Symbol:
Prdx5
Name:
peroxiredoxin 5
RGD ID:
71007
Description:
Predicted to enable several functions, including cysteine-type endopeptidase inhibitor activity involved in apoptotic process; identical protein binding activity; and peroxidase activity. Predicted to be involved in several processes, including cell redox homeostasis; negative regulation of transcription by RNA polymerase III; and regulation of apoptotic process. Located in mitochondrion and peroxisome. Orthologous to human PRDX5 (peroxiredoxin 5); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3-bis(4-hydroxyphenyl)propionitrile.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
antioxidant enzyme B166; Aoeb166; peroxiredoxin V; peroxiredoxin-5, mitochondrial; peroxisomal antioxidant enzyme; PLP; prx-V; thioredoxin peroxidase PMP20; thioredoxin reductase; thioredoxin-dependent peroxiredoxin 5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRDX5 (peroxiredoxin 5) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Prdx5 (peroxiredoxin 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prdx5 (peroxiredoxin 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRDX5 (peroxiredoxin 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRDX5 (peroxiredoxin 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prdx5 (peroxiredoxin 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRDX5 (peroxiredoxin 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRDX5 (peroxiredoxin 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prdx5 (peroxiredoxin 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CYFIP2 (cytoplasmic FMR1 interacting protein 2) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Prdx5 (peroxiredoxin 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PRDX5 (peroxiredoxin 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prdx5 (peroxiredoxin 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
AHP1
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
Prx5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prdx5
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 213,529,042 - 213,532,787 (-) NCBI GRCr8 mRatBN7.2 1 204,099,826 - 204,103,589 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 204,099,826 - 204,114,268 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 212,450,032 - 212,453,015 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 219,545,095 - 219,548,082 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 212,236,145 - 212,239,134 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 222,164,462 - 222,167,447 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 222,164,462 - 222,167,447 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 229,155,316 - 229,158,301 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 209,583,414 - 209,586,399 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 209,741,843 - 209,744,829 (-) NCBI Celera 1 201,633,781 - 201,636,766 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prdx5 Rat (1->4)-beta-D-glucan multiple interactions ISO Prdx5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRDX5 mRNA CTD PMID:36331819 Prdx5 Rat 17beta-estradiol multiple interactions EXP 6480464 [Medroxyprogesterone Acetate co-treated with Estradiol] affects the expression of PRDX5 CTD PMID:21159850 Prdx5 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PRDX5 protein CTD PMID:22070562 Prdx5 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO PRDX5 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Prdx5 Rat 2,2'-Methylenebis(4-methyl-6-tert-butylphenol) multiple interactions ISO PRDX5 (Homo sapiens) 6480464 [CYP3A4 protein affects the susceptibility to 2 and 2'-methylenebis(4-methyl-6-tert-butylphenol)] which affects the expression of PRDX5 mRNA CTD PMID:38160208 Prdx5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRDX5 mRNA CTD PMID:21215274 Prdx5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PRDX5 mRNA CTD PMID:33387578 Prdx5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PRDX5 mRNA CTD PMID:34747641 Prdx5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Prdx5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PRDX5 mRNA CTD PMID:21570461 and PMID:24680724 Prdx5 Rat 2,3-bis(4-hydroxyphenyl)propionitrile increases expression EXP 6480464 2 and 3-bis(4-hydroxyphenyl)-propionitrile results in increased expression of PRDX5 protein CTD PMID:22070562 Prdx5 Rat 2,4,6-tribromophenol decreases expression ISO PRDX5 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Prdx5 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Prdx5 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Prdx5 Rat 2,6-dimethoxyphenol multiple interactions ISO PRDX5 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of PRDX5 protein CTD PMID:38598786 Prdx5 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO PRDX5 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of PRDX5 protein CTD PMID:31675489 Prdx5 Rat 4,4'-sulfonyldiphenol increases expression ISO Prdx5 (Mus musculus) 6480464 bisphenol S results in increased expression of PRDX5 mRNA CTD PMID:39298647 Prdx5 Rat 5-aza-2'-deoxycytidine increases expression ISO PRDX5 (Homo sapiens) 6480464 Decitabine results in increased expression of PRDX5 mRNA CTD PMID:20231622 Prdx5 Rat 5-aza-2'-deoxycytidine affects expression ISO PRDX5 (Homo sapiens) 6480464 Decitabine affects the expression of PRDX5 mRNA CTD PMID:23300844 Prdx5 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PRDX5 mRNA CTD PMID:31881176 Prdx5 Rat actinomycin D multiple interactions ISO PRDX5 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PRDX5 protein CTD PMID:38460933 Prdx5 Rat all-trans-retinoic acid increases expression ISO PRDX5 (Homo sapiens) 6480464 Tretinoin results in increased expression of PRDX5 mRNA CTD PMID:33167477 Prdx5 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PRDX5 mRNA CTD PMID:30047161 Prdx5 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRDX5 mRNA CTD PMID:16483693 Prdx5 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PRDX5 mRNA CTD PMID:30779732 Prdx5 Rat antirheumatic drug increases expression ISO PRDX5 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PRDX5 mRNA CTD PMID:24449571 Prdx5 Rat arsane increases expression ISO PRDX5 (Homo sapiens) 6480464 Arsenic results in increased expression of PRDX5 protein CTD PMID:19818359 Prdx5 Rat arsenic atom increases expression ISO PRDX5 (Homo sapiens) 6480464 Arsenic results in increased expression of PRDX5 protein CTD PMID:19818359 Prdx5 Rat arsenite(3-) multiple interactions ISO PRDX5 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to PRDX5 mRNA] CTD PMID:32406909 Prdx5 Rat arsenous acid increases expression ISO PRDX5 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PRDX5 mRNA CTD PMID:25258189 Prdx5 Rat aspartame multiple interactions ISO Prdx5 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Prdx5 Rat benzo[a]pyrene increases expression ISO Prdx5 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PRDX5 mRNA CTD PMID:22228805 Prdx5 Rat benzo[a]pyrene decreases methylation ISO PRDX5 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PRDX5 3' UTR CTD PMID:27901495 Prdx5 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Prdx5 (Mus musculus) 6480464 PRDX5 protein inhibits the reaction [Diethylhexyl Phthalate affects the localization of DNM1L protein] more ... CTD PMID:31408635 Prdx5 Rat bis(2-ethylhexyl) phthalate increases expression ISO Prdx5 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PRDX5 mRNA and Diethylhexyl Phthalate results in increased expression of PRDX5 protein CTD PMID:31408635 and PMID:34319233 Prdx5 Rat bisphenol A increases expression ISO Prdx5 (Mus musculus) 6480464 bisphenol A results in increased expression of PRDX5 mRNA and bisphenol A results in increased expression of PRDX5 protein CTD PMID:25772901 and PMID:32156529 Prdx5 Rat bisphenol A decreases expression ISO Prdx5 (Mus musculus) 6480464 bisphenol A results in decreased expression of PRDX5 protein CTD PMID:35999755 Prdx5 Rat bisphenol A increases expression ISO PRDX5 (Homo sapiens) 6480464 bisphenol A results in increased expression of PRDX5 protein CTD PMID:34186270 and PMID:37567409 Prdx5 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRDX5 mRNA CTD PMID:34947998 Prdx5 Rat bisphenol A decreases expression ISO PRDX5 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PRDX5 mRNA and bisphenol A results in decreased expression of PRDX5 protein CTD PMID:31675489 and PMID:33670352 Prdx5 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PRDX5 mRNA CTD PMID:25181051 Prdx5 Rat bisphenol AF increases expression ISO PRDX5 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PRDX5 protein CTD PMID:34186270 Prdx5 Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of PRDX5 mRNA CTD PMID:24136188 Prdx5 Rat carbamazepine affects expression ISO PRDX5 (Homo sapiens) 6480464 Carbamazepine affects the expression of PRDX5 mRNA CTD PMID:25979313 Prdx5 Rat carbon nanotube decreases expression ISO PRDX5 (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased expression of PRDX5 protein CTD PMID:22157353 Prdx5 Rat carbon nanotube affects expression EXP 6480464 Nanotubes and Carbon affects the expression of PRDX5 mRNA CTD PMID:19836432 Prdx5 Rat carbon nanotube increases expression ISO Prdx5 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Prdx5 Rat cerium trichloride multiple interactions ISO PRDX5 (Homo sapiens) 6480464 [cerous chloride co-treated with lanthanum chloride] results in increased expression of PRDX5 mRNA CTD PMID:28954213 Prdx5 Rat chloropicrin affects expression ISO PRDX5 (Homo sapiens) 6480464 chloropicrin affects the expression of PRDX5 mRNA CTD PMID:26352163 Prdx5 Rat chlorpyrifos increases expression ISO Prdx5 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PRDX5 mRNA CTD PMID:37019170 Prdx5 Rat choline multiple interactions ISO Prdx5 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PRDX5 gene CTD PMID:20938992 Prdx5 Rat cis-caffeic acid multiple interactions ISO PRDX5 (Homo sapiens) 6480464 caffeic acid promotes the reaction [Thapsigargin results in decreased expression of PRDX5 mRNA] CTD PMID:19442820 Prdx5 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of PRDX5 protein CTD PMID:22023808 Prdx5 Rat cisplatin affects expression ISO PRDX5 (Homo sapiens) 6480464 Cisplatin affects the expression of PRDX5 mRNA CTD PMID:23300844 Prdx5 Rat clobetasol increases expression ISO Prdx5 (Mus musculus) 6480464 Clobetasol results in increased expression of PRDX5 mRNA CTD PMID:27462272 Prdx5 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of PRDX5 mRNA CTD PMID:17602206 Prdx5 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of PRDX5 mRNA CTD PMID:24386269 Prdx5 Rat cocaine affects expression ISO PRDX5 (Homo sapiens) 6480464 Cocaine affects the expression of PRDX5 protein CTD PMID:19393250 Prdx5 Rat curcumin multiple interactions ISO PRDX5 (Homo sapiens) 6480464 Curcumin inhibits the reaction [Hypochlorous Acid results in decreased activity of PRDX5 protein] CTD PMID:36924976 Prdx5 Rat cyclosporin A decreases expression ISO PRDX5 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PRDX5 mRNA CTD PMID:25562108 Prdx5 Rat cyfluthrin decreases expression ISO PRDX5 (Homo sapiens) 6480464 cyfluthrin results in decreased expression of PRDX5 mRNA CTD PMID:31330490 Prdx5 Rat cypermethrin increases expression ISO Prdx5 (Mus musculus) 6480464 cypermethrin results in increased expression of PRDX5 mRNA CTD PMID:21142847 Prdx5 Rat decabromodiphenyl ether decreases expression ISO PRDX5 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of PRDX5 protein CTD PMID:31675489 Prdx5 Rat diarsenic trioxide increases expression ISO PRDX5 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PRDX5 mRNA CTD PMID:25258189 Prdx5 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PRDX5 mRNA CTD PMID:21266533 Prdx5 Rat disodium selenite increases expression ISO PRDX5 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of PRDX5 mRNA CTD PMID:18175754 Prdx5 Rat dorsomorphin multiple interactions ISO PRDX5 (Homo sapiens) 6480464 dorsomorphin inhibits the reaction [[Air Pollutants results in increased abundance of Particulate Matter] which results in increased expression of PRDX5 protein] CTD PMID:29753072 Prdx5 Rat dorsomorphin multiple interactions EXP 6480464 [dorsomorphin co-treated with [Air Pollutants results in increased abundance of Particulate Matter]] results in decreased expression of PRDX5 protein CTD PMID:29753072 Prdx5 Rat doxorubicin increases expression ISO Prdx5 (Mus musculus) 6480464 Doxorubicin results in increased expression of PRDX5 mRNA and Doxorubicin results in increased expression of PRDX5 protein CTD PMID:21463615 Prdx5 Rat doxorubicin multiple interactions EXP 6480464 SIRT6 protein inhibits the reaction [Doxorubicin results in decreased expression of PRDX5 mRNA] CTD PMID:34713381 Prdx5 Rat doxorubicin increases expression ISO PRDX5 (Homo sapiens) 6480464 Doxorubicin results in increased expression of PRDX5 mRNA CTD PMID:29803840 Prdx5 Rat doxorubicin decreases expression ISO Prdx5 (Mus musculus) 6480464 Doxorubicin results in decreased expression of PRDX5 protein CTD PMID:21251210 Prdx5 Rat doxorubicin multiple interactions ISO Prdx5 (Mus musculus) 6480464 MT1 affects the reaction [Doxorubicin results in increased expression of PRDX5 mRNA] more ... CTD PMID:21251210 more ... Prdx5 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PRDX5 mRNA CTD PMID:29391264 Prdx5 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PRDX5 mRNA CTD PMID:18035473 Prdx5 Rat folic acid multiple interactions ISO Prdx5 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PRDX5 gene CTD PMID:20938992 Prdx5 Rat furfural multiple interactions ISO PRDX5 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PRDX5 protein CTD PMID:38598786 Prdx5 Rat graphite increases expression ISO PRDX5 (Homo sapiens) 6480464 Graphite results in increased expression of PRDX5 protein CTD PMID:22157353 Prdx5 Rat herbicide multiple interactions ISO Prdx5 (Mus musculus) 6480464 [arginyl-2 more ... CTD PMID:21318024 Prdx5 Rat herbicide increases expression ISO Prdx5 (Mus musculus) 6480464 Herbicides results in increased expression of PRDX5 mRNA CTD PMID:21318024 Prdx5 Rat herbicide decreases expression ISO Prdx5 (Mus musculus) 6480464 Herbicides results in decreased expression of PRDX5 mRNA CTD PMID:21318024 Prdx5 Rat hydrogen peroxide increases expression ISO Prdx5 (Mus musculus) 6480464 Hydrogen Peroxide results in increased expression of PRDX5 mRNA CTD PMID:14729362 Prdx5 Rat hydrogen peroxide affects response to substance ISO PRDX5 (Homo sapiens) 6480464 PRDX5 protein affects the susceptibility to Hydrogen Peroxide CTD PMID:21051700 Prdx5 Rat hypochlorous acid decreases activity ISO PRDX5 (Homo sapiens) 6480464 Hypochlorous Acid results in decreased activity of PRDX5 protein CTD PMID:36924976 Prdx5 Rat hypochlorous acid multiple interactions ISO PRDX5 (Homo sapiens) 6480464 Curcumin inhibits the reaction [Hypochlorous Acid results in decreased activity of PRDX5 protein] CTD PMID:36924976 Prdx5 Rat ivermectin decreases expression ISO PRDX5 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PRDX5 protein CTD PMID:32959892 Prdx5 Rat L-methionine multiple interactions ISO Prdx5 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PRDX5 gene CTD PMID:20938992 Prdx5 Rat lanthanum trichloride multiple interactions ISO PRDX5 (Homo sapiens) 6480464 [cerous chloride co-treated with lanthanum chloride] results in increased expression of PRDX5 mRNA CTD PMID:28954213 Prdx5 Rat lipopolysaccharide multiple interactions ISO PRDX5 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of PRDX5 mRNA CTD PMID:31059760 Prdx5 Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of PRDX5 protein CTD PMID:18296634 Prdx5 Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of PRDX5 protein CTD PMID:18296634 Prdx5 Rat lutein decreases expression ISO Prdx5 (Mus musculus) 6480464 Lutein results in decreased expression of PRDX5 mRNA CTD PMID:24865317 Prdx5 Rat medroxyprogesterone acetate affects expression EXP 6480464 Medroxyprogesterone Acetate affects the expression of PRDX5 CTD PMID:21159850 Prdx5 Rat medroxyprogesterone acetate multiple interactions EXP 6480464 [Medroxyprogesterone Acetate co-treated with Estradiol] affects the expression of PRDX5 CTD PMID:21159850 Prdx5 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of PRDX5 mRNA CTD PMID:19149911 Prdx5 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PRDX5 mRNA CTD PMID:30047161 Prdx5 Rat monosodium L-glutamate multiple interactions ISO Prdx5 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Prdx5 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PRDX5 mRNA CTD PMID:28659758 Prdx5 Rat N-acetyl-beta-D-glucosamine increases expression ISO PRDX5 (Homo sapiens) 6480464 Acetylglucosamine results in increased expression of PRDX5 mRNA CTD PMID:18047607 Prdx5 Rat N-acetyl-D-glucosamine increases expression ISO PRDX5 (Homo sapiens) 6480464 Acetylglucosamine results in increased expression of PRDX5 mRNA CTD PMID:18047607 Prdx5 Rat N-acetyl-L-cysteine multiple interactions ISO Prdx5 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [PRKAA2 protein affects the reaction [[Air Pollutants results in increased abundance of Particulate Matter] which results in decreased expression of PRDX5 protein]] CTD PMID:29753072 Prdx5 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PRDX5 protein CTD PMID:20600802 Prdx5 Rat N-methyl-4-phenylpyridinium affects response to substance ISO PRDX5 (Homo sapiens) 6480464 PRDX5 protein affects the susceptibility to 1-Methyl-4-phenylpyridinium CTD PMID:18262354 Prdx5 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of PRDX5 protein CTD PMID:19716841 Prdx5 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PRDX5 mRNA CTD PMID:24136188 Prdx5 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PRDX5 mRNA CTD PMID:24136188 Prdx5 Rat nitrates multiple interactions ISO Prdx5 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PRDX5 mRNA CTD PMID:35964746 Prdx5 Rat Nutlin-3 multiple interactions ISO PRDX5 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PRDX5 protein CTD PMID:38460933 Prdx5 Rat okadaic acid multiple interactions ISO PRDX5 (Homo sapiens) 6480464 [Okadaic Acid co-treated with gambierol] results in decreased expression of PRDX5 protein CTD PMID:19397276 Prdx5 Rat okadaic acid decreases expression ISO PRDX5 (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of PRDX5 protein CTD PMID:19397276 Prdx5 Rat p-menthan-3-ol decreases expression ISO PRDX5 (Homo sapiens) 6480464 Menthol results in decreased expression of PRDX5 mRNA CTD PMID:26760959 Prdx5 Rat paracetamol decreases expression ISO PRDX5 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PRDX5 mRNA CTD PMID:25704631 Prdx5 Rat paracetamol decreases expression ISO Prdx5 (Mus musculus) 6480464 Acetaminophen results in decreased expression of PRDX5 mRNA CTD PMID:34390818 Prdx5 Rat paracetamol increases secretion ISO Prdx5 (Mus musculus) 6480464 Acetaminophen results in increased secretion of PRDX5 protein CTD PMID:24038040 Prdx5 Rat paracetamol multiple interactions ISO PRDX5 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of PRDX5 mRNA CTD PMID:31059760 Prdx5 Rat paraquat multiple interactions ISO PRDX5 (Homo sapiens) 6480464 [Quercetin co-treated with Paraquat] results in increased expression of PRDX5 mRNA CTD PMID:22996356 Prdx5 Rat paraquat increases expression ISO PRDX5 (Homo sapiens) 6480464 Paraquat results in increased expression of PRDX5 mRNA CTD PMID:22996356 Prdx5 Rat perfluorooctane-1-sulfonic acid decreases expression ISO Prdx5 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of PRDX5 protein CTD PMID:26178269 Prdx5 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Prdx5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRDX5 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of PRDX5 mRNA CTD PMID:36331819 Prdx5 Rat perfluorooctanoic acid increases expression ISO Prdx5 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of PRDX5 protein CTD PMID:37422089 Prdx5 Rat permethrin multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PRDX5 mRNA CTD PMID:28659758 Prdx5 Rat phlorizin decreases expression ISO Prdx5 (Mus musculus) 6480464 Phlorhizin results in decreased expression of PRDX5 mRNA CTD PMID:22538082 Prdx5 Rat picloram decreases expression ISO Prdx5 (Mus musculus) 6480464 Picloram results in decreased expression of PRDX5 mRNA CTD PMID:21318024 Prdx5 Rat picloram multiple interactions ISO Prdx5 (Mus musculus) 6480464 arginyl-2 and '6'-dimethyltyrosyl-lysyl-phenylalaninamide inhibits the reaction [Picloram results in decreased expression of PRDX5 mRNA] CTD PMID:21318024 Prdx5 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of PRDX5 mRNA CTD PMID:30047161 Prdx5 Rat Pyridostigmine bromide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PRDX5 mRNA CTD PMID:28659758 Prdx5 Rat quartz affects expression EXP 6480464 Quartz affects the expression of PRDX5 mRNA CTD PMID:19836432 Prdx5 Rat quercetin multiple interactions ISO Prdx5 (Mus musculus) 6480464 Quercetin inhibits the reaction [Carbon Tetrachloride results in decreased expression of PRDX5 mRNA] CTD PMID:25471833 Prdx5 Rat quercetin multiple interactions ISO PRDX5 (Homo sapiens) 6480464 [Quercetin co-treated with Paraquat] results in increased expression of PRDX5 mRNA CTD PMID:22996356 Prdx5 Rat quercetin increases expression ISO PRDX5 (Homo sapiens) 6480464 Quercetin results in increased expression of PRDX5 mRNA and Quercetin results in increased expression of PRDX5 protein CTD PMID:21051700 and PMID:22996356 Prdx5 Rat silver atom decreases expression ISO Prdx5 (Mus musculus) 6480464 Silver results in decreased expression of PRDX5 mRNA CTD PMID:22576574 Prdx5 Rat silver(0) decreases expression ISO Prdx5 (Mus musculus) 6480464 Silver results in decreased expression of PRDX5 mRNA CTD PMID:22576574 Prdx5 Rat sodium arsenite increases expression ISO Prdx5 (Mus musculus) 6480464 sodium arsenite results in increased expression of PRDX5 protein CTD PMID:29044176 Prdx5 Rat sodium arsenite increases expression ISO PRDX5 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PRDX5 mRNA CTD PMID:38568856 Prdx5 Rat sodium chloride multiple interactions ISO PRDX5 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PRDX5 protein more ... CTD PMID:38598786 Prdx5 Rat sodium nitrate multiple interactions ISO Prdx5 (Mus musculus) 6480464 sodium nitrate inhibits the reaction [Doxorubicin results in decreased expression of PRDX5 protein] CTD PMID:21251210 Prdx5 Rat sodium nitrate increases expression ISO Prdx5 (Mus musculus) 6480464 sodium nitrate results in increased expression of PRDX5 protein CTD PMID:22484629 Prdx5 Rat streptozocin decreases expression ISO Prdx5 (Mus musculus) 6480464 Streptozocin results in decreased expression of PRDX5 mRNA CTD PMID:20446767 Prdx5 Rat streptozocin multiple interactions ISO PRDX5 (Homo sapiens) 6480464 PRDX4 protein inhibits the reaction [Streptozocin results in decreased expression of PRDX5 mRNA] CTD PMID:20446767 Prdx5 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PRDX5 mRNA CTD PMID:30047161 Prdx5 Rat temozolomide decreases expression ISO PRDX5 (Homo sapiens) 6480464 Temozolomide results in decreased expression of PRDX5 mRNA CTD PMID:31758290 Prdx5 Rat tert-butyl hydroperoxide increases expression ISO Prdx5 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of PRDX5 mRNA CTD PMID:14729362 Prdx5 Rat tetrachloroethene decreases expression ISO Prdx5 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of PRDX5 mRNA CTD PMID:28973375 Prdx5 Rat tetrachloromethane decreases expression ISO Prdx5 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PRDX5 mRNA CTD PMID:25471833 Prdx5 Rat tetrachloromethane multiple interactions ISO Prdx5 (Mus musculus) 6480464 Quercetin inhibits the reaction [Carbon Tetrachloride results in decreased expression of PRDX5 mRNA] CTD PMID:25471833 Prdx5 Rat thapsigargin multiple interactions ISO PRDX5 (Homo sapiens) 6480464 4-methoxycinnamate methyl ester promotes the reaction [Thapsigargin results in decreased expression of PRDX5 mRNA] more ... CTD PMID:19442820 Prdx5 Rat thapsigargin increases expression ISO PRDX5 (Homo sapiens) 6480464 Thapsigargin results in increased expression of PRDX5 mRNA CTD PMID:22378314 Prdx5 Rat thapsigargin decreases expression ISO PRDX5 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of PRDX5 mRNA CTD PMID:19442820 Prdx5 Rat titanium dioxide increases expression ISO PRDX5 (Homo sapiens) 6480464 titanium dioxide results in increased expression of PRDX5 protein CTD PMID:30910687 Prdx5 Rat titanium dioxide decreases methylation ISO Prdx5 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PRDX5 gene CTD PMID:35295148 Prdx5 Rat toluene affects expression EXP 6480464 Toluene affects the expression of PRDX5 mRNA CTD PMID:21827849 Prdx5 Rat trans-caffeic acid multiple interactions ISO PRDX5 (Homo sapiens) 6480464 caffeic acid promotes the reaction [Thapsigargin results in decreased expression of PRDX5 mRNA] CTD PMID:19442820 Prdx5 Rat trichlopyr increases expression ISO Prdx5 (Mus musculus) 6480464 triclopyr results in increased expression of PRDX5 mRNA CTD PMID:21318024 Prdx5 Rat trichlopyr multiple interactions ISO Prdx5 (Mus musculus) 6480464 [arginyl-2 and '6'-dimethyltyrosyl-lysyl-phenylalaninamide co-treated with triclopyr] results in increased expression of PRDX5 mRNA CTD PMID:21318024 Prdx5 Rat trichloroethene decreases expression ISO Prdx5 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of PRDX5 mRNA CTD PMID:28973375 Prdx5 Rat triphenyl phosphate affects expression ISO PRDX5 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PRDX5 mRNA CTD PMID:37042841 Prdx5 Rat tunicamycin increases expression ISO PRDX5 (Homo sapiens) 6480464 Tunicamycin results in increased expression of PRDX5 mRNA CTD PMID:22378314 Prdx5 Rat valproic acid affects expression ISO PRDX5 (Homo sapiens) 6480464 Valproic Acid affects the expression of PRDX5 mRNA CTD PMID:25979313 Prdx5 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PRDX5 mRNA CTD PMID:23555832 Prdx5 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of PRDX5 mRNA CTD PMID:22570695 Prdx5 Rat vorinostat increases expression ISO PRDX5 (Homo sapiens) 6480464 vorinostat results in increased expression of PRDX5 protein CTD PMID:20543569
(1->4)-beta-D-glucan (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3-bis(4-hydroxyphenyl)propionitrile (EXP) 2,4,6-tribromophenol (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dimethoxyphenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) acetamide (EXP) actinomycin D (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) aspartame (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) buspirone (EXP) carbamazepine (ISO) carbon nanotube (EXP,ISO) cerium trichloride (ISO) chloropicrin (ISO) chlorpyrifos (ISO) choline (ISO) cis-caffeic acid (ISO) cisplatin (EXP,ISO) clobetasol (ISO) clofibric acid (EXP) cobalt dichloride (EXP) cocaine (ISO) curcumin (ISO) cyclosporin A (ISO) cyfluthrin (ISO) cypermethrin (ISO) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) disodium selenite (ISO) dorsomorphin (EXP,ISO) doxorubicin (EXP,ISO) endosulfan (EXP) flavonoids (EXP) folic acid (ISO) furfural (ISO) graphite (ISO) herbicide (ISO) hydrogen peroxide (ISO) hypochlorous acid (ISO) ivermectin (ISO) L-methionine (ISO) lanthanum trichloride (ISO) lipopolysaccharide (ISO) lithium atom (EXP) lithium hydride (EXP) lutein (ISO) medroxyprogesterone acetate (EXP) methamphetamine (EXP) methimazole (EXP) monosodium L-glutamate (ISO) N,N-diethyl-m-toluamide (EXP) N-acetyl-beta-D-glucosamine (ISO) N-acetyl-D-glucosamine (ISO) N-acetyl-L-cysteine (ISO) N-methyl-4-phenylpyridinium (EXP,ISO) N-nitrosomorpholine (EXP) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) Nutlin-3 (ISO) okadaic acid (ISO) p-menthan-3-ol (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) permethrin (EXP) phlorizin (ISO) picloram (ISO) propiconazole (EXP) Pyridostigmine bromide (EXP) quartz (EXP) quercetin (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium nitrate (ISO) streptozocin (ISO) sulfadimethoxine (EXP) temozolomide (ISO) tert-butyl hydroperoxide (ISO) tetrachloroethene (ISO) tetrachloromethane (ISO) thapsigargin (ISO) titanium dioxide (ISO) toluene (EXP) trans-caffeic acid (ISO) trichlopyr (ISO) trichloroethene (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO)
Cellular Component
cytoplasm (IBA,IEA,ISO) cytoplasmic vesicle (IEA,ISO) cytosol (IEA,ISO) mitochondrion (IBA,IDA,IEA,ISO) nucleus (IEA,ISO) perinuclear region of cytoplasm (IEA,ISO) peroxisomal matrix (IEA,ISO) peroxisome (IBA,IDA,IEA,ISO)
1.
Peroxiredoxin V contributes to antioxidant defense of lung epithelial cells.
Avila PC, etal., Lung. 2008 Mar-Apr;186(2):103-14. doi: 10.1007/s00408-007-9066-2. Epub 2008 Jan 25.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Brucella infection regulates peroxiredoxin-5 protein expression to facilitate intracellular survival by reducing the production of nitric oxide and reactive oxygen species.
Hu H, etal., Biochem Biophys Res Commun. 2019 Aug 13;516(1):82-88. doi: 10.1016/j.bbrc.2019.06.026. Epub 2019 Jun 10.
4.
Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.
Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
5.
Cloning and characterization of AOEB166, a novel mammalian antioxidant enzyme of the peroxiredoxin family.
Knoops B, etal., J Biol Chem 1999 Oct 22;274(43):30451-8.
6.
Gene Data Set
MGD Curation, June 12, 2002
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Prdx5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 213,529,042 - 213,532,787 (-) NCBI GRCr8 mRatBN7.2 1 204,099,826 - 204,103,589 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 204,099,826 - 204,114,268 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 212,450,032 - 212,453,015 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 219,545,095 - 219,548,082 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 212,236,145 - 212,239,134 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 222,164,462 - 222,167,447 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 222,164,462 - 222,167,447 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 229,155,316 - 229,158,301 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 209,583,414 - 209,586,399 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 209,741,843 - 209,744,829 (-) NCBI Celera 1 201,633,781 - 201,636,766 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
PRDX5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 64,318,121 - 64,321,811 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 64,318,121 - 64,321,811 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 64,085,593 - 64,089,283 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 63,842,145 - 63,845,859 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 63,842,144 - 63,845,858 NCBI Celera 11 61,411,653 - 61,415,367 (+) NCBI Celera Cytogenetic Map 11 q13.1 NCBI HuRef 11 60,413,301 - 60,417,036 (+) NCBI HuRef CHM1_1 11 63,968,573 - 63,972,308 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 64,308,102 - 64,311,792 (+) NCBI T2T-CHM13v2.0
Prdx5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 6,884,065 - 6,887,474 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 6,884,065 - 6,887,474 (-) Ensembl GRCm39 Ensembl GRCm38 19 6,906,697 - 6,910,106 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 6,906,697 - 6,910,106 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 6,981,309 - 6,984,135 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 6,973,863 - 6,976,689 (-) NCBI MGSCv36 mm8 Celera 19 6,683,601 - 6,686,426 (-) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 5.08 NCBI
Prdx5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 20,761,495 - 20,766,976 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 20,763,822 - 20,766,976 (-) NCBI ChiLan1.0 ChiLan1.0
PRDX5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 65,545,189 - 65,548,848 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 66,590,326 - 66,593,993 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 59,675,138 - 59,678,804 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 63,020,097 - 63,023,624 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 63,020,097 - 63,023,624 (+) Ensembl panpan1.1 panPan2
PRDX5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 52,750,977 - 52,754,432 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 51,358,049 - 51,361,693 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 53,796,390 - 53,800,034 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 18 52,888,242 - 52,891,882 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 52,474,829 - 52,478,470 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 53,258,704 - 53,262,348 (-) NCBI UU_Cfam_GSD_1.0
Prdx5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 8,452,065 - 8,455,009 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936599 4,894,409 - 4,897,223 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936599 4,894,409 - 4,897,426 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRDX5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 7,798,670 - 7,802,952 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 7,798,672 - 7,801,955 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 6,864,489 - 6,867,774 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRDX5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 9,912,947 - 9,917,439 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 9,912,898 - 9,917,361 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 107,253,189 - 107,257,819 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prdx5
.
Predicted Target Of
Count of predictions: 165 Count of miRNA genes: 101 Interacting mature miRNAs: 109 Transcripts: ENSRNOT00000028687, ENSRNOT00000050964 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
RH142172
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 213,532,927 - 213,533,227 (+) Marker Load Pipeline mRatBN7.2 1 204,103,718 - 204,104,018 (+) MAPPER mRatBN7.2 Rnor_6.0 1 222,168,348 - 222,168,647 NCBI Rnor6.0 Rnor_5.0 1 229,159,202 - 229,159,501 UniSTS Rnor5.0 RGSC_v3.4 1 209,587,300 - 209,587,599 UniSTS RGSC3.4 Celera 1 201,637,667 - 201,637,966 UniSTS RH 3.4 Map 1 1522.1 UniSTS Cytogenetic Map 1 q43 UniSTS
RH127892
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 204,099,882 - 204,100,067 (+) MAPPER mRatBN7.2 Rnor_6.0 1 222,164,512 - 222,164,696 NCBI Rnor6.0 Rnor_5.0 1 229,155,366 - 229,155,550 UniSTS Rnor5.0 RGSC_v3.4 1 209,583,464 - 209,583,648 UniSTS RGSC3.4 Celera 1 201,633,831 - 201,634,015 UniSTS RH 3.4 Map 1 1524.5 UniSTS Cytogenetic Map 1 q43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028687 ⟹ ENSRNOP00000028687
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,099,826 - 204,102,836 (-) Ensembl Rnor_6.0 Ensembl 1 222,164,462 - 222,167,447 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104624 ⟹ ENSRNOP00000081085
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,099,826 - 204,114,268 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110859 ⟹ ENSRNOP00000082685
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,099,833 - 204,102,818 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111281 ⟹ ENSRNOP00000090599
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,099,833 - 204,102,857 (-) Ensembl
RefSeq Acc Id:
NM_053610 ⟹ NP_446062
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,529,042 - 213,532,027 (-) NCBI mRatBN7.2 1 204,099,833 - 204,102,818 (-) NCBI Rnor_6.0 1 222,164,462 - 222,167,447 (-) NCBI Rnor_5.0 1 229,155,316 - 229,158,301 (-) NCBI RGSC_v3.4 1 209,583,414 - 209,586,399 (-) RGD Celera 1 201,633,781 - 201,636,766 (-) RGD
Sequence:
CAGAATCATCTGCGGGTGGGCTGCGGCGGCGGGGCGGGCATGGTCCAGCTGAGGTTTTGCGTCCTAGGCAGCATAGCCGGATCGGTGCTCCGTGCATCGGCTACTTGGACGTGCGTGGCAGGCAGAGC
hide sequence
RefSeq Acc Id:
XM_039105128 ⟹ XP_038961056
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,529,042 - 213,532,787 (-) NCBI mRatBN7.2 1 204,099,826 - 204,103,589 (-) NCBI
RefSeq Acc Id:
XM_039105162 ⟹ XP_038961090
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,529,042 - 213,532,315 (-) NCBI mRatBN7.2 1 204,099,826 - 204,102,991 (-) NCBI
RefSeq Acc Id:
XM_039105211 ⟹ XP_038961139
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,529,042 - 213,532,352 (-) NCBI mRatBN7.2 1 204,099,828 - 204,103,207 (-) NCBI
RefSeq Acc Id:
XM_039105308 ⟹ XP_038961236
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,529,042 - 213,532,442 (-) NCBI mRatBN7.2 1 204,099,826 - 204,103,214 (-) NCBI
RefSeq Acc Id:
XM_063288110 ⟹ XP_063144180
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,529,042 - 213,532,118 (-) NCBI
RefSeq Acc Id:
NP_446062 ⟸ NM_053610
- Peptide Label:
precursor
- UniProtKB:
Q9R063 (UniProtKB/Swiss-Prot), Q68G22 (UniProtKB/Swiss-Prot), A6HZI8 (UniProtKB/TrEMBL)
- Sequence:
MVQLRFCVLGSIAGSVLRASATWTCVAGRAGRKGAGWECGGARSFSSAAVTMAPIKVGDTIPSVEVFEGEPGKKVNLAELFKDKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVN
hide sequence
Ensembl Acc Id:
ENSRNOP00000028687 ⟸ ENSRNOT00000028687
RefSeq Acc Id:
XP_038961056 ⟸ XM_039105128
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038961236 ⟸ XM_039105308
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038961090 ⟸ XM_039105162
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038961139 ⟸ XM_039105211
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000081085 ⟸ ENSRNOT00000104624
Ensembl Acc Id:
ENSRNOP00000090599 ⟸ ENSRNOT00000111281
Ensembl Acc Id:
ENSRNOP00000082685 ⟸ ENSRNOT00000110859
RefSeq Acc Id:
XP_063144180 ⟸ XM_063288110
- Peptide Label:
isoform X1
RGD ID: 13690707 Promoter ID: EPDNEW_R1230 Type: initiation region Name: Prdx5_1 Description: peroxiredoxin 5 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 222,167,401 - 222,167,461 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Prdx5
peroxiredoxin 5
Symbol and Name status set to approved
1299863 APPROVED
2003-05-22
Prdx5
peroxiredoxin 5
Prdx
peroxiredoxin
Symbol updated to reflect Human and Mouse nomenclature
629527 PROVISIONAL
2002-07-09
Prdx6
peroxiredoxin 6
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
Note Type
Note
Reference
gene_protein
213 amino acids
70622
gene_regulation
induced by acute inflammation
70622
