Symbol:
Hpca
Name:
hippocalcin
RGD ID:
735422
MGI Page
MGI
Description:
Predicted to enable several functions, including actin binding activity; calcium ion binding activity; and identical protein binding activity. Acts upstream of or within inner ear development. Predicted to be located in several cellular components, including dendrite; neuronal cell body membrane; and perikaryon. Predicted to be active in glutamatergic synapse and postsynapse. Is expressed in ganglia; salivary gland primordium; and telencephalon. Human ortholog(s) of this gene implicated in torsion dystonia 2. Orthologous to human HPCA (hippocalcin).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
neuron-specific calcium-binding protein hippocalcin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HPCA (hippocalcin) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Hpca (hippocalcin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Hpca (hippocalcin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HPCA (hippocalcin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HPCA (hippocalcin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hpca (hippocalcin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HPCA (hippocalcin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HPCA (hippocalcin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Hpca (hippocalcin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
HPCAL1 (hippocalcin like 1) HGNC
OrthoDB
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Hpca (hippocalcin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
HPCA (hippocalcin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
hpca (hippocalcin)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB|ZFIN)
Drosophila melanogaster (fruit fly):
Nca
Alliance
DIOPT (Hieranoid|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
hpca
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 129,005,363 - 129,019,712 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 129,005,363 - 129,015,829 (-) Ensembl GRCm39 Ensembl GRCm38 4 129,111,570 - 129,125,919 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 129,111,570 - 129,122,036 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 128,788,819 - 128,798,984 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 128,613,879 - 128,621,062 (-) NCBI MGSCv36 mm8 Celera 4 127,451,599 - 127,461,862 (-) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 62.88 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hpca Mouse (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of HPCA mRNA CTD PMID:21955143 Hpca Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of HPCA mRNA CTD PMID:21570461 Hpca Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Hpca (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of HPCA mRNA CTD PMID:32109520 Hpca Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Hpca (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Hpca Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of HPCA mRNA CTD PMID:30951980 Hpca Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of HPCA gene CTD PMID:31683443 Hpca Mouse 4,4'-sulfonyldiphenol decreases methylation EXP 6480464 bisphenol S results in decreased methylation of HPCA promoter CTD PMID:33297965 Hpca Mouse 8-Br-cAMP decreases expression ISO HPCA (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of HPCA mRNA CTD PMID:22079614 Hpca Mouse all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of HPCA mRNA CTD PMID:36189433 Hpca Mouse all-trans-retinoic acid multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of HPCA mRNA CTD PMID:36189433 Hpca Mouse ammonium chloride affects expression ISO Hpca (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of HPCA mRNA CTD PMID:16483693 Hpca Mouse arsenous acid decreases expression ISO HPCA (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of HPCA mRNA CTD PMID:20458559 Hpca Mouse benzo[a]pyrene decreases expression ISO HPCA (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of HPCA mRNA CTD PMID:22316170 Hpca Mouse benzo[a]pyrene affects methylation ISO HPCA (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HPCA promoter CTD PMID:27901495 Hpca Mouse benzo[a]pyrene increases methylation ISO HPCA (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of HPCA 5' UTR CTD PMID:27901495 Hpca Mouse benzo[a]pyrene multiple interactions EXP 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of HPCA mRNA] CTD PMID:22228805 Hpca Mouse bisphenol A decreases expression ISO HPCA (Homo sapiens) 6480464 bisphenol A results in decreased expression of HPCA mRNA CTD PMID:33670352 Hpca Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HPCA mRNA CTD PMID:32156529 Hpca Mouse bisphenol A increases methylation ISO HPCA (Homo sapiens) 6480464 bisphenol A results in increased methylation of HPCA gene CTD PMID:31601247 Hpca Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of HPCA mRNA CTD PMID:38685157 Hpca Mouse butanal increases expression ISO HPCA (Homo sapiens) 6480464 butyraldehyde results in increased expression of HPCA mRNA CTD PMID:26079696 Hpca Mouse cadmium atom multiple interactions ISO HPCA (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HPCA mRNA CTD PMID:35301059 Hpca Mouse cadmium dichloride multiple interactions ISO HPCA (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HPCA mRNA CTD PMID:35301059 Hpca Mouse calcium atom decreases response to substance EXP 6480464 HPCA protein results in decreased susceptibility to Calcium CTD PMID:12445469 Hpca Mouse calcium(0) decreases response to substance EXP 6480464 HPCA protein results in decreased susceptibility to Calcium CTD PMID:12445469 Hpca Mouse carvedilol affects localization ISO Hpca (Rattus norvegicus) 6480464 carvedilol affects the localization of HPCA protein CTD PMID:21078978 Hpca Mouse CGP 52608 multiple interactions ISO HPCA (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to HPCA gene] CTD PMID:28238834 Hpca Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of HPCA mRNA CTD PMID:37019170 Hpca Mouse cocaine increases expression EXP 6480464 Cocaine deficiency results in increased expression of HPCA mRNA CTD PMID:27126842 Hpca Mouse copper(II) sulfate decreases expression ISO HPCA (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of HPCA mRNA CTD PMID:19549813 Hpca Mouse Cuprizon decreases expression ISO Hpca (Rattus norvegicus) 6480464 Cuprizone results in decreased expression of HPCA mRNA CTD PMID:26577399 Hpca Mouse diarsenic trioxide decreases expression ISO HPCA (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of HPCA mRNA CTD PMID:20458559 Hpca Mouse dimethylarsinic acid multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of HPCA mRNA CTD PMID:34876320 Hpca Mouse ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of HPCA mRNA CTD PMID:21955143 Hpca Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of HPCA mRNA CTD PMID:30319688 Hpca Mouse ethylparaben decreases expression ISO HPCA (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of HPCA mRNA CTD PMID:37690743 Hpca Mouse fenvalerate increases expression ISO Hpca (Rattus norvegicus) 6480464 fenvalerate results in increased expression of HPCA mRNA CTD PMID:30307764 Hpca Mouse furan increases methylation ISO Hpca (Rattus norvegicus) 6480464 furan results in increased methylation of HPCA gene CTD PMID:22079235 Hpca Mouse genistein decreases expression EXP 6480464 Genistein results in decreased expression of HPCA mRNA CTD PMID:32186404 Hpca Mouse gentamycin decreases expression ISO Hpca (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of HPCA mRNA CTD PMID:22061828 Hpca Mouse isoprenaline affects localization ISO Hpca (Rattus norvegicus) 6480464 Isoproterenol affects the localization of HPCA protein CTD PMID:21078978 Hpca Mouse ivermectin decreases expression ISO HPCA (Homo sapiens) 6480464 Ivermectin results in decreased expression of HPCA protein CTD PMID:32959892 Hpca Mouse kainic acid decreases response to substance EXP 6480464 HPCA protein results in decreased susceptibility to Kainic Acid CTD PMID:15607944 Hpca Mouse ketamine increases expression ISO Hpca (Rattus norvegicus) 6480464 Ketamine results in increased expression of HPCA mRNA CTD PMID:20080153 Hpca Mouse lead(0) affects expression ISO HPCA (Homo sapiens) 6480464 Lead affects the expression of HPCA mRNA CTD PMID:28903495 Hpca Mouse methamphetamine decreases expression ISO Hpca (Rattus norvegicus) 6480464 Methamphetamine results in decreased expression of HPCA mRNA CTD PMID:15644446 Hpca Mouse methylarsonic acid multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of HPCA mRNA CTD PMID:34876320 Hpca Mouse mono(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of HPCA mRNA CTD PMID:36189433 Hpca Mouse morphine increases expression EXP 6480464 Morphine results in increased expression of HPCA mRNA CTD PMID:21955143 Hpca Mouse morphine decreases expression EXP 6480464 Morphine deficiency results in decreased expression of HPCA mRNA CTD PMID:27126842 Hpca Mouse nicotine increases expression EXP 6480464 Nicotine results in increased expression of HPCA mRNA CTD PMID:21955143 Hpca Mouse propanal increases expression ISO HPCA (Homo sapiens) 6480464 propionaldehyde results in increased expression of HPCA mRNA CTD PMID:26079696 Hpca Mouse propranolol affects localization ISO Hpca (Rattus norvegicus) 6480464 Propranolol affects the localization of HPCA protein CTD PMID:21078978 Hpca Mouse resveratrol multiple interactions ISO HPCA (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of HPCA mRNA CTD PMID:23557933 Hpca Mouse sodium arsenate multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of HPCA mRNA CTD PMID:34876320 Hpca Mouse sodium arsenite multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of HPCA mRNA CTD PMID:34876320 Hpca Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of HPCA mRNA CTD PMID:37682722 Hpca Mouse Soman decreases expression ISO Hpca (Rattus norvegicus) 6480464 Soman results in decreased expression of HPCA mRNA CTD PMID:19281266 Hpca Mouse thapsigargin decreases response to substance EXP 6480464 HPCA protein results in decreased susceptibility to Thapsigargin CTD PMID:15607944 Hpca Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of HPCA gene and titanium dioxide results in increased methylation of HPCA promoter CTD PMID:35295148 Hpca Mouse trichloroethene increases expression ISO Hpca (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of HPCA mRNA CTD PMID:33387578 Hpca Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of HPCA mRNA CTD PMID:33045310
(S)-nicotine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 4,4'-sulfonyldiphenol (EXP) 8-Br-cAMP (ISO) all-trans-retinoic acid (EXP) ammonium chloride (ISO) arsenous acid (ISO) benzo[a]pyrene (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcium atom (EXP) calcium(0) (EXP) carvedilol (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) cocaine (EXP) copper(II) sulfate (ISO) Cuprizon (ISO) diarsenic trioxide (ISO) dimethylarsinic acid (EXP) ethanol (EXP) ethylparaben (ISO) fenvalerate (ISO) furan (ISO) genistein (EXP) gentamycin (ISO) isoprenaline (ISO) ivermectin (ISO) kainic acid (EXP) ketamine (ISO) lead(0) (ISO) methamphetamine (ISO) methylarsonic acid (EXP) mono(2-ethylhexyl) phthalate (EXP) morphine (EXP) nicotine (EXP) propanal (ISO) propranolol (ISO) resveratrol (ISO) sodium arsenate (EXP) sodium arsenite (EXP) Soman (ISO) thapsigargin (EXP) titanium dioxide (EXP) trichloroethene (ISO) triptonide (EXP)
Biological Process
activation of phospholipase D activity (ISO) calcium-mediated signaling (IEA,ISO) cellular response to calcium ion (ISO,ISS) cellular response to electrical stimulus (IEA,ISO) cellular response to L-glutamate (IEA,ISO) inner ear development (IDA) negative regulation of guanylate cyclase activity (ISO) positive regulation of adenylate cyclase activity (ISO) positive regulation of phospholipase activity (ISO) positive regulation of protein targeting to membrane (IEA,ISO) regulation of postsynaptic neurotransmitter receptor internalization (IEA,ISO) regulation of signal transduction (IBA) regulation of voltage-gated calcium channel activity (ISO,ISS) response to Aroclor 1254 (IEA,ISO) response to ketamine (IEA,ISO) response to L-glutamate (ISO) retina development in camera-type eye (IEA,ISO)
Cellular Component
axon (IEA,ISO) cytoplasm (ISO,ISS) cytosol (ISO,ISS) dendrite cytoplasm (IEA,ISO) dendrite membrane (IEA,ISO) dendritic spine head (IEA,ISO) glutamatergic synapse (IEA,ISO) membrane (ISO,ISS) neuronal cell body membrane (IEA,ISO) perikaryon (IEA,ISO) postsynapse (ISO)
1.
Expression profiling shows differential molecular pathways and provides potential new diagnostic biomarkers for colorectal serrated adenocarcinoma.
Conesa-Zamora P, etal., Int J Cancer. 2013 Jan 15;132(2):297-307. doi: 10.1002/ijc.27674. Epub 2012 Jun 28.
2.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
3.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
MGD IEA
MGD IEA
6.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Diminished hippocalcin expression in Huntington's disease brain does not account for increased striatal neuron vulnerability as assessed in primary neurons.
Rudinskiy N, etal., J Neurochem. 2009 Oct;111(2):460-72. doi: 10.1111/j.1471-4159.2009.06344.x. Epub 2009 Aug 17.
12.
Hippocalcin expression in the brain of the Snell dwarf mutant mouse.
Sugisaki T, etal., Brain Res. 1994 Nov 28;665(1):101-6.
Hpca Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 129,005,363 - 129,019,712 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 129,005,363 - 129,015,829 (-) Ensembl GRCm39 Ensembl GRCm38 4 129,111,570 - 129,125,919 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 129,111,570 - 129,122,036 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 128,788,819 - 128,798,984 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 128,613,879 - 128,621,062 (-) NCBI MGSCv36 mm8 Celera 4 127,451,599 - 127,461,862 (-) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 62.88 NCBI
HPCA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 32,885,996 - 32,894,646 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 32,885,994 - 32,898,441 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 33,352,092 - 33,360,247 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 33,124,685 - 33,132,834 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 33,021,190 - 33,029,339 NCBI Celera 1 31,620,733 - 31,628,882 (+) NCBI Celera Cytogenetic Map 1 p35.1 NCBI HuRef 1 31,467,222 - 31,475,369 (+) NCBI HuRef CHM1_1 1 33,467,533 - 33,475,680 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 32,745,769 - 32,754,441 (+) NCBI T2T-CHM13v2.0
Hpca Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 146,739,978 - 146,750,961 (-) NCBI GRCr8 mRatBN7.2 5 141,455,616 - 141,466,252 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 141,455,613 - 141,463,841 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 144,153,733 - 144,162,193 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 145,923,554 - 145,932,014 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 145,923,306 - 145,931,631 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 147,295,124 - 147,305,757 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 147,294,820 - 147,303,346 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 151,029,882 - 151,040,514 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 148,267,898 - 148,276,223 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 148,277,936 - 148,286,262 (-) NCBI Celera 5 139,935,623 - 139,943,977 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
Hpca Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 11,140,373 - 11,154,261 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 11,142,282 - 11,150,798 (+) NCBI ChiLan1.0 ChiLan1.0
HPCA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 193,927,688 - 193,936,359 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 193,049,890 - 193,058,560 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 32,176,465 - 32,185,133 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 33,362,921 - 33,371,524 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 33,363,673 - 33,371,524 (+) Ensembl panpan1.1 panPan2
HPCA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 68,464,631 - 68,473,661 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 68,465,280 - 68,473,310 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 65,045,221 - 65,053,618 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 69,030,436 - 69,038,834 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 69,029,808 - 69,039,028 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 65,841,971 - 65,850,366 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 66,864,436 - 66,872,823 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 67,856,319 - 67,864,715 (-) NCBI UU_Cfam_GSD_1.0
Hpca Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 49,961,196 - 49,969,278 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 15,785,879 - 15,798,740 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 15,786,171 - 15,794,830 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HPCA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 89,188,133 - 89,197,045 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 89,187,544 - 89,197,049 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 83,214,827 - 83,224,104 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HPCA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 99,974,952 - 99,983,194 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 99,975,742 - 99,980,728 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 16,708,814 - 16,717,377 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hpca
.
Predicted Target Of
Count of predictions: 2418 Count of miRNA genes: 531 Interacting mature miRNAs: 655 Transcripts: ENSMUST00000030572, ENSMUST00000095807, ENSMUST00000116442, ENSMUST00000116444, ENSMUST00000125931, ENSMUST00000135763, ENSMUST00000139450, ENSMUST00000149763, ENSMUST00000164649 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142139 Adip12_m adiposity 12 (mouse) Not determined 4 124621281 156860686 Mouse 10047132 Albq19_m albuminuria QTL 19 (mouse) Not determined 4 112824389 146824389 Mouse 1301525 Lmb1_m lupus in MRL and B6 F2 cross (mouse) Not determined 4 124264957 150676858 Mouse 14746982 Manh56_m mandible shape 56 (mouse) 4 117815917 151815917 Mouse 4141623 W6q13_m weight 6 weeks QTL 13 (mouse) Not determined 88982069 140468203 Mouse 12910797 Pwgrq4_m pre-weaning growth rate QTL 4 (mouse) 4 105835310 141433838 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 12910794 Pwbwq8_m post-weaning body weight QTL 8 (mouse) 4 105835310 141433838 Mouse 1300743 Skull6_m skull morphology 6 (mouse) Not determined 4 111009051 145009280 Mouse 1301382 Arvm2_m autoimmune renal vasculitis 2 (mouse) Not determined 4 107791564 141791756 Mouse 1302149 Tlsr2_m thymic lymphoma suppressor region 2 (mouse) Not determined 4 124264957 142230960 Mouse 12910813 Pwbwq4_m pre-weaning body weight QTL 4 (mouse) 4 105835310 141433838 Mouse 4141093 W3q17_m weight 3 weeks QTL 17 (mouse) Not determined 88982069 140468203 Mouse 27226757 Femd1_m femur midshaft diameter 1, 5 week (mouse) 4 123993793 144326570 Mouse 12910808 Pwbwq9_m post-weaning body weight QTL 9 (mouse) 4 105835310 141433838 Mouse 1300621 Tpnr1_m thermal pain response 1 (mouse) Not determined 4 125230872 156860686 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 4142493 Femwf13_m femur work to failure 13 (mouse) Not determined 116154678 150154782 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300663 Start2_m startle response 2 (mouse) Not determined 4 107264957 141265153 Mouse 1300917 Gasa1_m gastritis type A susceptibility locus 1 (mouse) Not determined 4 124055093 142438020 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 10412210 Cypr6_m cytokine production 6 (mouse) Not determined 4 120617848 154617995 Mouse 1302078 Sluc21_m susceptibility to lung cancer 21 (mouse) Not determined 4 117401141 151401275 Mouse 10045620 Heal22_m wound healing/regeneration 22 (mouse) Not determined 4 125230872 156860686 Mouse 4142481 Gct1_m granulosa cell tumorigenesis 1 (mouse) Not determined 4 127784226 156860686 Mouse 10412072 Ssen1_m suseptibility to Sendai virus 1 (mouse) Not determined 4 109658132 133154782 Mouse 4141065 Shali2_m survival time to hyperoxic acute lung injury 2 (mouse) Not determined 124055093 141572792 Mouse 13503348 Bntq18_m bone traits QTL 18 (mouse) 4 120617848 154617995 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 1300655 Nidds_m non-insulin-dependent diabetes mellitus in SJL (mouse) Not determined 4 115030777 129465915 Mouse 1300781 Lith8_m lithogenic gene 8 (mouse) Not determined 4 107264957 141265153 Mouse 39128212 Lwq21_m liver weight QTL 21 (mouse) 4 88982069 140468203 Mouse 4141180 Ssic1_m susceptibility to small intestinal cancer 1 (mouse) Not determined 120674005 154674151 Mouse 1301847 Fecq2_m fecundity QTL 2 (mouse) Not determined 4 100071971 134072206 Mouse 1302102 Bis1_m beta-carboline-induced seizures 1 (mouse) Not determined 4 119864433 153864536 Mouse 10043996 Gct5_m granulosa cell tumorigenesis 5 (mouse) Not determined 4 127784226 156860686 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 10043985 Stheal12_m soft tissue heal 12 (mouse) Not determined 4 121342649 155342753 Mouse 1301982 Pltiq1_m phospholipid transfer protein inducibility QTL 1 (mouse) Not determined 4 124621281 156860686 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 1300803 Sluc6_m susceptibility to lung cancer 6 (mouse) Not determined 4 120674005 154674151 Mouse 4141549 W10q10_m weight 10 weeks QTL 10 (mouse) Not determined 88982069 140468203 Mouse 4142061 Chlq16_m circulating hormone level QTL 16 (mouse) Not determined 4 121342649 155342753 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 1300933 Cdcs9_m cytokine deficiency colitis susceptibility 9 (mouse) Not determined 4 125230872 156860686 Mouse 1300809 Ccrs2_m corpus callosum hemisphere surface size 2 (mouse) Not determined 4 107264957 141265153 Mouse 1301964 Bw8q2_m body weight at 8 weeks QTL 2 (mouse) Not determined 4 119864433 153864536 Mouse 1301452 Elsgp1_m elevated serum gp70 1 (mouse) Not determined 4 121342649 155342753 Mouse 1301106 Skts7_m skin tumor susceptibility 7 (mouse) Not determined 4 100071971 134072206 Mouse 10755520 Rbc1_m red blood cell count 1 (mouse) 4 108477692 142477692 Mouse 10755521 Hct1_m hematocrit 1 (mouse) 4 108477692 142477692 Mouse 10755522 Hgb1_m hemoglobin 1 (mouse) 4 108477692 142477692 Mouse 27095924 Pglq2_m pelvic girdle length QTL 2, 5 week (mouse) 4 69118237 130727311 Mouse 1300858 Tafat_m tally ho associated mesenteric fat pad weight (mouse) Not determined 4 124621281 156860686 Mouse 10755531 Lymph3_m lymphocyte differential 3 (mouse) 4 124553483 156860686 Mouse 27095917 Scvln14_m sacral vertebrae length 2, 16 week (mouse) 4 68018237 130277062 Mouse 15039382 Ltgq7_m liver triglyceride QTL 7 (mouse) 4 105705794 139705794 Mouse 11533916 Mts1_m mammary tumor susceptibility 1 (mouse) 4 125289325 156860686 Mouse 15039377 Bw45_m body weight QTL 45 (mouse) 4 105705794 139705794 Mouse 1300839 Dyscalc2_m dystrophic cardiac calcinosis 2 (mouse) Not determined 4 111009051 145009280 Mouse 12880433 Fgf23lq1_m FGF23 serum level QTL 1 (mouse) 4 101157197 135157197 Mouse 4141001 Tgq17_m triglyceride QTL 17 (mouse) Not determined 112523489 146523489 Mouse 15039378 Adip30_m adiposity 30 (mouse) 4 105705794 139705794 Mouse 1357800 Tgq3_m triglyceride QTL 3 (mouse) Not determined 4 107055093 141055180 Mouse 15039385 Mvlq3_m macrovesicular liver lesion QTL 3 (mouse) 4 112182386 146182386 Mouse
AB015200
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 129,112,175 - 129,112,269 UniSTS GRCm38 MGSCv37 4 128,789,419 - 128,789,513 UniSTS GRCm37 Celera 4 127,452,201 - 127,452,295 UniSTS Cytogenetic Map 4 D2-D3 UniSTS Whitehead/MRC_RH 4 1682.5 UniSTS
AI507302
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 129,111,384 - 129,111,479 UniSTS GRCm38 MGSCv37 4 128,788,628 - 128,788,723 UniSTS GRCm37 Celera 4 127,451,408 - 127,451,503 UniSTS Cytogenetic Map 4 D2.2 UniSTS Cytogenetic Map 4 D2-D3 UniSTS Whitehead/MRC_RH 4 1673.6 UniSTS
D5Wox35
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 129,111,700 - 129,111,856 UniSTS GRCm38 MGSCv37 4 128,788,944 - 128,789,100 UniSTS GRCm37 Celera 4 127,451,724 - 127,451,882 UniSTS Cytogenetic Map 4 D2-D3 UniSTS Cytogenetic Map 4 D2.2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000030572 ⟹ ENSMUSP00000030572
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,005,369 - 129,015,084 (-) Ensembl GRCm38.p6 Ensembl 4 129,111,576 - 129,121,291 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000095807 ⟹ ENSMUSP00000093486
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,005,363 - 129,012,760 (-) Ensembl GRCm38.p6 Ensembl 4 129,111,570 - 129,118,967 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000116442 ⟹ ENSMUSP00000112143
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,006,053 - 129,014,739 (-) Ensembl GRCm38.p6 Ensembl 4 129,112,260 - 129,120,946 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000116444 ⟹ ENSMUSP00000112145
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,005,363 - 129,015,829 (-) Ensembl GRCm38.p6 Ensembl 4 129,111,570 - 129,122,036 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000125931 ⟹ ENSMUSP00000115031
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,006,242 - 129,015,718 (-) Ensembl GRCm38.p6 Ensembl 4 129,112,449 - 129,121,925 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000135763 ⟹ ENSMUSP00000120655
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,012,398 - 129,015,501 (-) Ensembl GRCm38.p6 Ensembl 4 129,118,605 - 129,121,708 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000139450 ⟹ ENSMUSP00000119178
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,006,067 - 129,015,682 (-) Ensembl GRCm38.p6 Ensembl 4 129,112,274 - 129,121,889 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000149763 ⟹ ENSMUSP00000115619
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,006,468 - 129,015,532 (-) Ensembl GRCm38.p6 Ensembl 4 129,112,675 - 129,121,739 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000164649 ⟹ ENSMUSP00000129548
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,005,369 - 129,015,533 (-) Ensembl GRCm38.p6 Ensembl 4 129,111,576 - 129,121,740 (-) Ensembl
RefSeq Acc Id:
NM_001130419 ⟹ NP_001123891
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,015,516 (-) NCBI GRCm38 4 129,111,570 - 129,121,747 (-) NCBI MGSCv37 4 128,788,819 - 128,798,984 (-) RGD Celera 4 127,451,594 - 127,462,047 (-) NCBI cM Map 4 ENTREZGENE
Sequence:
TCTGAGGCGGAGGTAGCAGGGGGCGTGTCTGGCCCCTGGAAGACCTTGGGACTGAGCAATGGGTGCTCCCTCCTCCCTAGAGAGCCCCCAGTTCATCTGGCTCGGGAGTTGAGGTGCGGGGGCAGCGA
hide sequence
RefSeq Acc Id:
NM_001286081 ⟹ NP_001273010
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,015,728 (-) NCBI GRCm38 4 129,111,570 - 129,121,925 (-) NCBI Celera 4 127,451,594 - 127,462,047 (-) NCBI
Sequence:
TTCCGTTCTCGCAGGTCACGGCCTGCACTCACAGAGGCTAGGAGAGGAGAGGAGAGGGTTCCTTGCCTGGAGGAGTACTGGGAAGAGCTAGGTGGGACTTGGCTCTTCTGCCATGGGCAAGCAGAACA
hide sequence
RefSeq Acc Id:
NM_001286083 ⟹ NP_001273012
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,015,516 (-) NCBI GRCm38 4 129,111,570 - 129,120,172 (-) NCBI Celera 4 127,451,594 - 127,462,047 (-) NCBI
Sequence:
GACCTTTTGAAACCGGAGAAAAGGTGGGACTTGGCTCTTCTGCCATGGGCAAGCAGAACAGCAA
hide sequence
RefSeq Acc Id:
NM_001421088 ⟹ NP_001408017
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,015,516 (-) NCBI
RefSeq Acc Id:
NM_001421089 ⟹ NP_001408018
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,015,899 (-) NCBI
RefSeq Acc Id:
NM_001421090 ⟹ NP_001408019
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,015,899 (-) NCBI
RefSeq Acc Id:
NM_001421091 ⟹ NP_001408020
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,015,899 (-) NCBI
RefSeq Acc Id:
NM_001421092 ⟹ NP_001408021
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,015,050 (-) NCBI
RefSeq Acc Id:
NM_010471 ⟹ NP_034601
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,015,050 (-) NCBI GRCm38 4 129,111,570 - 129,121,303 (-) NCBI MGSCv37 4 128,788,819 - 128,798,984 (-) RGD Celera 4 127,451,594 - 127,462,047 (-) NCBI cM Map 4 ENTREZGENE
Sequence:
GCCCGCCCCTCCGGCCGCCTCTGCCGCCGCGCGCCGCAGCAGCGCCGCCTTCTCTGCGCAGTCG
hide sequence
RefSeq Acc Id:
NR_185239
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,019,700 (-) NCBI
RefSeq Acc Id:
NR_185240
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,019,705 (-) NCBI
RefSeq Acc Id:
NR_185241
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,016,336 (-) NCBI
RefSeq Acc Id:
XM_006502775 ⟹ XP_006502838
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,015,894 (-) NCBI GRCm38 4 129,111,570 - 129,122,101 (-) NCBI
Sequence:
GGGGGGAGGACAGCATTTAGCTCAGGATGTAGCGATTGTTACCAGAGCTGGAGGAGGGAGAGTCCCTTACAGGCAGGAGGAGTTGTGACCCCATCAGCGCCTCTAAGAGCAGCTGTCCTTAGTACAGA
hide sequence
RefSeq Acc Id:
XM_030253224 ⟹ XP_030109084
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,019,712 (-) NCBI GRCm38 4 129,111,570 - 129,125,919 (-) NCBI
Sequence:
CCCGTGTAGAATGAGCTGGACTTGGGGAGATAGCAGATGCAAGTCCACAGGAAGGAGGGTCCTGGGTGTGGTGGAGTCTCATCGGGCTTCTTGGCTGGCTGGCGGAGGACAAGCTGCAGGATGCTCCG
hide sequence
RefSeq Acc Id:
XM_030253225 ⟹ XP_030109085
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,005,363 - 129,015,616 (-) NCBI GRCm38 4 129,111,570 - 129,121,823 (-) NCBI
Sequence:
GTGAGAGGTGGGATTAATTCTTAGAGGGGTTGGGGGATGACATCCGGAGTAGTAGGCAGGAGAG
hide sequence
RefSeq Acc Id:
NP_034601 ⟸ NM_010471
- Peptide Label:
isoform 1
- UniProtKB:
A2A7R4 (UniProtKB/Swiss-Prot), P84075 (UniProtKB/Swiss-Prot), E9PV73 (UniProtKB/TrEMBL)
- Sequence:
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAI
hide sequence
RefSeq Acc Id:
NP_001123891 ⟸ NM_001130419
- Peptide Label:
isoform 1
- UniProtKB:
A2A7R4 (UniProtKB/Swiss-Prot), P84075 (UniProtKB/Swiss-Prot), E9PV73 (UniProtKB/TrEMBL)
- Sequence:
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAI
hide sequence
RefSeq Acc Id:
NP_001273010 ⟸ NM_001286081
- Peptide Label:
isoform 1
- UniProtKB:
A2A7R4 (UniProtKB/Swiss-Prot), P84075 (UniProtKB/Swiss-Prot), E9PV73 (UniProtKB/TrEMBL)
- Sequence:
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAI
hide sequence
RefSeq Acc Id:
NP_001273012 ⟸ NM_001286083
- Peptide Label:
isoform 1
- UniProtKB:
A2A7R4 (UniProtKB/Swiss-Prot), P84075 (UniProtKB/Swiss-Prot), E9PV73 (UniProtKB/TrEMBL)
- Sequence:
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAI
hide sequence
RefSeq Acc Id:
XP_006502838 ⟸ XM_006502775
- Peptide Label:
isoform X1
- UniProtKB:
A2A7R4 (UniProtKB/Swiss-Prot), P84075 (UniProtKB/Swiss-Prot), E9PV73 (UniProtKB/TrEMBL)
- Sequence:
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAI
hide sequence
RefSeq Acc Id:
XP_030109084 ⟸ XM_030253224
- Peptide Label:
isoform X1
- UniProtKB:
P84075 (UniProtKB/Swiss-Prot), A2A7R4 (UniProtKB/Swiss-Prot), E9PV73 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_030109085 ⟸ XM_030253225
- Peptide Label:
isoform X1
- UniProtKB:
P84075 (UniProtKB/Swiss-Prot), A2A7R4 (UniProtKB/Swiss-Prot), E9PV73 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000115031 ⟸ ENSMUST00000125931
Ensembl Acc Id:
ENSMUSP00000119178 ⟸ ENSMUST00000139450
Ensembl Acc Id:
ENSMUSP00000129548 ⟸ ENSMUST00000164649
Ensembl Acc Id:
ENSMUSP00000115619 ⟸ ENSMUST00000149763
Ensembl Acc Id:
ENSMUSP00000120655 ⟸ ENSMUST00000135763
Ensembl Acc Id:
ENSMUSP00000093486 ⟸ ENSMUST00000095807
Ensembl Acc Id:
ENSMUSP00000030572 ⟸ ENSMUST00000030572
Ensembl Acc Id:
ENSMUSP00000112145 ⟸ ENSMUST00000116444
Ensembl Acc Id:
ENSMUSP00000112143 ⟸ ENSMUST00000116442
RefSeq Acc Id:
NP_001408019 ⟸ NM_001421090
- Peptide Label:
isoform 1
- UniProtKB:
P84075 (UniProtKB/Swiss-Prot), A2A7R4 (UniProtKB/Swiss-Prot), E9PV73 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001408018 ⟸ NM_001421089
- Peptide Label:
isoform 1
- UniProtKB:
P84075 (UniProtKB/Swiss-Prot), A2A7R4 (UniProtKB/Swiss-Prot), E9PV73 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001408020 ⟸ NM_001421091
- Peptide Label:
isoform 2
- UniProtKB:
E9PV73 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001408017 ⟸ NM_001421088
- Peptide Label:
isoform 1
- UniProtKB:
P84075 (UniProtKB/Swiss-Prot), A2A7R4 (UniProtKB/Swiss-Prot), E9PV73 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001408021 ⟸ NM_001421092
- Peptide Label:
isoform 1
- UniProtKB:
P84075 (UniProtKB/Swiss-Prot), A2A7R4 (UniProtKB/Swiss-Prot), E9PV73 (UniProtKB/TrEMBL)
RGD ID: 6884734 Promoter ID: EPDNEW_M5818 Type: initiation region Name: Hpca_1 Description: Mus musculus hippocalcin , transcript variant 2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 129,121,246 - 129,121,306 EPDNEW
