Label:
isoform X22
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130513 ⟸ XM_063274443
- Peptide Label:
isoform X1
- UniProtKB:
Q6JBI7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130533 ⟸ XM_063274463
- Peptide Label:
isoform X31
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130536 ⟸ XM_063274466
- Peptide Label:
isoform X34
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130535 ⟸ XM_063274465
- Peptide Label:
isoform X33
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130520 ⟸ XM_063274450
- Peptide Label:
isoform X19
- UniProtKB:
A0A8I6AMI4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130525 ⟸ XM_063274455
- Peptide Label:
isoform X24
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130531 ⟸ XM_063274461
- Peptide Label:
isoform X29
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130528 ⟸ XM_063274458
- Peptide Label:
isoform X27
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130532 ⟸ XM_063274462
- Peptide Label:
isoform X30
- UniProtKB:
A0A8I5ZR48 (UniProtKB/TrEMBL), Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130519 ⟸ XM_063274449
- Peptide Label:
isoform X19
- UniProtKB:
A0A8I6AMI4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130537 ⟸ XM_063274467
- Peptide Label:
isoform X35
- UniProtKB:
Q6JBI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130521 ⟸ XM_063274451
- Peptide Label:
isoform X19
- UniProtKB:
A0A8I6AMI4 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-11-14
Lmo7
LIM domain 7
Lmo7
LIM domain only 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-04
Lmo7
LIM domain only 7
LMO7
LIM domain only protein 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-02-14
LMO7
LIM domain only protein 7
Symbol and Name status set to provisional
70820 PROVISIONAL
