Ddx39b (DExD-box helicase 39B) - Rat Genome Database

Name: Ddx39b
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ddx39b (DExD-box helicase 39B) Rattus norvegicus

Analyze

Symbol:

Ddx39b

Name:

DExD-box helicase 39B

RGD ID:

70923

Description:

Predicted to enable several functions, including ATP hydrolysis activity; ATP-dependent protein binding activity; and snRNA binding activity. Involved in several processes, including positive regulation of cell growth involved in cardiac muscle cell development; positive regulation of macromolecule biosynthetic process; and positive regulation of vascular associated smooth muscle cell proliferation. Located in nuclear matrix. Part of protein-containing complex. Human ortholog(s) of this gene implicated in type 1 diabetes mellitus. Orthologous to human DDX39B (DExD-box helicase 39B); PARTICIPATES IN NXF1-NXT1 export pathway; spliceosome pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

56 kDa U2AF65-associated protein; ATP-dependent RNA helicase p47; Bat1; Bat1a; D17H6S81E-1; D20H6S81e; DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B; DEAD box protein UAP56; DEAD-box helicase 39B; DNA segment Chr 17 human D6S81E 1; HLA-B associated transcript 1; HLA-B associated transcript 1A; HLA-B-associated transcript 1A; Nuclear RNA helicase; p47; spliceosome RNA helicase Bat1; spliceosome RNA helicase Ddx39b

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DDX39B (DExD-box helicase 39B)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ddx39b (DEAD box helicase 39b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ddx39b (DExD-box helicase 39B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DDX39B (DExD-box helicase 39B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DDX39B (DExD-box helicase 39B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ddx39b (DExD-box helicase 39B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DDX39B (DExD-box helicase 39B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DDX39B (DExD-box helicase 39B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ddx39b (DExD-box helicase 39B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DDX39A (DExD-box helicase 39A)	HGNC	OrthoDB
Homo sapiens (human):	MT1A (metallothionein 1A)	HGNC	OMA
Homo sapiens (human):	MT1G (metallothionein 1G)	HGNC	OMA
Homo sapiens (human):	MT1F (metallothionein 1F)	HGNC	OMA
Homo sapiens (human):	MT1X (metallothionein 1X)	HGNC	OMA
Homo sapiens (human):	MT1E (metallothionein 1E)	HGNC	OMA
Homo sapiens (human):	MT2A (metallothionein 2A)	HGNC	OMA
Homo sapiens (human):	MT1B (metallothionein 1B)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	DDX39B (DExD-box helicase 39B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ddx39b (DEAD box helicase 39b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ddx39b (DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Hel25E	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SUB2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	hel-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ddx39b	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	3,547,702 - 3,585,064 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,572,056 - 3,584,996 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,272,550 - 4,284,961 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,634,613 - 3,647,024 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,172,085 - 4,184,507 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	4,806,103 - 4,818,600 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	4,806,108 - 4,818,568 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	6,886,503 - 6,898,979 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	3,611,128 - 3,623,578 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	3,611,355 - 3,623,754 (-)	NCBI
Celera	20	4,440,470 - 4,452,912 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

JMP syndrome (ISO)

megacolon (ISO)

Neurodevelopmental Disorders (ISO)

type 1 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4-dinitrotoluene (EXP)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

4-amino-2,6-dinitrotoluene (EXP)

5-fluorouracil (ISO)

7,12-dimethyltetraphene (EXP)

aconitine (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

caffeine (ISO)

calcium dichloride (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chlorpyrifos (EXP,ISO)

copper atom (EXP)

copper(0) (EXP)

coumestrol (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

Enterolactone (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

glafenine (EXP)

glyphosate (EXP)

isoflavones (EXP)

ivermectin (ISO)

lead diacetate (ISO)

methidathion (ISO)

nickel atom (EXP)

nickel sulfate (EXP)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

rac-lactic acid (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thimerosal (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vanadyl sulfate (ISO)

vinclozolin (EXP)

vitamin E (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

liver development (IEP)

mRNA export from nucleus (IBA,IEA,ISO)

mRNA splicing, via spliceosome (IBA,ISO)

negative regulation of DNA damage checkpoint (IEA,ISO,ISS)

positive regulation of cell growth involved in cardiac muscle cell development (IMP)

positive regulation of DNA biosynthetic process (IMP)

positive regulation of DNA-templated transcription, elongation (IEA,ISO,ISS)

positive regulation of translation (IMP)

positive regulation of vascular associated smooth muscle cell proliferation (IMP)

RNA secondary structure unwinding (IEA,ISO)

RNA splicing (ISO)

spliceosomal complex assembly (IEA,ISO)

viral mRNA export from host cell nucleus (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

nuclear matrix (IDA)

nuclear speck (IEA,ISO)

nucleus (ISO)

protein-containing complex (IDA)

spliceosomal complex (IEA,ISO)

transcription export complex (IEA,ISO)

U4 snRNP (IEA,ISO)

U6 snRNP (IEA,ISO)

Molecular Function

ATP binding (IEA)

ATP hydrolysis activity (ISO)

ATP-dependent activity, acting on RNA (ISO)

ATP-dependent protein binding (IEA,ISO)

hydrolase activity (IEA)

identical protein binding (IEA,ISO)

nucleic acid binding (IEA)

protein binding (ISO)

protein-containing complex binding (IDA)

RNA binding (IBA)

RNA helicase activity (IBA,IEA,ISO)

U4 snRNA binding (IEA,ISO)

U6 snRNA binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

NXF1-NXT1 export pathway (ISO)

spliceosome pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Functions of the DExD/H-box proteins in nuclear pre-mRNA splicing.	Chang TH, etal., Biochim Biophys Acta. 2013 Aug;1829(8):764-74. doi: 10.1016/j.bbagrm.2013.02.006. Epub 2013 Feb 21.
2.	Localization of central MHC genes influencing type I diabetes.	Cheong KY, etal., Hum Immunol. 2001 Dec;62(12):1363-70.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Molecular cloning of mouse p47, a second group mammalian RuvB DNA helicase-like protein: homology with those from human and Saccharomyces cerevisiae.	Gohshi T, etal., J Biochem. 1999 May;125(5):939-46.
6.	Cytogenetic localization of the growth and reproduction complex (Grc) in the rat and in the mouse and its position in relation to RT1.EC and other loci in the rat MHC.	Helou K, etal., Hereditas 1999;130(2):105-9.
7.	mRNA export and the TREX complex.	Katahira J Biochim Biophys Acta. 2012 Jun;1819(6):507-13. doi: 10.1016/j.bbagrm.2011.12.001. Epub 2011 Dec 8.
8.	Co-localization and interaction of b0,+-type amino acid transporter 1 (BAT1) with caveolin-1 in rat kidney.	Kwak JO, etal., J Nephrol. 2005 Nov-Dec;18(6):681-9.
9.	Does the rat have an H2-D orthologue next to Bat1?	Lambracht-Washington D and Fischer Lindahl K, Immunogenetics 2002 Mar;53(12):1039-46.
10.	Gene Data Set	MGD Curation, June 12, 2002
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	Molecular cloning and analysis of an eIF-4A-related rat liver nuclear protein.	Nair S, etal., J Biol Chem 1992 Jun 25;267(18):12928-35.
13.	Polymorphisms at positions -22 and -348 in the promoter of the BAT1 gene affect transcription and the binding of nuclear factors.	Price P, etal., Hum Mol Genet. 2004 May 1;13(9):967-74. Epub 2004 Mar 17.
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	UAP56 is an important regulator of protein synthesis and growth in cardiomyocytes.	Sahni A, etal., Biochem Biophys Res Commun. 2010 Feb 26;393(1):106-10. doi: 10.1016/j.bbrc.2010.01.093. Epub 2010 Jan 29.
18.	UAP56 is a novel interacting partner of Bcr in regulating vascular smooth muscle cell DNA synthesis.	Sahni A, etal., Biochem Biophys Res Commun. 2012 Apr 13;420(3):511-5. doi: 10.1016/j.bbrc.2012.03.022. Epub 2012 Mar 13.
19.	UAP56 is an important mediator of angiotensin II/platelet derived growth factor induced vascular smooth muscle cell DNA synthesis and proliferation.	Sahni A, etal., Biochem Biophys Res Commun. 2013 Feb 15;431(3):636-40. doi: 10.1016/j.bbrc.2012.12.014. Epub 2012 Dec 12.
20.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:14667819	PMID:15047853	PMID:15489334	PMID:15833825	PMID:15998806	PMID:17190602	PMID:17562711	PMID:18593880	PMID:18974867	PMID:20844015	PMID:21859714	PMID:22082260
PMID:22144908	PMID:22658674	PMID:22681889	PMID:25145264

Genomics

Comparative Map Data

Ddx39b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	3,547,702 - 3,585,064 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,572,056 - 3,584,996 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,272,550 - 4,284,961 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,634,613 - 3,647,024 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,172,085 - 4,184,507 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	4,806,103 - 4,818,600 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	4,806,108 - 4,818,568 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	6,886,503 - 6,898,979 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	3,611,128 - 3,623,578 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	3,611,355 - 3,623,754 (-)	NCBI
Celera	20	4,440,470 - 4,452,912 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

DDX39B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	31,530,226 - 31,542,003 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	31,530,219 - 31,542,448 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	31,498,003 - 31,509,780 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	31,605,975 - 31,618,204 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	31,605,974 - 31,617,904	NCBI
Celera	6	33,096,234 - 33,108,459 (-)	NCBI		Celera
Cytogenetic Map	6	p21.33	NCBI
HuRef	6	31,284,705 - 31,296,997 (-)	NCBI		HuRef
CHM1_1	6	31,500,137 - 31,512,390 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	31,383,322 - 31,395,095 (-)	NCBI		T2T-CHM13v2.0

Ddx39b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	35,460,722 - 35,472,683 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	35,460,722 - 35,472,683 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	35,241,746 - 35,253,707 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	35,241,746 - 35,253,707 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	35,378,691 - 35,390,652 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	34,355,767 - 34,367,554 (+)	NCBI		MGSCv36	mm8
MGSCv36	17	34,849,922 - 34,861,736 (+)	NCBI		MGSCv36	mm8
Celera	17	38,343,889 - 38,346,696 (+)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	18.6	NCBI

Ddx39b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	72,835 - 84,384 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	72,835 - 84,045 (-)	NCBI	ChiLan1.0	ChiLan1.0

DDX39B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	41,968,724 - 41,980,648 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	31,191,333 - 31,203,246 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	32,081,210 - 32,093,135 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	32,081,210 - 32,092,569 (-)	Ensembl	panpan1.1		panPan2

DDX39B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	1,032,377 - 1,044,465 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	1,032,368 - 1,044,492 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	1,169,048 - 1,179,440 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	1,177,608 - 1,189,705 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	1,176,147 - 1,190,041 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	1,036,642 - 1,047,031 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	1,104,617 - 1,114,937 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	1,171,204 - 1,181,685 (-)	NCBI		UU_Cfam_GSD_1.0

Ddx39b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	35,580,562 - 35,597,123 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936727	1,968,094 - 1,980,785 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936727	1,968,032 - 1,980,789 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DDX39B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	23,658,088 - 23,670,031 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	23,658,089 - 23,669,095 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	27,582,945 - 27,593,980 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DDX39B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	40,445,258 - 40,457,379 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	40,447,061 - 40,456,826 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	31,430,956 - 31,442,672 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ddx39b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	24,657,914 - 24,667,579 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	24,657,019 - 24,667,225 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ddx39b
1858 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	132
Count of miRNA genes:	109
Interacting mature miRNAs:	114
Transcripts:	ENSRNOT00000001115
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724519	Bp144	Blood pressure QTL 144		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	20	1	3624629	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
2306850	Pia40	Pristane induced arthritis QTL 40		0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1527959	5304575	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
61448	Ciaa1	CIA Autoantibody QTL 1	30	0.001	blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	20	2646395	4597031	Rat
61472	Aia1	Adjuvant induced arthritis QTL 1	18	0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	2646395	4597031	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat

Markers in Region

D20Yum47

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	3,576,110 - 3,576,337 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,809,696 - 4,809,922	NCBI	Rnor6.0
Rnor_5.0	20	6,890,096 - 6,890,322	UniSTS	Rnor5.0
RGSC_v3.4	20	3,614,716 - 3,614,942	UniSTS	RGSC3.4
Celera	20	4,449,105 - 4,449,331	UniSTS
Cytogenetic Map	20	p12	UniSTS

Bat1_microsatellite

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	3,572,729 - 3,572,876 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,806,315 - 4,806,461	NCBI	Rnor6.0
Rnor_5.0	20	6,886,715 - 6,886,861	UniSTS	Rnor5.0
RGSC_v3.4	20	3,611,335 - 3,611,481	UniSTS	RGSC3.4
Celera	20	4,452,559 - 4,452,705	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH144334

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	3,572,601 - 3,572,969 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,806,187 - 4,806,554	NCBI	Rnor6.0
Rnor_5.0	20	6,886,587 - 6,886,954	UniSTS	Rnor5.0
RGSC_v3.4	20	3,611,207 - 3,611,574	UniSTS	RGSC3.4
Celera	20	4,452,466 - 4,452,833	UniSTS
RH 3.4 Map	20	50.5	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH126881

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	3,572,569 - 3,572,935 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,806,155 - 4,806,520	NCBI	Rnor6.0
Rnor_5.0	20	6,886,555 - 6,886,920	UniSTS	Rnor5.0
RGSC_v3.4	20	3,611,175 - 3,611,540	UniSTS	RGSC3.4
Celera	20	4,452,500 - 4,452,865	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098378	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005497163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005497165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_362030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF387339	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ314857	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC080243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX883046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DY309526	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000323	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M75168	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000001115 ⟹ ENSRNOP00000001115

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	3,572,523 - 3,584,996 (-)	Ensembl
Rnor_6.0 Ensembl	20	4,806,108 - 4,818,568 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000077809

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	3,572,410 - 3,584,996 (-)	Ensembl
Rnor_6.0 Ensembl	20	4,809,903 - 4,818,539 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000080174 ⟹ ENSRNOP00000075517

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	3,572,527 - 3,583,591 (-)	Ensembl
Rnor_6.0 Ensembl	20	4,806,108 - 4,817,146 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000082233

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	4,807,028 - 4,809,785 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000087615

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	4,806,327 - 4,808,119 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000116798 ⟹ ENSRNOP00000093667

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	3,572,056 - 3,584,996 (-)	Ensembl

RefSeq Acc Id:

NM_133300 ⟹ NP_579834

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	3,572,523 - 3,584,973 (-)	NCBI
Rnor_6.0	20	4,806,108 - 4,818,558 (-)	NCBI
Rnor_5.0	20	6,886,503 - 6,898,979 (-)	NCBI
RGSC_v3.4	20	3,611,128 - 3,623,578 (-)	RGD
Celera	20	4,440,470 - 4,452,912 (+)	RGD

Sequence:

show sequence

CCGGAAGTGAAGGCAGCTTCCCGCCTCCGTCCCTGTTGCTGCCGCCATACACGCTCGCAGTGCT
TAGCTCTTCTGTCGGAAACTGGTGTCTTTTCCCTTGCTGTTCTCCAACCCCTCTCTTTCCCCTT
GCTTCCTCTCACCTGCTCTGGGACACCTAACTCAGAGACCTCCCTTCTCCCCCCGCCGGCCGGA
TTATGGCAGAGAACGATGTGGACAATGAGCTCTTGGACTATGAAGACGATGAGGTGGAGACGGC
CGCTGGGGCAGATGGGACCGAAGCTCCCGCCAAGAAAGACGTCAAGGGCTCCTATGTCTCCATC
CACAGCTCCGGCTTTCGAGATTTCCTACTTAAGCCAGAGTTGCTCCGGGCCATTGTTGACTGTG
GCTTTGAGCATCCATCAGAGGTCCAGCATGAATGCATCCCCCAGGCCATTCTGGGGATGGATGT
CCTGTGCCAGGCCAAGTCAGGCATGGGAAAAACAGCAGTGTTTGTCCTGGCCACACTGCAGCAG
CTGGAGCCAGTTACTGGGCAGGTGTCAGTGCTGGTGATGTGTCACACCAGGGAGCTGGCTTTCC
AGATCAGCAAGGAATATGAGCGCTTCTCAAAGTACATGCCGAATGTCAAGGTGGCAGTGTTTTT
TGGCGGACTGTCTATCAAGAAGGATGAAGAGGTGCTGAAGAAGAACTGCCCACACATTGTTGTG
GGGACTCCTGGCCGAATTCTAGCCCTGGCCCGAAATAAGAGCCTGAACCTCAAACACATTAAAC
ACTTTATCTTGGACGAATGTGACAAGATGCTTGAACAGCTCGACATGCGTCGGGATGTCCAGGA
AATTTTTCGCATGACCCCCCATGAGAAGCAGGTCATGATGTTCAGTGCTACCTTGAGCAAAGAG
ATCCGCCCAGTGTGCCGCAAGTTCATGCAAGATCCTATGGAGATCTTCGTGGATGACGAGACCA
AGTTGACGCTGCACGGGTTGCAGCAATACTACGTGAAACTGAAGGACAACGAGAAGAACCGGAA
GCTCTTTGACCTTCTCGATGTCCTCGAGTTCAACCAGGTTGTGATCTTTGTGAAGTCCGTGCAG
CGCTGCATCGCCTTGGCCCAGCTTCTAGTGGAGCAGAACTTCCCAGCCATTGCTATCCACCGCG
GGATGCCCCAGGAGGAGAGGCTCTCTCGGTATCAGCAGTTCAAGGATTTTCAGCGGAGGATACT
TGTGGCTACCAACCTGTTTGGCCGTGGCATGGACATTGAGCGCGTGAACATCGCTTTCAACTAT
GACATGCCAGAGGACTCCGACACCTACCTGCACAGGGTGGCCAGAGCGGGCCGGTTTGGCACCA
AGGGCTTGGCCATCACATTTGTGTCAGACGAGAACGATGCCAAGATCCTGAATGACGTGCAGGA
CCGTTTCGAGGTCAACATCAGTGAGCTGCCCGATGAGATCGACATTTCCTCCTACATTGAACAG
ACACGGTAGAGGAATCACCTATTCTGGACCGTGGCAGTCTGTTGTAGAAGAGGACGAAGGGGTC
AGGGAGGAAACACTACTGCCCCACCCCTGACACCTCAGCCCACCCTCTCCATGCCTCTCTGCGT
CACCACCACTCCTAAACCTAGTCCTGATTTATCAGAGTTGTTTGTTTGTTTGTTTGTTTTTGTT
TTTTAACAAAACTAAGAATGAAACAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039098378 ⟹ XP_038954306

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	3,547,702 - 3,585,063 (-)	NCBI

RefSeq Acc Id:

XR_005497163

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	3,572,519 - 3,583,971 (-)	NCBI

RefSeq Acc Id:

XR_005497165

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	3,547,702 - 3,585,064 (-)	NCBI

RefSeq Acc Id:

XR_362030

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	3,572,519 - 3,585,064 (-)	NCBI
Rnor_6.0	20	4,806,103 - 4,818,600 (-)	NCBI
Rnor_5.0	20	6,886,503 - 6,898,979 (-)	NCBI

Sequence:

show sequence

CCCTGGCGGCCGGGAAGGCGGGAGGCCGGGGCGAGACTGGAACCGGAAGTGAAGGCAGCTTCCC
GCCTCCGTCCCTGTTGCTGCCGCCATACACGCTCGCAGTGCTTAGCTCTTCTGTCGGAAACTGG
TGTCTTTTCCCTTGCTGTTCTCCAACCCCTCTCTTTCCCCTTGCTTCCTCTCACCTGCTCTGGG
ACACCTAACTCAGAGACCTCCCTTCTCCCCCCGCCGGCCGGATTATGGCAGAGAACGATGTGGA
CAATGAGCTCTTGGACTATGAAGACGATGAGGTGGAGACGGCCGCTGGGGCAGATGGGACCGAA
GCTCCCGCCAAGAAAGACGTCAAGGGCTCCTATGTCTCCATCCACAGCTCCGGCTTTCGAGATT
TCCTACTTAAGCCAGAGTTGCTCCGGGCCATTGTTGACTGTGGCTTTGAGCATCCATCAGAGGT
CCAGCATGAATGCATCCCCCAGGCCATTCTGGGGATGGATGTCCTGTGCCAGGCCAAGTCAGGC
ATGGGAAAAACAGCAGTGTTTGTCCTGGCCACACTGCAGCAGCTGGAGCCAGTTACTGGGCAGG
TGTCAGTGCTGGTGATGTGTCACACCAGGGAGCTGGCTTTCCAGATCAGCAAGGAATATGAGCG
CTTCTCAAAGTACATGCCGAATGTCAAGGTGGCAGTGTTTTTTGGCGGACTGTCTATCAAGAAG
GATGAAGAGGTGCTGAAGAAGAACTGCCCACACATTGTTGTGGGGACTCCTGGCCGAATTCTAG
CCCTGGCCCGAAATAAGAGCCTGAACCTCAAACACATTAAACACTTTATCTTGGACGAATGTGA
CAAGATGCTTGAACAGCTCGACATGCGTCGGGATGTCCAGGAAATTTTTCGCATGACCCCCCAT
GAGAAGCAGGTCATGATGTTCAGTGCTACCTTGAGCAAAGAGATCCGCCCAGTGTGCCGCAAGT
TCATGCAAGATCCTATGGAGATCTTCGTGGATGACGAGACCAAGTTGACGCTGCACGGGTTGCA
GCAATACTACGTGAAACTGAAGGACAACGAGAAGAACCGGAAGCTCTTTGACCTTCTCGATGTC
CTCGAGTTCAACCAGGTTGTGATCTTTGTGAAGTCCGTGCAGCGCTGCATCGCCTTGGCCCAGC
TTCTAGTGGAGCAGAACTTCCCAGCCATTGCTATCCACCGCGGGATGCCCCAGGAGGAGAGGCT
CTCTCGGTATCAGCAGTTCAAGGATTTTCAGCGGAGGATACTTGTGGCTACCAACCTGTTTGGC
CGTGGCATGGACATTGAGCGCGTGAACATCGCTTTCAACTATGACATGCCAGAGGACTCCGACA
CCTACCTGCACAGGGTGAGTGCCCACCCTACCCCACTTCCTGTGTGCGCACGCTGTGCCCCTTC
CTCTCCCCTCTGTCTCCCCTATGAGGCTTGCAGTTTTCCACCTCTCCTTCCAGGTGGCCAGAGC
GGGCCGGTTTGGCACCAAGGGCTTGGCCATCACATTTGTGTCAGACGAGAACGATGCCAAGATC
CTGAATGACGTGCAGGACCGTTTCGAGGTCAACATCAGTGAGCTGCCCGATGAGATCGACATTT
CCTCCTACATTGAACAGACACGGTAGAGGAATCACCTATTCTGGACCGTGGCAGTCTGTTGTAG
AAGAGGACGAAGGGGTCAGGGAGGAAACACTACTGCCCCACCCCTGACACCTCAGCCCACCCTC
TCCATGCCTCTCTGCGTCACCACCACTCCTAAACCTAGTCCTGATTTATCAGAGTTGTTTGTTT
GTTTGTTTGTTTTTGTTTTTTAACAAAACTAAGAATGAAACAACTGTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_579834	(Get FASTA)	NCBI Sequence Viewer
	XP_038954306	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41787	(Get FASTA)	NCBI Sequence Viewer
	AAH80243	(Get FASTA)	NCBI Sequence Viewer
	AAL98920	(Get FASTA)	NCBI Sequence Viewer
	CAC85694	(Get FASTA)	NCBI Sequence Viewer
	EDL83554	(Get FASTA)	NCBI Sequence Viewer
	EDL83555	(Get FASTA)	NCBI Sequence Viewer
	EDL83556	(Get FASTA)	NCBI Sequence Viewer
	Q63413	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_579834 ⟸ NM_133300

- UniProtKB:

Q811A6 (UniProtKB/Swiss-Prot), Q8R2G9 (UniProtKB/Swiss-Prot), Q63413 (UniProtKB/Swiss-Prot), A6KTX4 (UniProtKB/TrEMBL), A0A8I6A103 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAENDVDNELLDYEDDEVETAAGADGTEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCG
FEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQ
ISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKH
FILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETK
LTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRG
MPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTK
GLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR

hide sequence

RefSeq Acc Id:

ENSRNOP00000075517 ⟸ ENSRNOT00000080174

RefSeq Acc Id:

ENSRNOP00000001115 ⟸ ENSRNOT00000001115

RefSeq Acc Id:	XP_038954306 ⟸ XM_039098378
- Peptide Label:	isoform X1
- UniProtKB:	Q811A6 (UniProtKB/Swiss-Prot), Q63413 (UniProtKB/Swiss-Prot), Q8R2G9 (UniProtKB/Swiss-Prot), A6KTX4 (UniProtKB/TrEMBL), A0A8I6A103 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000093667 ⟸ ENSRNOT00000116798

Protein Domains

DEAD-box RNA helicase Q Helicase ATP-binding Helicase C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63413-F1-model_v2	AlphaFold	Q63413	1-428	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:70923	AgrOrtholog
BioCyc Gene	G2FUF-4670	BioCyc
Ensembl Genes	ENSRNOG00000000841	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000001115	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000075517.2	UniProtKB/TrEMBL
	ENSRNOP00000084309.1	UniProtKB/TrEMBL
	ENSRNOP00000093667.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001115	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000077809.2	UniProtKB/TrEMBL
	ENSRNOT00000080174.2	UniProtKB/TrEMBL
	ENSRNOT00000116798.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7100155	IMAGE-MGC_LOAD
InterPro	DEAD/DEAH_box_helicase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Helicase_ATP-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Helicase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RNA_helicase_DEAD_Q_motif	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:114612	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91440	IMAGE-MGC_LOAD
NCBI Gene	114612	ENTREZGENE
PANTHER	ATP-DEPENDENT RNA HELICASE DBP3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SPLICEOSOME RNA HELICASE DDX39B	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	DEAD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Helicase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ddx39b	PhenoGen
PROSITE	HELICASE_ATP_BIND_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HELICASE_CTER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Q_MOTIF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	DEXDc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HELICc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2KAT4_RAT	UniProtKB/TrEMBL
	A0A8I6A103	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AKU4_RAT	UniProtKB/TrEMBL
	A6KTX4	ENTREZGENE, UniProtKB/TrEMBL
	DX39B_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q811A6	ENTREZGENE
	Q8R2G9	ENTREZGENE
UniProt Secondary	Q811A6	UniProtKB/Swiss-Prot
	Q8R2G9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-10-05	Ddx39b	DExD-box helicase 39B	Ddx39b	DEAD-box helicase 39B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-01-13	Ddx39b	DEAD-box helicase 39B	Ddx39b	DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-07-28	Ddx39b	DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B	Bat1	HLA-B associated transcript 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Bat1	HLA-B associated transcript 1	Bat1a	HLA-B-associated transcript 1A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2003-04-09	Bat1a	HLA-B-associated transcript 1A			Symbol and Name updated	629477	APPROVED
2003-03-11	Bat1a	HLA-B-associated transcript 1A	D20H6S81e	Nuclear RNA helicase	Data Merged	628472	PROVISIONAL
2002-07-09	Bat1a	HLA-B-associated transcript 1A			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED
2002-06-10	D20H6S81e	Nuclear RNA helicase			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expression in liver is cell cycle dependent and developmentally regulated	632224
gene_other	the start of the MHC class I region downstrean of the rat Bat1a gene contains a sequence with similarity to intron 3 of the mouse H-2D gene but without the coding region	632223

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations