Symbol:
Bspry
Name:
B-box and SPRY domain containing
RGD ID:
708400
Description:
Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in innate immune response. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Located in cell leading edge and perinuclear region of cytoplasm. Orthologous to human BSPRY (B-box and SPRY domain containing); INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
b box and SPRY domain-containing protein; LOC64027; zetin 1; zetin-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 80,942,974 - 80,965,157 (+) NCBI GRCr8 mRatBN7.2 5 75,927,397 - 75,949,585 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 75,927,405 - 75,949,583 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 78,326,720 - 78,348,902 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 80,143,817 - 80,165,999 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 80,119,331 - 80,141,514 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 78,334,284 - 78,356,462 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 78,334,284 - 78,356,460 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 82,453,655 - 82,475,833 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 79,471,061 - 79,493,239 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 79,488,492 - 79,497,552 (+) NCBI Celera 5 74,869,050 - 74,891,031 (+) NCBI Celera Cytogenetic Map 5 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bspry Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of BSPRY mRNA] CTD PMID:31150632 Bspry Rat 1,2-dimethylhydrazine multiple interactions ISO Bspry (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of BSPRY mRNA CTD PMID:22206623 Bspry Rat 1-chloro-2,4-dinitrobenzene increases expression ISO Bspry (Mus musculus) 6480464 Dinitrochlorobenzene results in increased expression of BSPRY mRNA CTD PMID:18242016 Bspry Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of BSPRY mRNA CTD PMID:17557909 Bspry Rat 17beta-estradiol increases expression ISO Bspry (Mus musculus) 6480464 Estradiol results in increased expression of BSPRY mRNA CTD PMID:19484750 Bspry Rat 17beta-estradiol multiple interactions ISO BSPRY (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of BSPRY mRNA CTD PMID:30165855 Bspry Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of BSPRY mRNA CTD PMID:22298810 Bspry Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of BSPRY mRNA CTD PMID:34747641 Bspry Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of BSPRY mRNA CTD PMID:21346803 Bspry Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of BSPRY mRNA CTD PMID:21346803 Bspry Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of BSPRY mRNA CTD PMID:21346803 Bspry Rat 2-amino-4,6-dinitrotoluene affects expression EXP 6480464 2-amino-4 and 6-dinitrotoluene affects the expression of BSPRY mRNA CTD PMID:21346803 Bspry Rat 2-hydroxypropanoic acid decreases expression ISO BSPRY (Homo sapiens) 6480464 Lactic Acid results in decreased expression of BSPRY mRNA CTD PMID:30851411 Bspry Rat 3,7-dihydropurine-6-thione decreases expression EXP 6480464 Mercaptopurine results in decreased expression of BSPRY mRNA CTD PMID:23358152 Bspry Rat 4,4'-sulfonyldiphenol increases methylation ISO Bspry (Mus musculus) 6480464 bisphenol S results in increased methylation of BSPRY exon CTD PMID:33297965 Bspry Rat 4,4'-sulfonyldiphenol affects methylation ISO Bspry (Mus musculus) 6480464 bisphenol S affects the methylation of BSPRY gene CTD PMID:31683443 Bspry Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO Bspry (Mus musculus) 6480464 Oxazolone results in increased expression of BSPRY mRNA CTD PMID:18242016 Bspry Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of BSPRY mRNA CTD PMID:21346803 Bspry Rat 4-hydroxyphenyl retinamide increases expression ISO Bspry (Mus musculus) 6480464 Fenretinide results in increased expression of BSPRY mRNA CTD PMID:28973697 Bspry Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of BSPRY mRNA CTD PMID:24780913 Bspry Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of BSPRY mRNA CTD PMID:28959563 Bspry Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of BSPRY mRNA CTD PMID:16483693 Bspry Rat atrazine increases expression ISO BSPRY (Homo sapiens) 6480464 Atrazine results in increased expression of BSPRY mRNA CTD PMID:22378314 Bspry Rat belinostat multiple interactions ISO BSPRY (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BSPRY mRNA CTD PMID:27188386 Bspry Rat benzo[a]pyrene decreases methylation ISO BSPRY (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of BSPRY 3' UTR and Benzo(a)pyrene results in decreased methylation of BSPRY promoter CTD PMID:27901495 Bspry Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of BSPRY mRNA CTD PMID:18164116 Bspry Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BSPRY mRNA CTD PMID:25181051 more ... Bspry Rat bisphenol A increases expression ISO Bspry (Mus musculus) 6480464 bisphenol A results in increased expression of BSPRY mRNA CTD PMID:32156529 Bspry Rat bisphenol F increases expression ISO Bspry (Mus musculus) 6480464 bisphenol F results in increased expression of BSPRY mRNA CTD PMID:30951980 Bspry Rat butanal increases expression ISO BSPRY (Homo sapiens) 6480464 butyraldehyde results in increased expression of BSPRY mRNA CTD PMID:26079696 Bspry Rat cadmium dichloride decreases expression ISO BSPRY (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of BSPRY mRNA CTD PMID:38382870 Bspry Rat calcitriol increases expression ISO BSPRY (Homo sapiens) 6480464 Calcitriol results in increased expression of BSPRY mRNA CTD PMID:26485663 Bspry Rat CGP 52608 multiple interactions ISO BSPRY (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BSPRY gene] CTD PMID:28238834 Bspry Rat chloroprene increases expression ISO Bspry (Mus musculus) 6480464 Chloroprene results in increased expression of BSPRY mRNA CTD PMID:23125180 Bspry Rat choline multiple interactions ISO Bspry (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BSPRY mRNA CTD PMID:20938992 Bspry Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of BSPRY mRNA CTD PMID:27523638 Bspry Rat dextran sulfate increases expression ISO Bspry (Mus musculus) 6480464 Dextran Sulfate results in increased expression of BSPRY mRNA CTD PMID:35093514 Bspry Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of BSPRY mRNA CTD PMID:21658437 Bspry Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of BSPRY mRNA CTD PMID:21551480 Bspry Rat dorsomorphin multiple interactions ISO BSPRY (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Bspry Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of BSPRY mRNA CTD PMID:29391264 Bspry Rat entinostat multiple interactions ISO BSPRY (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BSPRY mRNA CTD PMID:27188386 Bspry Rat entinostat increases expression ISO BSPRY (Homo sapiens) 6480464 entinostat results in increased expression of BSPRY mRNA CTD PMID:26272509 Bspry Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of BSPRY mRNA CTD PMID:18035473 Bspry Rat folic acid multiple interactions ISO Bspry (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Bspry Rat formaldehyde decreases expression ISO BSPRY (Homo sapiens) 6480464 Formaldehyde results in decreased expression of BSPRY mRNA CTD PMID:23649840 Bspry Rat furan increases expression EXP 6480464 furan results in increased expression of BSPRY mRNA CTD PMID:25539665 and PMID:26194646 Bspry Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of BSPRY mRNA CTD PMID:33387578 Bspry Rat graphite affects expression EXP 6480464 Graphite affects the expression of BSPRY mRNA CTD PMID:29933104 Bspry Rat L-methionine multiple interactions ISO Bspry (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BSPRY mRNA CTD PMID:20938992 Bspry Rat mercaptopurine decreases expression EXP 6480464 Mercaptopurine results in decreased expression of BSPRY mRNA CTD PMID:23358152 Bspry Rat mercury dibromide multiple interactions ISO BSPRY (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BSPRY mRNA CTD PMID:27188386 Bspry Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of BSPRY mRNA CTD PMID:19564919 Bspry Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of BSPRY mRNA CTD PMID:18164116 Bspry Rat panobinostat increases expression ISO BSPRY (Homo sapiens) 6480464 panobinostat results in increased expression of BSPRY mRNA CTD PMID:26272509 Bspry Rat panobinostat multiple interactions ISO BSPRY (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BSPRY mRNA CTD PMID:27188386 Bspry Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of BSPRY mRNA CTD PMID:33387578 Bspry Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of BSPRY mRNA CTD PMID:32680482 Bspry Rat perfluorohexanesulfonic acid increases expression ISO BSPRY (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in increased expression of BSPRY mRNA CTD PMID:25812627 Bspry Rat perfluorooctanoic acid increases expression ISO BSPRY (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of BSPRY mRNA CTD PMID:25812627 Bspry Rat purine-6-thiol decreases expression EXP 6480464 Mercaptopurine results in decreased expression of BSPRY mRNA CTD PMID:23358152 Bspry Rat rac-lactic acid decreases expression ISO BSPRY (Homo sapiens) 6480464 Lactic Acid results in decreased expression of BSPRY mRNA CTD PMID:30851411 Bspry Rat SB 431542 multiple interactions ISO BSPRY (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Bspry Rat silicon dioxide affects expression ISO BSPRY (Homo sapiens) 6480464 Silicon Dioxide analog affects the expression of BSPRY mRNA CTD PMID:23806026 Bspry Rat sodium arsenite increases expression ISO BSPRY (Homo sapiens) 6480464 sodium arsenite results in increased expression of BSPRY mRNA CTD PMID:29301061 Bspry Rat sodium arsenite decreases expression ISO Bspry (Mus musculus) 6480464 sodium arsenite results in decreased expression of BSPRY mRNA CTD PMID:37682722 Bspry Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of BSPRY mRNA] CTD PMID:31150632 Bspry Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of BSPRY mRNA CTD PMID:31150632 Bspry Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of BSPRY mRNA CTD PMID:23411599 and PMID:34492290 Bspry Rat titanium dioxide decreases methylation ISO Bspry (Mus musculus) 6480464 titanium dioxide results in decreased methylation of BSPRY gene CTD PMID:35295148 Bspry Rat toluene 2,4-diisocyanate increases expression ISO Bspry (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in increased expression of BSPRY mRNA CTD PMID:18242016 Bspry Rat tributylstannane increases expression ISO Bspry (Mus musculus) 6480464 tributyltin results in increased expression of BSPRY mRNA CTD PMID:31939706 Bspry Rat trichostatin A increases expression ISO BSPRY (Homo sapiens) 6480464 trichostatin A results in increased expression of BSPRY mRNA CTD PMID:24935251 Bspry Rat triptonide increases expression ISO Bspry (Mus musculus) 6480464 triptonide results in increased expression of BSPRY mRNA CTD PMID:33045310 Bspry Rat valproic acid increases expression ISO BSPRY (Homo sapiens) 6480464 Valproic Acid results in increased expression of BSPRY mRNA CTD PMID:24383497 more ... Bspry Rat valproic acid multiple interactions ISO BSPRY (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BSPRY mRNA CTD PMID:27188386 Bspry Rat vancomycin decreases expression ISO Bspry (Mus musculus) 6480464 Vancomycin results in decreased expression of BSPRY mRNA CTD PMID:18930951 Bspry Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of BSPRY mRNA CTD PMID:23555832
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,6-trinitrotoluene (EXP) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-amino-4,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,7-dihydropurine-6-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) ammonium chloride (EXP) atrazine (ISO) belinostat (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) calcitriol (ISO) CGP 52608 (ISO) chloroprene (ISO) choline (ISO) Cuprizon (EXP) dextran sulfate (ISO) diethylstilbestrol (EXP) diuron (EXP) dorsomorphin (ISO) endosulfan (EXP) entinostat (ISO) flavonoids (EXP) folic acid (ISO) formaldehyde (ISO) furan (EXP) gentamycin (EXP) graphite (EXP) L-methionine (ISO) mercaptopurine (EXP) mercury dibromide (ISO) methamphetamine (EXP) N-nitrosodiethylamine (EXP) panobinostat (ISO) paracetamol (EXP) paraquat (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (ISO) purine-6-thiol (EXP) rac-lactic acid (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) tributylstannane (ISO) trichostatin A (ISO) triptonide (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP)
Bspry Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 80,942,974 - 80,965,157 (+) NCBI GRCr8 mRatBN7.2 5 75,927,397 - 75,949,585 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 75,927,405 - 75,949,583 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 78,326,720 - 78,348,902 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 80,143,817 - 80,165,999 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 80,119,331 - 80,141,514 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 78,334,284 - 78,356,462 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 78,334,284 - 78,356,460 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 82,453,655 - 82,475,833 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 79,471,061 - 79,493,239 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 79,488,492 - 79,497,552 (+) NCBI Celera 5 74,869,050 - 74,891,031 (+) NCBI Celera Cytogenetic Map 5 q24 NCBI
BSPRY Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 113,349,541 - 113,371,222 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 113,349,541 - 113,371,233 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 116,111,821 - 116,133,502 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 115,151,633 - 115,173,334 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 113,196,098 - 113,213,058 NCBI Celera 9 86,759,422 - 86,781,124 (+) NCBI Celera Cytogenetic Map 9 q32 NCBI HuRef 9 85,719,212 - 85,740,717 (+) NCBI HuRef CHM1_1 9 116,258,468 - 116,280,145 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 125,548,355 - 125,570,031 (+) NCBI T2T-CHM13v2.0
Bspry Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 62,398,248 - 62,415,537 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 62,398,290 - 62,415,535 (+) Ensembl GRCm39 Ensembl GRCm38 4 62,480,011 - 62,497,300 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 62,480,053 - 62,497,298 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 62,141,101 - 62,158,332 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 61,966,428 - 61,983,659 (+) NCBI MGSCv36 mm8 Celera 4 61,150,214 - 61,167,438 (+) NCBI Celera Cytogenetic Map 4 B3 NCBI cM Map 4 33.16 NCBI
Bspry Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 14,124,980 - 14,136,199 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 14,124,167 - 14,139,181 (-) NCBI ChiLan1.0 ChiLan1.0
BSPRY Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 26,002,804 - 26,024,443 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 26,005,163 - 26,026,801 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 84,451,214 - 84,472,861 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 112,827,202 - 112,844,099 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 112,822,701 - 112,843,006 (+) Ensembl panpan1.1 panPan2
BSPRY Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 67,702,949 - 67,726,809 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 67,704,845 - 67,726,155 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 66,114,301 - 66,131,637 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 68,834,003 - 68,851,307 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 68,833,789 - 68,850,651 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 67,351,904 - 67,369,222 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 67,383,003 - 67,400,285 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 68,119,966 - 68,137,285 (+) NCBI UU_Cfam_GSD_1.0
Bspry
BSPRY Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 253,975,973 - 254,003,162 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 253,975,979 - 254,003,169 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 284,757,676 - 284,772,898 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BSPRY
Bspry
.
Predicted Target Of
Count of predictions: 210 Count of miRNA genes: 153 Interacting mature miRNAs: 175 Transcripts: ENSRNOT00000020366 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298067 Scl15 Serum cholesterol level QTL 15 4.8 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 33215665 78215665 Rat 1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1357396 Bw44 Body weight QTL 44 4.19 body mass (VT:0001259) body weight (CMO:0000012) 5 68984307 104251008 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 61380 Edpm5 Estrogen-dependent pituitary mass QTL 5 4.5 0.92 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 5 68984307 104251008 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 61386 Bp49 Blood pressure QTL 49 16.6 cerebrum integrity trait (VT:0010549) brain infarction volume (CMO:0001013) 5 60293434 98603051 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1357402 Bw46 Body weight QTL 46 4.47 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 5 68984307 104251008 Rat 2302381 Bw84 Body weight QTL 84 4.47 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 5 68984307 104251008 Rat 1598807 Glom12 Glomerulus QTL 12 2.7 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 33215665 78215665 Rat 1302786 Kidm8 Kidney mass QTL 8 28.15 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 33215665 78215665 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 2303615 Vencon7 Ventilatory control QTL 7 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 5 50983895 95983895 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331773 Scl26 Serum cholesterol level QTL 26 3.065 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 43726656 86724018 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 61359 Eaex Experimental allergic encephalomyelitis QTL x 3 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 5 55715622 100715622 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 2303574 Gluco42 Glucose level QTL 42 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 53496719 98496719 Rat 2290005 Mcs24 Mammary carcinoma susceptibility QTL 24 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 64719390 109719390 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 2316954 Rf57 Renal function QTL 57 0 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 59793528 90450144 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 2312671 Scl64 Serum cholesterol level QTL 64 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 68984307 104251008 Rat 2316957 Pur21 Proteinuria QTL 21 6.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 5 59793528 113558156 Rat
RH133104
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 75,949,273 - 75,949,457 (+) MAPPER mRatBN7.2 Rnor_6.0 5 78,356,151 - 78,356,334 NCBI Rnor6.0 Rnor_5.0 5 82,475,522 - 82,475,705 UniSTS Rnor5.0 RGSC_v3.4 5 79,492,928 - 79,493,111 UniSTS RGSC3.4 Celera 5 74,890,720 - 74,890,903 UniSTS Cytogenetic Map 5 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020366 ⟹ ENSRNOP00000020366
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 75,927,405 - 75,949,583 (+) Ensembl Rnor_6.0 Ensembl 5 78,334,284 - 78,356,460 (+) Ensembl
RefSeq Acc Id:
NM_022261 ⟹ NP_071597
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 80,942,979 - 80,965,157 (+) NCBI mRatBN7.2 5 75,927,405 - 75,949,585 (+) NCBI Rnor_6.0 5 78,334,284 - 78,356,462 (+) NCBI Rnor_5.0 5 82,453,655 - 82,475,833 (+) NCBI RGSC_v3.4 5 79,471,061 - 79,493,239 (+) RGD Celera 5 74,869,050 - 74,891,031 (+) RGD
Sequence:
CCTGCGACAGGTGGAGCGCGCGGCCTCCGGCACCGGCCATGTCCTCGGATGTCTCCGGGACGGAGTCCGGGTCCGAGTCCGGGCCGGAGTCGGTTCCGGAGCCGGTGCCGGAGCCCGGGCCGGAGCCG
hide sequence
RefSeq Acc Id:
XM_017593607 ⟹ XP_017449096
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 80,942,974 - 80,965,157 (+) NCBI mRatBN7.2 5 75,927,397 - 75,949,585 (+) NCBI Rnor_6.0 5 78,334,290 - 78,356,462 (+) NCBI
Sequence:
ACAGGTGGAGCGCGCGGCCTCCGGCACCGGCCATGTCCTCGGATGTCTCCGGGACGGAGTCCGG
hide sequence
RefSeq Acc Id:
NP_071597 ⟸ NM_022261
- UniProtKB:
Q4VBG7 (UniProtKB/Swiss-Prot), Q9JKB6 (UniProtKB/Swiss-Prot), Q6P6S3 (UniProtKB/Swiss-Prot), B2GVA0 (UniProtKB/TrEMBL)
- Sequence:
MSSDVSGTESGSESGPESVPEPVPEPGPEPESEPGPGPAPGPGPGPAPGPGPGLGREPGQRYQPCQLCPEHGKPLSWFCLSERRPVCATCAGFGGRCHRHRIRRAEEHAEELRNKIVDHCEKLQLQSA
hide sequence
RefSeq Acc Id:
XP_017449096 ⟸ XM_017593607
- Peptide Label:
isoform X1
- Sequence:
MSSDVSGTESGSESGPESVPEPVPEPGPEPESEPGPGPAPGPGPGPAPGPGPGLGREPGQRYQP
hide sequence
Ensembl Acc Id:
ENSRNOP00000020366 ⟸ ENSRNOT00000020366
RGD ID: 13693792 Promoter ID: EPDNEW_R4315 Type: initiation region Name: Bspry_1 Description: B-box and SPRY domain containing SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 78,334,292 - 78,334,352 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Bspry
B-box and SPRY domain containing
LOC64027
zetin 1
Symbol and Name updated
1299863 APPROVED
