Rheb (Ras homolog, mTORC1 binding)

Gene: Rheb (Ras homolog, mTORC1 binding) Rattus norvegicus

Analyze

Symbol:

Rheb

Name:

Ras homolog, mTORC1 binding

RGD ID:

621840

Description:

Enables GDP binding activity; GTP binding activity; and GTPase activity. Involved in regulation of postsynapse organization and small GTPase-mediated signal transduction. Located in dendrite and neuronal cell body. Is active in glutamatergic synapse. Orthologous to human RHEB (Ras homolog, mTORC1 binding); PARTICIPATES IN mTOR signaling pathway; insulin signaling pathway; Rheb mediated signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

GTP-binding protein Rheb; Ras homolog enriched in brain

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RHEB (Ras homolog, mTORC1 binding)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Rheb (Ras homolog enriched in brain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rheb (Ras homolog, mTORC1 binding)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RHEB (Ras homolog, mTORC1 binding)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RHEB (Ras homolog, mTORC1 binding)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rheb (Ras homolog, mTORC1 binding)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RHEB (Ras homolog, mTORC1 binding)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RHEB (Ras homolog, mTORC1 binding)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rheb (Ras homolog, mTORC1 binding)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RHEBL1 (RHEB like 1)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Rheb (Ras homolog enriched in brain)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RHEB (Ras homolog, mTORC1 binding)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	rheb (Ras homolog, mTORC1 binding)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Danio rerio (zebrafish):	rhebl1 (Ras homolog, mTORC1 binding like 1)	Alliance	DIOPT (InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RHB1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rheb	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rheb-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rheb	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	11,012,173 - 11,053,860 (+)	NCBI		GRCr8
mRatBN7.2	4	10,278,970 - 10,320,160 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	10,279,370 - 10,320,160 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	15,278,765 - 15,319,243 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	11,093,025 - 11,133,503 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	9,445,606 - 9,486,084 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	6,827,429 - 6,873,384 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	6,827,429 - 6,873,383 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	6,843,897 - 6,889,004 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	4	3,156 - 43,581 (-)	NCBI		Celera
Cytogenetic Map	4	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

epilepsy (ISO)

Hemimegalencephaly (ISO)

lethal congenital glycogen storage disease of heart (ISO)

long QT syndrome (ISO)

lung non-small cell carcinoma (ISO)

papillary renal cell carcinoma (ISO)

renal cell carcinoma (ISO)

Renal Cell Carcinoma 1 (ISO)

Sporadic Papillary Renal Cell Carcinoma (ISO)

transitional cell carcinoma (ISO)

uterine cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4-dinitrotoluene (EXP)

2-nitrofluorene (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP)

6-propyl-2-thiouracil (EXP)

aconitine (EXP)

acrylamide (ISO)

aflatoxin B1 (EXP)

Allylamine (EXP)

amitrole (EXP)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

carnosic acid (ISO)

chloropicrin (ISO)

chloroquine (EXP)

choline (ISO)

cisplatin (ISO)

clobetasol (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

decabromodiphenyl ether (ISO)

dibutyl phthalate (EXP)

diethylstilbestrol (EXP)

doxorubicin (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

gentamycin (EXP)

hexadecanoic acid (ISO)

isobutanol (ISO)

ivermectin (ISO)

L-methionine (ISO)

lead(0) (ISO)

lonafarnib (ISO)

manganese atom (EXP)

manganese(0) (EXP)

methapyrilene (EXP,ISO)

methidathion (ISO)

methimazole (EXP)

methoxychlor (EXP)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

nitroglycerin (EXP)

Nonylphenol (EXP)

oleic acid (ISO)

ozone (EXP)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

phenobarbital (ISO)

pioglitazone (ISO)

piperonyl butoxide (EXP)

pirinixic acid (EXP)

propiconazole (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

succimer (ISO)

T-2 toxin (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (ISO)

thapsigargin (EXP)

thiram (ISO)

tipifarnib (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to nutrient levels (IEA,ISO)

negative regulation of cold-induced thermogenesis (IEA,ISO,ISS)

oligodendrocyte differentiation (IEA,ISO)

positive regulation of oligodendrocyte differentiation (IEA,ISO)

positive regulation of TOR signaling (ISO,ISS)

positive regulation of TORC1 signaling (IEA,ISO,ISS)

regulation of neuronal synaptic plasticity (NAS)

regulation of postsynapse organization (IDA,IMP)

regulation of TOR signaling (ISO)

regulation of type B pancreatic cell development (IEA,ISO)

signal transduction (IEA)

small GTPase-mediated signal transduction (IBA,IDA)

Cellular Component

cytosol (IEA)

dendrite (IDA)

endomembrane system (ISO,ISS)

endoplasmic reticulum membrane (IEA)

glutamatergic synapse (IDA,IMP)

Golgi membrane (IEA,ISO)

lysosomal membrane (IEA,ISO,ISS)

membrane (IEA)

neuronal cell body (IDA)

plasma membrane (IBA)

postsynaptic density (IEA,ISO)

spliceosomal complex (IEA,ISO)

synapse (ISO)

Molecular Function

GDP binding (IBA,IDA,IEA,ISO)

GTP binding (IBA,IDA,IEA,ISO)

GTPase activity (IBA,IDA,IEA,ISO)

magnesium ion binding (IEA,ISO)

protein binding (IPI,ISO)

protein kinase activator activity (ISO,ISS)

protein kinase binding (IEA,ISO)

protein serine/threonine kinase activator activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

insulin signaling pathway (IEA)

mTOR signaling pathway (IDA,IEA,ISO)

Rheb mediated signaling pathway (TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	The Rheb family of GTP-binding proteins.	Aspuria PJ and Tamanoi F, Cell Signal. 2004 Oct;16(10):1105-12.
2.	Regulation of mTORC1 by PI3K signaling.	Dibble CC and Cantley LC, Trends Cell Biol. 2015 Sep;25(9):545-55. doi: 10.1016/j.tcb.2015.06.002. Epub 2015 Jul 6.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Regulation of B-Raf kinase activity by tuberin and Rheb is mammalian target of rapamycin (mTOR)-independent.	Karbowniczek M, etal., J Biol Chem. 2004 Jul 16;279(29):29930-7. Epub 2004 May 18.
6.	Molecular mechanisms of mTOR-mediated translational control.	Ma XM and Blenis J, Nat Rev Mol Cell Biol. 2009 May;10(5):307-18. Epub 2009 Apr 2.
7.	Role of insulin, adipocyte hormones, and nutrient-sensing pathways in regulating fuel metabolism and energy homeostasis: a nutritional perspective of diabetes, obesity, and cancer.	Marshall S Sci STKE. 2006 Aug 1;2006(346):re7.
8.	Rheb Inhibits Beiging of White Adipose Tissue via PDE4D5-Dependent Downregulation of the cAMP-PKA Signaling Pathway.	Meng W, etal., Diabetes. 2017 May;66(5):1198-1213. doi: 10.2337/db16-0886. Epub 2017 Feb 27.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
13.	GOA pipeline	RGD automated data pipeline
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Brain-derived neurotrophic factor induces mammalian target of rapamycin-dependent local activation of translation machinery and protein synthesis in neuronal dendrites.	Takei N, etal., J Neurosci. 2004 Nov 3;24(44):9760-9.
16.	Nutrients suppress phosphatidylinositol 3-kinase/Akt signaling via raptor-dependent mTOR-mediated insulin receptor substrate 1 phosphorylation.	Tzatsos A and Kandror KV, Mol Cell Biol. 2006 Jan;26(1):63-76.
17.	rheb, a growth factor- and synaptic activity-regulated gene, encodes a novel Ras-related protein.	Yamagata K, etal., J Biol Chem 1994 Jun 10;269(23):16333-9.
18.	Activation of Rheb, but not of mTORC1, impairs spine synapse morphogenesis in tuberous sclerosis complex.	Yasuda S, etal., Sci Rep. 2014 Jun 3;4:5155. doi: 10.1038/srep05155.

Additional References at PubMed

PMID:11555636	PMID:12477932	PMID:15489334	PMID:15728574	PMID:17074751	PMID:18722381	PMID:18842593	PMID:19056867	PMID:19258434	PMID:19636840	PMID:20381137	PMID:20458337
PMID:21336308	PMID:22294621	PMID:23376485	PMID:25385233	PMID:25411504	PMID:25880340	PMID:26245968	PMID:27865617	PMID:27898073	PMID:28025572	PMID:29287199	PMID:30053369
PMID:34673407

Genomics

Comparative Map Data

Rheb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	11,012,173 - 11,053,860 (+)	NCBI		GRCr8
mRatBN7.2	4	10,278,970 - 10,320,160 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	10,279,370 - 10,320,160 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	15,278,765 - 15,319,243 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	11,093,025 - 11,133,503 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	9,445,606 - 9,486,084 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	6,827,429 - 6,873,384 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	6,827,429 - 6,873,383 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	6,843,897 - 6,889,004 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	4	3,156 - 43,581 (-)	NCBI		Celera
Cytogenetic Map	4	q11	NCBI

RHEB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	151,466,012 - 151,519,895 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	151,466,012 - 151,520,120 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	151,163,098 - 151,216,981 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	150,794,031 - 150,847,943 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	150,601,443 - 150,654,657	NCBI
Celera	7	145,720,573 - 145,774,491 (-)	NCBI		Celera
Cytogenetic Map	7	q36.1	NCBI
HuRef	7	144,974,671 - 145,028,586 (-)	NCBI		HuRef
CHM1_1	7	151,171,499 - 151,225,408 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	152,638,843 - 152,692,729 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	150,492,679 - 150,546,598 (-)	NCBI

Rheb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	25,007,821 - 25,047,359 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	25,007,821 - 25,047,622 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	24,802,823 - 24,842,361 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	24,802,823 - 24,842,624 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	24,308,641 - 24,348,179 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	24,312,888 - 24,352,426 (-)	NCBI		MGSCv36	mm8
Celera	5	21,753,578 - 21,793,634 (-)	NCBI		Celera
Cytogenetic Map	5	A3	NCBI
cM Map	5	11.93	NCBI

Rheb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955491	5,794,911 - 5,834,912 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955491	5,795,040 - 5,833,897 (-)	NCBI	ChiLan1.0	ChiLan1.0

RHEB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	187,889,998 - 187,943,262 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	39,900,264 - 39,953,504 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	143,054,747 - 143,108,011 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	155,203,244 - 155,235,404 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

RHEB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	15,439,910 - 15,483,489 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	15,434,111 - 15,483,419 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	16,047,342 - 16,090,853 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	17,162,021 - 17,205,547 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	17,156,207 - 17,205,573 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	15,534,296 - 15,577,817 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	16,115,524 - 16,159,011 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	16,166,245 - 16,209,781 (-)	NCBI		UU_Cfam_GSD_1.0

Rheb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	6,025,492 - 6,071,143 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936527	6,832,169 - 6,878,164 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936527	6,832,286 - 6,877,938 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RHEB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	5,779,212 - 5,822,257 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	5,779,439 - 5,821,839 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	6,029,721 - 6,072,123 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RHEB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	119,652,692 - 119,704,833 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	119,652,127 - 119,703,458 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666072	15,623,250 - 15,675,215 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rheb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624800	5,221,605 - 5,264,965 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624800	5,221,630 - 5,262,980 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rheb
109 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	278
Count of miRNA genes:	207
Interacting mature miRNAs:	222
Transcripts:	ENSRNOT00000071737
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	57114705	Rat
8552903	Pigfal2	Plasma insulin-like growth factor 1 level QTL 2	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	1	31934116	Rat
724557	Plsm1	Polydactyly-luxate syndrome (PLS) morphotypes QTL 1		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	4	1	27716890	Rat
9590100	Sffal4	Serum free fatty acids level QTL 4	7.36	0.05	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	4	1	31934116	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	10084089	55084089	Rat
1357341	Gluco5	Glucose level QTL 5	6.4		adipocyte free fatty acid secretion trait (VT:0010465)	absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446)	4	1	33250345	Rat
1357343	Gluco4	Glucose level QTL 4		0.00002	adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	4	1	33250345	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	10084089	55084089	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5219178	56647776	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	10084089	55084089	Rat
61333	Gluco16	Glucose level QTL 16	4.3	0.00001	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	1	30372989	Rat
634323	Hc2	Hypercalciuria QTL 2	2.15		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	4	210796	45210796	Rat
61408	Scl23	Serum cholesterol level QTL 23		0.0005	blood HDL phospholipid amount (VT:0010504)	serum high density lipoprotein phospholipid level (CMO:0001567)	4	1	27716890	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	9940885	44463908	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	10084089	55084089	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
9589046	Scfw2	Subcutaneous fat weight QTL 2	5.54	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	4	1	31934116	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	10084089	55084089	Rat
61351	Bp33	Blood pressure QTL 33		0.0018	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	1	27716890	Rat
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	39505420	Rat
1641905	Colcr1	Colorectal carcinoma resistance QTL 1	4.3	0.0003	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	4	1	29494328	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
1358201	Gluco12	Glucose level QTL12	1.6		adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake (CMO:0000870)	4	5218392	29593287	Rat
738021	Hcar13	Hepatocarcinoma resistance QTL 13	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	4	1	32584199	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	10084089	55084089	Rat
9589097	Slep11	Serum leptin concentration QTL 11	5.09	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	4	1	31934116	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10024901	39524530	Rat

Markers in Region

RHEB

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	10,319,613 - 10,319,858 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	6,872,910 - 6,873,154	NCBI	Rnor6.0
Rnor_5.0	4	6,888,530 - 6,888,774	UniSTS	Rnor5.0
Celera	4	3,386 - 3,630	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013216	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285650	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088857	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474057	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212847	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214530	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U08227	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000071737 ⟹ ENSRNOP00000063915

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	10,279,370 - 10,320,160 (+)	Ensembl
Rnor_6.0 Ensembl	4	6,827,429 - 6,873,383 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108274 ⟹ ENSRNOP00000083387

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	10,291,585 - 10,320,160 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113919 ⟹ ENSRNOP00000086692

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	10,279,973 - 10,320,160 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114997 ⟹ ENSRNOP00000095272

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	10,279,370 - 10,320,160 (+)	Ensembl

RefSeq Acc Id:

NM_013216 ⟹ NP_037348

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	11,013,383 - 11,053,860 (+)	NCBI
mRatBN7.2	4	10,279,606 - 10,320,088 (+)	NCBI
Rnor_6.0	4	6,827,429 - 6,873,384 (+)	NCBI
Rnor_5.0	4	6,843,897 - 6,889,004 (+)	NCBI
Celera	4	3,156 - 43,581 (-)	RGD

Sequence:

show sequence

GCGCCCGCCGCCGCGCTCTGTATGCCGCGTTCCCCCGGCGCACCCGCCGCCGATAGTCTGAGCC
GGAGGAGTCGCCGCCGCTGCGGTTGATGTGGTTGGGCCGGGGCTGACCAGGCTACCAAGATGCC
TCAGTCCAAGTCCCGGAAGATCGCCATCCTGGGCTATCGGTCTGTGGGAAAGTCCTCATTGACA
ATTCAGTTTGTTGAAGGTCAATTTGTTGATTCCTACGATCCAACCATAGAAAACACATTCACCA
AGCTGATCACAGTAAATGGGCAAGAGTATCATCTTCAGCTTGTAGACACAGCAGGGCAGGATGA
ATATTCCATTTTTCCTCAGACATACTCCATAGATATTAATGGTTATATTCTTGTGTATTCTGTT
ACATCAATCAAAAGCTTTGAAGTAATTAAAGTTATCCACGGCAAGCTGTTGGACATGGTGGGGA
AAGTGCAGATACCGATTATGTTAGTCGGAAATAAGAAGGACCTGCATATGGAAAGGGTGATCAG
TTATGAAGAAGGAAAGGCTTTGGCAGAATCTTGGAATGCAGCTTTTTTGGAATCTTCTGCAAAA
GAAAATCAGACTGCTGTGGATGTTTTTAGAAGGATAATTTTGGAAGCAGAAAAGATTGACGGAG
CGGCTTCACAAGGGAAGTCTTCGTGCTCGGTGATGTGACGCGCCTGCTGCAGAGCCTGAGTGTA
TTCCACCTGAGGAAGCAAGCTGCCTGTCATCCTTGAAGATAAAACTAGGCTTCTGTTTTCTTCT
GTTAACCTGAACGATGTCATTTGGGTCAGAGGTCCTCCCCTCTCAGATTATGTTAACGTCTGAC
TCTGTCCAAATGAGTTCACTTCCATTTTCAAATTTTAAACAATCATATTTTCAATTTATATATT
GTATTTCTTAATATTATGACCAAGAATTTTATCGGCATTAATTTTTCAGTGTAGTTTGTTGTTT
AAAATAATGTAATCATCAAAATGATACACGTTACACTACTATTAGCTAGGCTTCAGTCTATCAG
TGTTTATCTCCTTGTGTTAAATGTATACTTGTAAATAAAGTAGCTGCAAACCTTAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063285650 ⟹ XP_063141720

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	11,012,173 - 11,053,391 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_037348	(Get FASTA)	NCBI Sequence Viewer
	XP_063141720	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA21380	(Get FASTA)	NCBI Sequence Viewer
	AAH88857	(Get FASTA)	NCBI Sequence Viewer
	EDL86374	(Get FASTA)	NCBI Sequence Viewer
	EDL86375	(Get FASTA)	NCBI Sequence Viewer
	EDL86376	(Get FASTA)	NCBI Sequence Viewer
	EDL86377	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000063915
	ENSRNOP00000063915.3
	ENSRNOP00000083387.1
	ENSRNOP00000086692.1
	ENSRNOP00000095272.1
	ENSRNOP00055031296
	ENSRNOP00060033296
	ENSRNOP00065004255
GenBank Protein	Q62639	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_037348 ⟸ NM_013216
- UniProtKB:	Q62639 (UniProtKB/Swiss-Prot), A6KJH3 (UniProtKB/TrEMBL), M0R3K1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQ DEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERV ISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSSCSVM hide sequence

Ensembl Acc Id:

ENSRNOP00000063915 ⟸ ENSRNOT00000071737

Ensembl Acc Id:

ENSRNOP00000095272 ⟸ ENSRNOT00000114997

Ensembl Acc Id:

ENSRNOP00000086692 ⟸ ENSRNOT00000113919

Ensembl Acc Id:

ENSRNOP00000083387 ⟸ ENSRNOT00000108274

RefSeq Acc Id:	XP_063141720 ⟸ XM_063285650
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62639-F1-model_v2	AlphaFold	Q62639	1-184	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692784

Promoter ID:

EPDNEW_R3307

Type:

initiation region

Name:

Rheb_1

Description:

Ras homolog, mTORC1 binding

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	6,827,394 - 6,827,454	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621840	AgrOrtholog
BioCyc Gene	G2FUF-46063	BioCyc
Ensembl Genes	ENSRNOG00000050578	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055022385	UniProtKB/Swiss-Prot
	ENSRNOG00060023259	UniProtKB/Swiss-Prot
	ENSRNOG00065004059	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000071737	UniProtKB/TrEMBL
	ENSRNOT00000071737.3	UniProtKB/Swiss-Prot
	ENSRNOT00000108274.1	UniProtKB/TrEMBL
	ENSRNOT00000113919.1	UniProtKB/TrEMBL
	ENSRNOT00000114997.1	UniProtKB/TrEMBL
	ENSRNOT00055038470	UniProtKB/Swiss-Prot
	ENSRNOT00060040324	UniProtKB/Swiss-Prot
	ENSRNOT00065005931	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7307969	IMAGE-MGC_LOAD
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase_Ras-type	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:26954	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:105484	IMAGE-MGC_LOAD
NCBI Gene	26954	ENTREZGENE
PANTHER	PTHR24070	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR24070:SF264	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Ras	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rheb	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	RAB	UniProtKB/TrEMBL
	RAS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RHO	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000050578	RatGTEx
	ENSRNOG00055022385	RatGTEx
	ENSRNOG00060023259	RatGTEx
	ENSRNOG00065004059	RatGTEx
SMART	RAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RHO	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZVS8_RAT	UniProtKB/TrEMBL
	A0A8I6A6R1_RAT	UniProtKB/TrEMBL
	A0A8I6AN58_RAT	UniProtKB/TrEMBL
	A6KJH2_RAT	UniProtKB/TrEMBL
	A6KJH3	ENTREZGENE, UniProtKB/TrEMBL
	A6KJH4_RAT	UniProtKB/TrEMBL
	A6KJH5_RAT	UniProtKB/TrEMBL
	M0R3K1	ENTREZGENE, UniProtKB/TrEMBL
	Q62639	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-08-22	Rheb	Ras homolog, mTORC1 binding	Rheb	Ras homolog enriched in brain	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Rheb	Ras homolog enriched in brain			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Rheb	Ras homolog enriched in brain			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	mRNA expression increases in response to seizures and to NMDA-dependent synaptic activity	729721

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)