Symbol:
BDKRB1
Name:
bradykinin receptor B1
RGD ID:
730874
HGNC Page
HGNC:1029
Description:
Enables bradykinin receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway; cyclooxygenase pathway; and smooth muscle relaxation of the bladder outlet. Predicted to act upstream of or within response to lipopolysaccharide. Predicted to be located in endoplasmic reticulum. Predicted to be active in plasma membrane. Implicated in end stage renal disease; hypertension; and pulmonary fibrosis. Biomarker of end stage renal disease; glomerulonephritis; and rhinitis.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
B1 bradykinin receptor; B1BKR; B1R; BDKRB2; BK-1 receptor; BKB1R; BKR1; BRADYB1; bradykinin B1 receptor; bradykinin receptor 1; bradykinin receptor B2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Bdkrb1 (bradykinin receptor, beta 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Bdkrb1 (bradykinin receptor B1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Bdkrb1 (bradykinin receptor B1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
BDKRB1 (bradykinin receptor B1) NCBI
Ortholog
Canis lupus familiaris (dog):
BDKRB1 (bradykinin receptor B1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bdkrb1 (bradykinin receptor B1) NCBI
Ortholog
Sus scrofa (pig):
BDKRB1 (bradykinin receptor B1) HGNC
NCBI
Chlorocebus sabaeus (green monkey):
BDKRB1 (bradykinin receptor B1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Bdkrb1 (bradykinin receptor B1) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Bdkrb1 (bradykinin receptor B1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Bdkrb1 (bradykinin receptor, beta 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bdkrb1 (bradykinin receptor B1)
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|PANTHER|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
npr-33
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
npr-15
Alliance
DIOPT (Ensembl Compara|PANTHER)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
NCBI Annotation Information:
Note: This gene has been reviewed for its involvement in coronavirus biology, and is involved in immune response or antiviral activity.
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 96,256,210 - 96,264,763 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 96,256,210 - 96,268,967 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 96,722,547 - 96,731,100 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 95,792,312 - 95,800,853 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 95,792,311 - 95,800,851 NCBI Celera 14 76,778,278 - 76,786,817 (+) NCBI Celera Cytogenetic Map 14 q32.2 NCBI HuRef 14 76,907,652 - 76,916,201 (+) NCBI HuRef CHM1_1 14 96,661,476 - 96,670,026 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 90,487,459 - 90,496,013 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
BDKRB1 Human (+)-pilocarpine decreases response to substance ISO RGD:731358 6480464 BDKRB1 protein mutant form results in decreased susceptibility to Pilocarpine CTD PMID:15196965 BDKRB1 Human (-)-epigallocatechin 3-gallate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BDKRB1 mRNA CTD PMID:22079256 BDKRB1 Human 1-naphthyl isothiocyanate increases expression ISO RGD:620401 6480464 1-Naphthylisothiocyanate results in increased expression of BDKRB1 mRNA CTD PMID:30723492 BDKRB1 Human 15-acetyldeoxynivalenol increases expression EXP 6480464 15-acetyldeoxynivalenol results in increased expression of BDKRB1 mRNA CTD PMID:23792671 BDKRB1 Human 17beta-estradiol affects expression ISO RGD:731358 6480464 Estradiol affects the expression of BDKRB1 mRNA CTD PMID:15598610 BDKRB1 Human 17beta-estradiol multiple interactions EXP 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of BDKRB1 mRNA CTD PMID:17404688 BDKRB1 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of BDKRB1 mRNA CTD PMID:22298810 BDKRB1 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:620401 6480464 Tetrachlorodibenzodioxin results in increased expression of BDKRB1 mRNA CTD PMID:33387578 BDKRB1 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:620401 6480464 Tetrachlorodibenzodioxin affects the expression of BDKRB1 mRNA CTD PMID:22298810 BDKRB1 Human 3',5'-cyclic GMP multiple interactions ISO RGD:620401 6480464 [bradykinin, Leu(8)-des-Arg(9)- results in decreased activity of BDKRB1 protein] inhibits the reaction [Valsartan results in more ... CTD PMID:16982965 BDKRB1 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 BDKRB1 Human 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 BDKRB1 Human 8-Br-cAMP increases expression EXP 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of BDKRB1 mRNA CTD PMID:20147733 BDKRB1 Human [des-Arg(9)]-bradykinin increases expression ISO RGD:731358 6480464 bradykinin, des-Arg(9)- results in increased expression of BDKRB1 protein CTD PMID:16039549 BDKRB1 Human [des-Arg(9)]-bradykinin multiple interactions ISO RGD:731358 6480464 lipopolysaccharide A promotes the reaction [bradykinin, des-Arg(9)- results in increased expression of BDKRB1 protein]; Thalidomide more ... CTD PMID:16039549 BDKRB1 Human Ac-Ser-Asp-Lys-Pro-OH multiple interactions ISO RGD:731358 6480464 [BDKRB1 protein affects the activity of ACE protein] which affects the hydrolysis of goralatide CTD PMID:20096676 BDKRB1 Human Ac-Ser-Asp-Lys-Pro-OH affects abundance ISO RGD:731358 6480464 BDKRB1 protein affects the abundance of goralatide CTD PMID:20096676 BDKRB1 Human aldehydo-D-glucose increases expression ISO RGD:620401 6480464 Glucose results in increased expression of BDKRB1 protein CTD PMID:29165388 BDKRB1 Human aldehydo-D-glucose multiple interactions ISO RGD:620401 6480464 argan oil inhibits the reaction [Glucose results in increased expression of BDKRB1 protein]; Corn Oil more ... CTD PMID:29165388 BDKRB1 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of BDKRB1 mRNA CTD PMID:23830798 BDKRB1 Human AM-251 multiple interactions EXP 6480464 AM 251 inhibits the reaction [anandamide results in decreased activity of BDKRB1 protein] CTD PMID:19022239 BDKRB1 Human ammonium chloride affects expression ISO RGD:620401 6480464 Ammonium Chloride affects the expression of BDKRB1 mRNA CTD PMID:16483693 BDKRB1 Human anandamide multiple interactions EXP 6480464 AM 251 inhibits the reaction [anandamide results in decreased activity of BDKRB1 protein] CTD PMID:19022239 BDKRB1 Human anandamide decreases activity EXP 6480464 anandamide results in decreased activity of BDKRB1 protein CTD PMID:19022239 BDKRB1 Human antirheumatic drug decreases expression EXP 6480464 Antirheumatic Agents results in decreased expression of BDKRB1 mRNA CTD PMID:24449571 BDKRB1 Human arsenite(3-) decreases expression EXP 6480464 arsenite results in decreased expression of BDKRB1 mRNA CTD PMID:23974009 BDKRB1 Human Azoxymethane multiple interactions ISO RGD:731358 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of BDKRB1 more ... CTD PMID:29950665 BDKRB1 Human beclomethasone decreases expression EXP 6480464 Beclomethasone results in decreased expression of BDKRB1 mRNA CTD PMID:18039523 BDKRB1 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of BDKRB1 5' UTR CTD PMID:27901495 BDKRB1 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of BDKRB1 promoter CTD PMID:27901495 BDKRB1 Human benzo[a]pyrene diol epoxide I affects expression EXP 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide affects the expression of BDKRB1 mRNA CTD PMID:20382639 BDKRB1 Human bisphenol A affects expression ISO RGD:620401 6480464 bisphenol A affects the expression of BDKRB1 mRNA CTD PMID:25181051 BDKRB1 Human bisphenol A decreases expression ISO RGD:620401 6480464 bisphenol A results in decreased expression of BDKRB1 mRNA CTD PMID:36779543 BDKRB1 Human bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of BDKRB1 gene CTD PMID:31601247 BDKRB1 Human bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of BDKRB1 gene; [INS protein co-treated more ... CTD PMID:28628672|PMID:31601247 BDKRB1 Human bisphenol A decreases methylation ISO RGD:731358 6480464 bisphenol A results in decreased methylation of BDKRB1 promoter CTD PMID:27312807 BDKRB1 Human calcitriol increases expression EXP 6480464 Calcitriol results in increased expression of BDKRB1 mRNA CTD PMID:21592394 BDKRB1 Human calcitriol multiple interactions EXP 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of BDKRB1 mRNA CTD PMID:21592394 BDKRB1 Human calcium atom multiple interactions EXP 6480464 2-(2-(4-(4-nitrobenzyloxy)phenyl)ethyl)isothiourea methanesulfonate inhibits the reaction [[kallidin, des-Arg(10)- results in increased activity of BDKRB1 protein] which more ... CTD PMID:15703175 BDKRB1 Human calcium atom multiple interactions ISO RGD:620401 6480464 [kallidin, des-Arg(10)- binds to and results in increased activity of BDKRB1 protein] which results in more ... CTD PMID:22554775 BDKRB1 Human calcium(0) multiple interactions EXP 6480464 2-(2-(4-(4-nitrobenzyloxy)phenyl)ethyl)isothiourea methanesulfonate inhibits the reaction [[kallidin, des-Arg(10)- results in increased activity of BDKRB1 protein] which more ... CTD PMID:15703175 BDKRB1 Human calcium(0) multiple interactions ISO RGD:620401 6480464 [kallidin, des-Arg(10)- binds to and results in increased activity of BDKRB1 protein] which results in more ... CTD PMID:22554775 BDKRB1 Human capsaicin multiple interactions ISO RGD:620401 6480464 Acetylcysteine inhibits the reaction [Capsaicin results in increased expression of BDKRB1 mRNA]; capsazepine inhibits the more ... CTD PMID:22264228 BDKRB1 Human capsaicin increases expression ISO RGD:620401 6480464 Capsaicin results in increased expression of BDKRB1 mRNA CTD PMID:22264228 BDKRB1 Human capsazepine multiple interactions ISO RGD:620401 6480464 capsazepine inhibits the reaction [Capsaicin results in increased expression of BDKRB1 mRNA] CTD PMID:22264228 BDKRB1 Human carbon nanotube increases expression ISO RGD:731358 6480464 Nanotubes, Carbon analog results in increased expression of BDKRB1 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 BDKRB1 Human ceruletide increases expression ISO RGD:731358 6480464 Ceruletide results in increased expression of BDKRB1 mRNA CTD PMID:21484880 BDKRB1 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to BDKRB1 gene] CTD PMID:28238834 BDKRB1 Human chlorpyrifos increases expression ISO RGD:731358 6480464 Chlorpyrifos results in increased expression of BDKRB1 mRNA CTD PMID:32715474 BDKRB1 Human chromium(6+) decreases expression EXP 6480464 chromium hexavalent ion results in decreased expression of BDKRB1 mRNA CTD PMID:30690063 BDKRB1 Human cisplatin increases expression ISO RGD:731358 6480464 Cisplatin results in increased expression of BDKRB1 protein CTD PMID:31874189 BDKRB1 Human corn oil multiple interactions ISO RGD:620401 6480464 Corn Oil inhibits the reaction [Glucose results in increased expression of BDKRB1 protein] CTD PMID:29165388 BDKRB1 Human crocidolite asbestos decreases expression EXP 6480464 Asbestos, Crocidolite results in decreased expression of BDKRB1 mRNA CTD PMID:24160326 BDKRB1 Human cyclophosphamide increases expression ISO RGD:620401 6480464 Cyclophosphamide results in increased expression of BDKRB1 mRNA CTD PMID:10498854|PMID:15576455 BDKRB1 Human D-glucose increases expression ISO RGD:620401 6480464 Glucose results in increased expression of BDKRB1 protein CTD PMID:29165388 BDKRB1 Human D-glucose multiple interactions ISO RGD:620401 6480464 argan oil inhibits the reaction [Glucose results in increased expression of BDKRB1 protein]; Corn Oil more ... CTD PMID:29165388 BDKRB1 Human DDE decreases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of BDKRB1 mRNA CTD PMID:38568856 BDKRB1 Human dexamethasone multiple interactions ISO RGD:620401 6480464 Dexamethasone inhibits the reaction [KNG1 protein binds to and results in increased activity of BDKRB1 more ... CTD PMID:11159707 BDKRB1 Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 BDKRB1 Human dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of BDKRB1 mRNA CTD PMID:25047013 BDKRB1 Human dexamethasone phosphate multiple interactions EXP 6480464 dexamethasone 21-phosphate inhibits the reaction [IL1B protein promotes the reaction [kallidin, des-Arg(10)- binds to BDKRB1 more ... CTD PMID:17931716 BDKRB1 Human dextran sulfate multiple interactions ISO RGD:731358 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of BDKRB1 more ... CTD PMID:29950665 BDKRB1 Human dioxygen multiple interactions ISO RGD:731358 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of BDKRB1 mRNA CTD PMID:30529165 BDKRB1 Human doxorubicin multiple interactions ISO RGD:731358 6480464 BDKRB1 protein affects the reaction [Doxorubicin results in decreased expression of BCL2 protein]; BDKRB1 protein more ... CTD PMID:18627295|PMID:37409694 BDKRB1 Human doxorubicin increases expression ISO RGD:731358 6480464 Doxorubicin results in increased expression of BDKRB1 mRNA CTD PMID:37409694 BDKRB1 Human enalapril increases expression ISO RGD:620401 6480464 Enalapril results in increased expression of BDKRB1 mRNA CTD PMID:18796534 BDKRB1 Human enalapril multiple interactions ISO RGD:620401 6480464 [kallidin, des-Arg(10)- results in decreased activity of BDKRB1 protein] which results in decreased susceptibility to more ... CTD PMID:21430409 BDKRB1 Human enalaprilat dihydrate increases activity EXP 6480464 Enalaprilat results in increased activity of BDKRB1 protein CTD PMID:11880373 BDKRB1 Human enalaprilat dihydrate multiple interactions EXP 6480464 bradykinin, Lys-Leu(8)-desArg(9)- inhibits the reaction [Enalaprilat results in increased activity of BDKRB1 protein]; Zinc affects more ... CTD PMID:11880373 BDKRB1 Human endosulfan decreases expression ISO RGD:620401 6480464 Endosulfan results in decreased expression of BDKRB1 mRNA CTD PMID:29391264 BDKRB1 Human epoxiconazole decreases expression ISO RGD:731358 6480464 epoxiconazole results in decreased expression of BDKRB1 mRNA CTD PMID:35436446 BDKRB1 Human fulvestrant multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of BDKRB1 gene CTD PMID:31601247 BDKRB1 Human furan increases expression ISO RGD:620401 6480464 furan results in increased expression of BDKRB1 mRNA CTD PMID:27387713 BDKRB1 Human gentamycin increases expression ISO RGD:620401 6480464 Gentamicins results in increased expression of BDKRB1 mRNA CTD PMID:33387578 BDKRB1 Human glucose increases expression ISO RGD:620401 6480464 Glucose results in increased expression of BDKRB1 protein CTD PMID:29165388 BDKRB1 Human glucose multiple interactions ISO RGD:620401 6480464 argan oil inhibits the reaction [Glucose results in increased expression of BDKRB1 protein]; Corn Oil more ... CTD PMID:29165388 BDKRB1 Human goralatide affects abundance ISO RGD:731358 6480464 BDKRB1 protein affects the abundance of goralatide CTD PMID:20096676 BDKRB1 Human goralatide multiple interactions ISO RGD:731358 6480464 [BDKRB1 protein affects the activity of ACE protein] which affects the hydrolysis of goralatide CTD PMID:20096676 BDKRB1 Human hydrochlorothiazide decreases expression ISO RGD:620401 6480464 Hydrochlorothiazide results in decreased expression of BDKRB1 mRNA CTD PMID:18796534 BDKRB1 Human indometacin multiple interactions ISO RGD:620401 6480464 Indomethacin inhibits the reaction [[kallidin, des-Arg(10)- binds to and results in increased activity of BDKRB1 more ... CTD PMID:22554775 BDKRB1 Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 BDKRB1 Human ketamine increases expression ISO RGD:731358 6480464 Ketamine results in increased expression of BDKRB1 mRNA; Ketamine results in increased expression of BDKRB1 more ... CTD PMID:27638051 BDKRB1 Human lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of BDKRB1 mRNA CTD PMID:38568856 BDKRB1 Human lipopolysaccharide affects response to substance ISO RGD:731358 6480464 BDKRB1 protein affects the susceptibility to Lipopolysaccharides CTD PMID:20096676 BDKRB1 Human lipopolysaccharide increases expression ISO RGD:731358 6480464 Lipopolysaccharides results in increased expression of BDKRB1 mRNA CTD PMID:29775649 BDKRB1 Human lipopolysaccharide multiple interactions ISO RGD:620401 6480464 ethyl 6-(N-(2-chloro-4-fluorophenyl)sulfamoyl)cyclohex-1-ene-1-carboxylate inhibits the reaction [Lipopolysaccharides results in increased expression of BDKRB1 protein] CTD PMID:29775649 BDKRB1 Human lipopolysaccharide affects expression ISO RGD:620401 6480464 Lipopolysaccharides affects the expression of BDKRB1 protein CTD PMID:29775649 BDKRB1 Human lipopolysaccharide multiple interactions EXP 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Lipopolysaccharides results in increased expression of BDKRB1 protein]; 4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)imidazole inhibits the more ... CTD PMID:29775649|PMID:35811015 BDKRB1 Human lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of BDKRB1 mRNA CTD PMID:29775649|PMID:35811015 BDKRB1 Human LY294002 multiple interactions EXP 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [IL1A protein results in increased expression of BDKRB1 protein]; 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits more ... CTD PMID:29775649 BDKRB1 Human medroxyprogesterone acetate decreases expression EXP 6480464 Medroxyprogesterone Acetate results in decreased expression of BDKRB1 mRNA CTD PMID:20843944 BDKRB1 Human meloxicam multiple interactions ISO RGD:620401 6480464 meloxicam inhibits the reaction [KNG1 protein binds to and results in increased activity of BDKRB1 more ... CTD PMID:11159707 BDKRB1 Human Methanandamide decreases activity EXP 6480464 methanandamide results in decreased activity of BDKRB1 protein CTD PMID:19022239 BDKRB1 Human Mitotane increases activity ISO RGD:620401 6480464 Mitotane results in increased activity of BDKRB1 protein CTD PMID:11159707 BDKRB1 Human N-acetyl-L-cysteine multiple interactions ISO RGD:620401 6480464 Acetylcysteine inhibits the reaction [Capsaicin results in increased expression of BDKRB1 mRNA] CTD PMID:22264228 BDKRB1 Human okadaic acid increases expression EXP 6480464 Okadaic Acid results in increased expression of BDKRB1 mRNA CTD PMID:38832940 BDKRB1 Human paracetamol affects expression ISO RGD:731358 6480464 Acetaminophen affects the expression of BDKRB1 mRNA CTD PMID:17562736 BDKRB1 Human paracetamol decreases expression ISO RGD:620401 6480464 Acetaminophen results in decreased expression of BDKRB1 mRNA CTD PMID:33387578 BDKRB1 Human perindopril affects expression ISO RGD:620401 6480464 Perindopril affects the expression of BDKRB1 protein CTD PMID:18806609 BDKRB1 Human phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of BDKRB1 mRNA CTD PMID:19084549 BDKRB1 Human potassium chromate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BDKRB1 mRNA CTD PMID:22079256 BDKRB1 Human potassium chromate decreases expression EXP 6480464 potassium chromate(VI) results in decreased expression of BDKRB1 mRNA CTD PMID:22079256|PMID:22714537 BDKRB1 Human progesterone multiple interactions EXP 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of BDKRB1 mRNA CTD PMID:17404688 BDKRB1 Human progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of BDKRB1 mRNA CTD PMID:17404688|PMID:20864642|PMID:21795739 BDKRB1 Human quercitrin decreases expression EXP 6480464 quercitrin results in decreased expression of BDKRB1 mRNA CTD PMID:25193878 BDKRB1 Human S-(1,2-dichlorovinyl)-L-cysteine multiple interactions EXP 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of BDKRB1 mRNA CTD PMID:35811015 BDKRB1 Human serpentine asbestos decreases expression EXP 6480464 Asbestos, Serpentine results in decreased expression of BDKRB1 mRNA CTD PMID:24160326 BDKRB1 Human silicon dioxide decreases expression EXP 6480464 Silicon Dioxide analog results in decreased expression of BDKRB1 mRNA CTD PMID:25895662 BDKRB1 Human silicon dioxide increases expression ISO RGD:731358 6480464 Silicon Dioxide results in increased expression of BDKRB1 mRNA CTD PMID:38811393 BDKRB1 Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of BDKRB1 mRNA CTD PMID:25351596 BDKRB1 Human silver atom decreases expression ISO RGD:731358 6480464 Silver results in decreased expression of BDKRB1 mRNA CTD PMID:27131904 BDKRB1 Human silver(0) decreases expression ISO RGD:731358 6480464 Silver results in decreased expression of BDKRB1 mRNA CTD PMID:27131904 BDKRB1 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of BDKRB1 mRNA CTD PMID:38568856 BDKRB1 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of BDKRB1 mRNA CTD PMID:34032870 BDKRB1 Human sodium atom multiple interactions EXP 6480464 Sodium affects the reaction [[kallidin, des-Arg(10)- results in increased activity of BDKRB1 protein] which results more ... CTD PMID:15703175 BDKRB1 Human streptozocin increases expression ISO RGD:731358 6480464 Streptozocin results in increased expression of BDKRB1 mRNA CTD PMID:19516248 BDKRB1 Human streptozocin multiple interactions ISO RGD:620401 6480464 [HOE 140, desArg(10)- binds to and results in decreased activity of BDKRB1 protein] which results more ... CTD PMID:17989505 BDKRB1 Human temozolomide decreases expression EXP 6480464 Temozolomide results in decreased expression of BDKRB1 mRNA CTD PMID:31758290 BDKRB1 Human testosterone multiple interactions EXP 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of BDKRB1 mRNA CTD PMID:21592394 BDKRB1 Human testosterone decreases expression EXP 6480464 Testosterone results in decreased expression of BDKRB1 mRNA CTD PMID:21592394 BDKRB1 Human tetrachloromethane decreases expression ISO RGD:620401 6480464 Carbon Tetrachloride results in decreased expression of BDKRB1 mRNA CTD PMID:16644059 BDKRB1 Human tetrachloromethane multiple interactions ISO RGD:731358 6480464 PPARD protein affects the reaction [Carbon Tetrachloride results in increased expression of BDKRB1 mRNA] CTD PMID:18038451 BDKRB1 Human tetrachloromethane increases expression ISO RGD:620401 6480464 Carbon Tetrachloride results in increased expression of BDKRB1 protein CTD PMID:18054572 BDKRB1 Human thalidomide multiple interactions ISO RGD:731358 6480464 Thalidomide inhibits the reaction [bradykinin, des-Arg(9)- results in increased expression of BDKRB1 protein] CTD PMID:16039549 BDKRB1 Human thiram increases expression EXP 6480464 Thiram results in increased expression of BDKRB1 mRNA CTD PMID:38568856 BDKRB1 Human titanium dioxide multiple interactions ISO RGD:731358 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of BDKRB1 more ... CTD PMID:29950665 BDKRB1 Human tributylstannane decreases expression ISO RGD:620401 6480464 tributyltin results in decreased expression of BDKRB1 mRNA CTD PMID:31129395 BDKRB1 Human trichloroethene increases expression ISO RGD:620401 6480464 Trichloroethylene results in increased expression of BDKRB1 mRNA CTD PMID:33387578 BDKRB1 Human triclosan increases expression EXP 6480464 Triclosan results in increased expression of BDKRB1 mRNA CTD PMID:30510588 BDKRB1 Human valsartan multiple interactions ISO RGD:620401 6480464 [bradykinin, Leu(8)-des-Arg(9)- results in decreased activity of BDKRB1 protein] inhibits the reaction [Valsartan results in more ... CTD PMID:16982965 BDKRB1 Human vincristine multiple interactions ISO RGD:620401 6480464 [HOE 140, desArg(10)- binds to and results in decreased activity of BDKRB1 protein] which results more ... CTD PMID:17989505 BDKRB1 Human zinc atom multiple interactions EXP 6480464 Zinc affects the reaction [Enalaprilat results in increased activity of BDKRB1 protein] CTD PMID:11880373 BDKRB1 Human zinc atom affects binding EXP 6480464 Zinc binds to BDKRB1 protein CTD PMID:11880373 BDKRB1 Human zinc(0) affects binding EXP 6480464 Zinc binds to BDKRB1 protein CTD PMID:11880373 BDKRB1 Human zinc(0) multiple interactions EXP 6480464 Zinc affects the reaction [Enalaprilat results in increased activity of BDKRB1 protein] CTD PMID:11880373
Imported Annotations - KEGG (archival)
(+)-pilocarpine (ISO) (-)-epigallocatechin 3-gallate (EXP) 1-naphthyl isothiocyanate (ISO) 15-acetyldeoxynivalenol (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3',5'-cyclic GMP (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) 4,4'-sulfonyldiphenol (EXP) 8-Br-cAMP (EXP) [des-Arg(9)]-bradykinin (ISO) Ac-Ser-Asp-Lys-Pro-OH (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP) AM-251 (EXP) ammonium chloride (ISO) anandamide (EXP) antirheumatic drug (EXP) arsenite(3-) (EXP) Azoxymethane (ISO) beclomethasone (EXP) benzo[a]pyrene (EXP) benzo[a]pyrene diol epoxide I (EXP) bisphenol A (EXP,ISO) calcitriol (EXP) calcium atom (EXP,ISO) calcium(0) (EXP,ISO) capsaicin (ISO) capsazepine (ISO) carbon nanotube (ISO) ceruletide (ISO) CGP 52608 (EXP) chlorpyrifos (ISO) chromium(6+) (EXP) cisplatin (ISO) corn oil (ISO) crocidolite asbestos (EXP) cyclophosphamide (ISO) D-glucose (ISO) DDE (EXP) dexamethasone (EXP,ISO) dexamethasone phosphate (EXP) dextran sulfate (ISO) dioxygen (ISO) doxorubicin (ISO) enalapril (ISO) enalaprilat dihydrate (EXP) endosulfan (ISO) epoxiconazole (ISO) fulvestrant (EXP) furan (ISO) gentamycin (ISO) glucose (ISO) goralatide (ISO) hydrochlorothiazide (ISO) indometacin (EXP,ISO) ketamine (ISO) lead diacetate (EXP) lipopolysaccharide (EXP,ISO) LY294002 (EXP) medroxyprogesterone acetate (EXP) meloxicam (ISO) Methanandamide (EXP) Mitotane (ISO) N-acetyl-L-cysteine (ISO) okadaic acid (EXP) paracetamol (ISO) perindopril (ISO) phenobarbital (EXP) potassium chromate (EXP) progesterone (EXP) quercitrin (EXP) S-(1,2-dichlorovinyl)-L-cysteine (EXP) serpentine asbestos (EXP) silicon dioxide (EXP,ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (EXP) sodium atom (EXP) streptozocin (ISO) temozolomide (EXP) testosterone (EXP) tetrachloromethane (ISO) thalidomide (ISO) thiram (EXP) titanium dioxide (ISO) tributylstannane (ISO) trichloroethene (ISO) triclosan (EXP) valsartan (ISO) vincristine (ISO) zinc atom (EXP) zinc(0) (EXP)
1.
Retinal plasma extravasation in streptozotocin-diabetic rats mediated by kinin B(1) and B(2) receptors.
Abdouh M, etal., Br J Pharmacol. 2008 May;154(1):136-43. Epub 2008 Mar 3.
2.
Leptin deficiency leads to the regulation of kinin receptors expression in mice.
Abe KC, etal., Regul Pept. 2007 Feb 1;138(2-3):56-8. Epub 2006 Dec 20.
3.
Characterization of two polymorphic sites in the human kinin B1 receptor gene: altered frequency of an allele in patients with a history of end-stage renal failure.
Bachvarov DR, etal., J Am Soc Nephrol. 1998 Apr;9(4):598-604.
4.
Antidiabetic efficacy of bradykinin antagonist R-954 on glucose tolerance test in diabetic type 1 mice.
Catanzaro OL, etal., Neuropeptides. 2010 Apr;44(2):187-9. doi: 10.1016/j.npep.2009.12.010. Epub 2010 Jan 21.
5.
Expression and function of bradykinin B1 and B2 receptors in normal and inflamed rat urinary bladder urothelium.
Chopra B, etal., J Physiol. 2005 Feb 1;562(Pt 3):859-71. Epub 2004 Dec 2.
6.
Up-regulation of functional kinin B1 receptors in allergic airway inflammation.
Christiansen SC, etal., J Immunol. 2002 Aug 15;169(4):2054-60.
7.
Sequence variation of bradykinin receptors B1 and B2 and association with hypertension.
Cui J, etal., J Hypertens. 2005 Jan;23(1):55-62.
8.
Gene expression of kinin receptors B1 and B2 in PBMC from patients with cardiac syndrome X.
Dabek J, etal., Scand Cardiovasc J. 2007 Dec;41(6):391-6.
9.
The kinin B1 receptor antagonist SSR240612 reverses tactile and cold allodynia in an experimental rat model of insulin resistance.
Dias JP, etal., Br J Pharmacol. 2007 Sep;152(2):280-7. Epub 2007 Jul 9.
10.
Genomic phenotype of non-cultured pulmonary fibroblasts in idiopathic pulmonary fibrosis.
Emblom-Callahan MC, etal., Genomics. 2010 Sep;96(3):134-45. Epub 2010 May 6.
11.
Regulation and function of spinal and peripheral neuronal B1 bradykinin receptors in inflammatory mechanical hyperalgesia.
Fox A, etal., Pain. 2003 Aug;104(3):683-91.
12.
Kinin B1 receptor antagonists inhibit diabetes-induced hyperalgesia in mice.
Gabra BH and Sirois P, Neuropeptides. 2003 Feb;37(1):36-44.
13.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
14.
The role of kinin B1 in the plasma extravasation of carrageenin-induced pleurisy.
Hayashi I, etal., Life Sci. 2002 Jan 11;70(8):937-49.
15.
Lack of both bradykinin B1 and B2 receptors enhances nephropathy, neuropathy, and bone mineral loss in Akita diabetic mice.
Kakoki M, etal., Proc Natl Acad Sci U S A. 2010 Jun 1;107(22):10190-5. doi: 10.1073/pnas.1005144107. Epub 2010 May 17.
16.
Delayed blockade of the kinin B1 receptor reduces renal inflammation and fibrosis in obstructive nephropathy.
Klein J, etal., FASEB J. 2009 Jan;23(1):134-42. doi: 10.1096/fj.08-115600. Epub 2008 Sep 22.
17.
Blockade of the kinin B1 receptor ameloriates glomerulonephritis.
Klein J, etal., J Am Soc Nephrol. 2010 Jul;21(7):1157-64. doi: 10.1681/ASN.2009090887. Epub 2010 May 6.
18.
G(-699)/C polymorphism in the bradykinin-1 receptor gene in patients with renal failure.
Knigge H, etal., Nephrol Dial Transplant. 2000 May;15(5):586-8.
19.
Effects of a selective bradykinin B1 receptor antagonist on increased plasma extravasation in streptozotocin-induced diabetic rats: distinct vasculopathic profile of major key organs.
Lawson SR, etal., Eur J Pharmacol. 2005 May 2;514(1):69-78. Epub 2005 Apr 21.
20.
International union of pharmacology. XLV. Classification of the kinin receptor family: from molecular mechanisms to pathophysiological consequences.
Leeb-Lundberg LM, etal., Pharmacol Rev. 2005 Mar;57(1):27-77.
21.
Involvement of kinin B1 receptor and oxidative stress in sensory abnormalities and arterial hypertension in an experimental rat model of insulin resistance.
Lungu C, etal., Neuropeptides. 2007 Dec;41(6):375-87. Epub 2007 Nov 7.
22.
The kallikrein-kinin system: current and future pharmacological targets.
Moreau ME, etal., J Pharmacol Sci. 2005 Sep;99(1):6-38.
23.
Tissue kallikrein and kinins in renal disease.
Naicker S, etal., Immunopharmacology. 1999 Oct 15;44(1-2):183-92.
24.
Overexpression of Kinin B1 Receptors Induces Hypertensive Response to Des-Arg9-bradykinin and Susceptibility to Inflammation.
Ni A, etal., J Biol Chem 2003 Jan 3;278(1):219-25.
25.
Autoradiographic analysis of rat brain kinin B1 and B2 receptors: normal distribution and alterations induced by epilepsy.
Ongali B, etal., J Comp Neurol 2003 Jul 7;461(4):506-19.
26.
Bradykinin receptor 1 activation exacerbates experimental focal and segmental glomerulosclerosis.
Pereira RL, etal., Kidney Int. 2011 Jun;79(11):1217-27. doi: 10.1038/ki.2011.14. Epub 2011 Mar 16.
27.
Role of kinin B1 and B2 receptors in a rat model of neuropathic pain.
Petcu M, etal., Int Immunopharmacol. 2008 Feb;8(2):188-96. Epub 2007 Sep 29.
28.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
29.
Kinin B1 and B2 receptor mRNA expression in the hypothalamus of spontaneously hypertensive rats.
Qadri F, etal., Can J Physiol Pharmacol 2002 Apr;80(4):258-63.
30.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
31.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
32.
Interactions between bradykinin (BK) and cell adhesion molecule (CAM) expression in peptidoglycan-polysaccharide (PG-PS)-induced arthritis.
Sainz IM, etal., FASEB J. 2004 May;18(7):887-9. Epub 2004 Mar 4.
33.
Regulation of cardiac bradykinin B1- and B2-receptor mRNA in experimental ischemic, diabetic, and pressure-overload-induced cardiomyopathy.
Spillmann F, etal., Int Immunopharmacol 2002 Dec;2(13-14):1823-32.
34.
Key role for spinal dorsal horn microglial kinin B1 receptor in early diabetic pain neuropathy.
Talbot S, etal., J Neuroinflammation. 2010 Jun 29;7(1):36.
35.
Up-regulation of kinin B1 receptor in the lung of streptozotocin-diabetic rat: autoradiographic and functional evidence.
Vianna RM, etal., Br J Pharmacol 2003 Jan;138(1):13-22.
36.
Bradykinin B1 receptor antagonism is beneficial in renal ischemia-reperfusion injury.
Wang PH, etal., PLoS One. 2008 Aug 25;3(8):e3050. doi: 10.1371/journal.pone.0003050.
BDKRB1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 96,256,210 - 96,264,763 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 96,256,210 - 96,268,967 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 96,722,547 - 96,731,100 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 95,792,312 - 95,800,853 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 95,792,311 - 95,800,851 NCBI Celera 14 76,778,278 - 76,786,817 (+) NCBI Celera Cytogenetic Map 14 q32.2 NCBI HuRef 14 76,907,652 - 76,916,201 (+) NCBI HuRef CHM1_1 14 96,661,476 - 96,670,026 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 90,487,459 - 90,496,013 (+) NCBI T2T-CHM13v2.0
Bdkrb1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 105,570,350 - 105,571,770 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 105,569,344 - 105,571,687 (+) Ensembl GRCm39 Ensembl GRCm38 12 105,604,091 - 105,605,511 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 105,603,085 - 105,605,428 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 106,842,301 - 106,843,638 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 106,005,141 - 106,006,478 (+) NCBI MGSCv36 mm8 Celera 12 106,838,703 - 106,840,040 (+) NCBI Celera Cytogenetic Map 12 E NCBI cM Map 12 55.81 NCBI
Bdkrb1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 130,275,631 - 130,284,968 (+) NCBI GRCr8 mRatBN7.2 6 124,510,827 - 124,514,475 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 124,510,870 - 124,513,747 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 124,632,115 - 124,634,531 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 124,927,381 - 124,929,797 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 124,288,772 - 124,291,188 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 129,437,423 - 129,441,553 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 129,438,158 - 129,440,574 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 138,631,450 - 138,633,866 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 129,760,129 - 129,762,545 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 129,763,875 - 129,766,292 (+) NCBI Celera 6 122,077,962 - 122,080,378 (+) NCBI Celera RH 3.4 Map 6 821.1 RGD Cytogenetic Map 6 q32 NCBI
Bdkrb1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955438 16,500,633 - 16,501,691 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955438 16,500,219 - 16,505,394 (-) NCBI ChiLan1.0 ChiLan1.0
BDKRB1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 97,412,576 - 97,424,766 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 96,629,081 - 96,641,330 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 76,885,923 - 76,894,456 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 96,208,312 - 96,221,049 (+) NCBI panpan1.1 PanPan1.1 panPan2
BDKRB1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 65,017,655 - 65,028,899 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 64,541,610 - 64,542,662 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 65,289,047 - 65,301,253 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 65,297,113 - 65,298,165 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 64,970,187 - 64,971,239 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 65,031,504 - 65,032,556 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 65,355,171 - 65,356,223 (+) NCBI UU_Cfam_GSD_1.0
Bdkrb1
BDKRB1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 117,491,350 - 117,492,410 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 117,491,350 - 117,492,410 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 124,701,695 - 124,749,780 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BDKRB1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 74,136,464 - 74,146,668 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 74,145,531 - 74,146,592 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 61,287,030 - 61,297,919 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bdkrb1
.
Predicted Target Of
Count of predictions: 500 Count of miRNA genes: 391 Interacting mature miRNAs: 419 Transcripts: ENST00000216629, ENST00000553356, ENST00000557122 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
RH17999
Human Assembly Chr Position (strand) Source JBrowse GRCh37 14 96,730,837 - 96,730,997 UniSTS GRCh37 Build 36 14 95,800,590 - 95,800,750 RGD NCBI36 Celera 14 76,786,554 - 76,786,714 RGD Cytogenetic Map 14 q32.1-q32.2 UniSTS HuRef 14 76,915,938 - 76,916,098 UniSTS GeneMap99-GB4 RH Map 14 261.84 UniSTS
BDKRB1
Human Assembly Chr Position (strand) Source JBrowse GRCh37 14 96,731,007 - 96,731,078 UniSTS GRCh37 Build 36 14 95,800,760 - 95,800,831 RGD NCBI36 Celera 14 76,786,724 - 76,786,795 RGD HuRef 14 76,916,108 - 76,916,179 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1203
2405
2533
2027
4572
1629
2195
4
552
875
394
2173
5726
5180
30
3445
813
1659
1531
169
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000216629 ⟹ ENSP00000216629
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 14 96,256,210 - 96,264,763 (+) Ensembl
Ensembl Acc Id:
ENST00000553356 ⟹ ENSP00000452064
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 14 96,256,210 - 96,268,967 (+) Ensembl
Ensembl Acc Id:
ENST00000557122
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 14 96,264,826 - 96,268,455 (+) Ensembl
Ensembl Acc Id:
ENST00000611804 ⟹ ENSP00000479276
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 14 96,263,670 - 96,264,754 (+) Ensembl
RefSeq Acc Id:
NM_000710 ⟹ NP_000701
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 14 96,256,210 - 96,264,763 (+) NCBI GRCh37 14 96,721,641 - 96,735,304 (+) NCBI Build 36 14 95,792,312 - 95,800,853 (+) NCBI Archive HuRef 14 76,907,652 - 76,916,201 (+) NCBI CHM1_1 14 96,661,476 - 96,670,026 (+) NCBI T2T-CHM13v2.0 14 90,487,459 - 90,496,013 (+) NCBI
Sequence:
AGCACTTCCCAGAAGAGAAAACTCCTCCAAAAGCAGCTCTCACTATCAGAAAACCCAACTACAGTTGTGAACGCCTTCATTTTCTGCCTGAGGTCTCAGTCCGTCGGCCCAGACTGAAGTGCAGTGGC
hide sequence
RefSeq Acc Id:
NM_001386007 ⟹ NP_001372936
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 14 96,256,210 - 96,264,763 (+) NCBI T2T-CHM13v2.0 14 90,487,459 - 90,496,013 (+) NCBI
Sequence:
AGCACTTCCCAGAAGAGAAAACTCCTCCAAAAGCAGCTCTCACTATCAGAAAACCCAACTACAG
hide sequence
RefSeq Acc Id:
NP_000701 ⟸ NM_000710
- UniProtKB:
Q546S7 (UniProtKB/Swiss-Prot), A8K7F5 (UniProtKB/Swiss-Prot), Q8N0Y8 (UniProtKB/Swiss-Prot), P46663 (UniProtKB/Swiss-Prot), A0A075E6Y0 (UniProtKB/TrEMBL)
- Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLLVFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKANLFISIFLV
hide sequence
Ensembl Acc Id:
ENSP00000216629 ⟸ ENST00000216629
Ensembl Acc Id:
ENSP00000479276 ⟸ ENST00000611804
Ensembl Acc Id:
ENSP00000452064 ⟸ ENST00000553356
RefSeq Acc Id:
NP_001372936 ⟸ NM_001386007
- UniProtKB:
Q546S7 (UniProtKB/Swiss-Prot), P46663 (UniProtKB/Swiss-Prot), A8K7F5 (UniProtKB/Swiss-Prot), Q8N0Y8 (UniProtKB/Swiss-Prot), A0A075E6Y0 (UniProtKB/TrEMBL)
RGD ID: 7228587 Promoter ID: EPDNEW_H20039 Type: initiation region Name: BDKRB1_1 Description: bradykinin receptor B1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H20031 EPDNEW_H20040 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 14 96,256,210 - 96,256,270 EPDNEW
RGD ID: 7228589 Promoter ID: EPDNEW_H20040 Type: initiation region Name: BDKRB1_3 Description: bradykinin receptor B1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H20031 EPDNEW_H20039 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 14 96,262,564 - 96,262,624 EPDNEW
