Atp5f1b (ATP synthase F1 subunit beta)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Atp5f1b (ATP synthase F1 subunit beta) Rattus norvegicus

Analyze

Symbol:

Atp5f1b

Name:

ATP synthase F1 subunit beta

RGD ID:

621368

Description:

Enables adenyl ribonucleotide binding activity; calcium ion binding activity; and lipoprotein particle receptor activity. Contributes to ATP hydrolysis activity. Involved in several processes, including cold acclimation; response to 3,3',5-triiodo-L-thyronine; and response to curcumin. Located in cell surface; membrane raft; and mitochondrial inner membrane. Part of mitochondrial proton-transporting ATP synthase complex, catalytic sector F(1). Used to study obesity. Biomarker of cardiomyopathy; polycystic ovary syndrome; transient cerebral ischemia; and type 2 diabetes mellitus. Orthologous to human ATP5F1B (ATP synthase F1 subunit beta); PARTICIPATES IN electron transport chain pathway; Alzheimer's disease pathway; Huntington's disease pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1,3-dinitrobenzene; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ATP synthase subunit beta, mitochondrial; ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit; ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide; Atp5b; mitochondrial ATP synthase beta subunit

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATP5F1B (ATP synthase F1 subunit beta)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Atp5f1b (ATP synthase F1 subunit beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Atp5f1b (ATP synthase F1 subunit beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATP5F1B (ATP synthase F1 subunit beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ATP5F1B (ATP synthase F1 subunit beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atp5f1b (ATP synthase F1 subunit beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ATP5F1B (ATP synthase F1 subunit beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ATP5F1B (ATP synthase F1 subunit beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atp5f1b (ATP synthase F1 subunit beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ATP5F1B (ATP synthase F1 subunit beta)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Atp5f1b (ATP synthase F1 subunit beta)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	atp5f1b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ATP2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ATPsynbeta	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	atp-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	atp5f1b	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	515,454 - 521,858 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	515,460 - 567,273 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	3,274,116 - 3,280,516 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	5,150,130 - 5,156,530 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	5,451,361 - 5,457,743 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	2,504,708 - 2,511,748 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	2,504,695 - 2,511,749 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	2,484,095 - 2,490,338 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	1,376,552 - 1,383,228 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	1,377,178 - 1,383,228 (+)	NCBI
Celera	7	394,648 - 401,125 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute kidney failure (ISO)

cardiomyopathy (IEP)

COVID-19 (ISO)

Diabetic Nephropathies (IDA)

Experimental Diabetes Mellitus (IEP)

Fetal Growth Retardation (IEP)

genetic disease (ISO)

Hypermetabolism due to Defect in Mitochondria (ISO)

HYPERMETABOLISM DUE TO UNCOUPLED MITOCHONDRIAL OXIDATIVE PHOSPHORYLATION 2 (ISO)

Hypoxia (ISO)

Liver Injury (IEP)

non-alcoholic fatty liver disease (ISO)

obesity (IDA)

polycystic ovary syndrome (IEP)

pre-malignant neoplasm (ISO)

spinocerebellar ataxia type 17 (ISO)

transient cerebral ischemia (IEP)

type 2 diabetes mellitus (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(Z)-3-butylidenephthalide (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,2,2-tetramine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-methyl-2-[4-(1,2,3,4-tetrahydronaphthalen-1-yl)phenoxy]propanoic acid (EXP)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

7,12-dimethyltetraphene (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

amiodarone (EXP)

ammonium chloride (EXP)

aniline (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (EXP)

arsane (EXP,ISO)

arsenic atom (EXP,ISO)

atrazine (ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bleomycin A2 (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

captan (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

choline (ISO)

chromium trinitrate (ISO)

clobetasol (ISO)

clofibrate (EXP)

clozapine (EXP)

cocaine (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diclofenac (EXP)

diethyl maleate (EXP)

dioxygen (ISO)

diuron (EXP)

doxorubicin (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

fenpyroximate (ISO)

flavonoids (EXP)

folic acid (ISO)

folpet (ISO)

fulvestrant (ISO)

furan (EXP)

glyphosate (EXP,ISO)

gold atom (ISO)

gold(0) (ISO)

hyaluronic acid (EXP)

hydrogen peroxide (EXP,ISO)

isoflavones (EXP)

isoniazide (ISO)

ivermectin (ISO)

josamycin (ISO)

L-ascorbic acid (ISO)

L-methionine (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

lithium atom (EXP)

lithium hydride (EXP)

methamphetamine (EXP)

methapyrilene (EXP)

methoxychlor (EXP)

mitoxantrone (ISO)

N,N-diethyl-m-toluamide (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosomorpholine (EXP)

nafenopin (EXP)

naphthalene (ISO)

nicotinic acid (ISO)

nitric oxide (ISO)

Nonylphenol (EXP)

ochratoxin A (ISO)

oxybenzone (EXP)

paracetamol (ISO)

paraoxon (ISO)

perfluorooctanoic acid (ISO)

permethrin (EXP)

phenethyl isothiocyanate (ISO)

PhIP (EXP)

pioglitazone (ISO)

piperonyl butoxide (EXP)

potassium chromate (ISO)

potassium dichromate (ISO)

procymidone (ISO)

progesterone (EXP)

promethazine (EXP)

Pyridostigmine bromide (EXP)

quercetin (ISO)

rotenone (EXP,ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sodium nitrate (ISO)

streptozocin (EXP)

sulforaphane (ISO)

T-2 toxin (EXP)

tamoxifen (EXP,ISO)

tanespimycin (ISO)

testosterone (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tolcapone (EXP)

toluene (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

troglitazone (ISO)

valproic acid (ISO)

vanadium atom (ISO)

vanadium(0) (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (IEA,ISO)

ATP biosynthetic process (ISO)

cellular response to interleukin-7 (IEA,ISO)

cellular response to peptide (IEP)

cold acclimation (IEP)

lipid metabolic process (IEA,ISO)

liver development (IEP)

negative regulation of cell adhesion involved in substrate-bound cell migration (IEA,ISO)

positive regulation of blood vessel endothelial cell migration (IEA,ISO)

proton motive force-driven mitochondrial ATP synthesis (IBA,IEA,ISO)

proton transmembrane transport (IEA,ISO)

receptor-mediated endocytosis (IDA)

regulation of intracellular pH (IEA,ISO)

response to 3,3',5-triiodo-L-thyronine (IEP)

response to curcumin (IEP)

response to manganese ion (IEP)

Cellular Component

cell surface (IDA,IEA,ISO)

membrane (ISO)

membrane raft (IDA)

mitochondrial inner membrane (IDA)

mitochondrial membrane (ISO)

mitochondrial nucleoid (IEA,ISO)

mitochondrial proton-transporting ATP synthase complex (IBA,IDA,IEA,ISO)

mitochondrial proton-transporting ATP synthase complex, catalytic sector F(1) (IDA)

mitochondrion (ISO)

plasma membrane (IEA,ISO)

proton-transporting ATP synthase complex (ISO)

proton-transporting ATP synthase complex, catalytic core F(1) (IBA,IDA,IEA)

Molecular Function

ADP binding (IDA)

angiostatin binding (IEA,ISO)

ATP binding (IDA,IEA,IPI)

ATP hydrolysis activity (IDA,IEA)

calcium ion binding (IDA)

lipoprotein particle receptor activity (IDA)

MHC class I protein binding (IEA,ISO)

protein binding (ISO)

proton-transporting ATP synthase activity, rotational mechanism (IBA,IEA,ISO,ISS)

proton-transporting ATPase activity, rotational mechanism (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Alzheimer's disease pathway (IEA)

electron transport chain pathway (ISO)

Huntington's disease pathway (IEA)

oxidative phosphorylation pathway (IEA)

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	ATP synthase subunit c expression: physiological regulation of the P1 and P2 genes.	Andersson U, etal., Biochem J. 1997 Apr 15;323 ( Pt 2):379-85.
2.	Mitochondrial ATP synthase. Quaternary structure of the F1 moiety at 3.6 A determined by x-ray diffraction analysis.	Bianchet M, etal., J Biol Chem. 1991 Nov 5;266(31):21197-201.
3.	Quantitative neuroproteomics of an in vivo rodent model of focal cerebral ischemia/reperfusion injury reveals a temporal regulation of novel pathophysiological molecular markers.	Datta A, etal., J Proteome Res. 2011 Nov 4;10(11):5199-213. doi: 10.1021/pr200673y. Epub 2011 Oct 20.
4.	Beta subunit of rat liver mitochondrial ATP synthase: cDNA cloning, amino acid sequence, expression in Escherichia coli, and structural relationship to adenylate kinase.	Garboczi DN, etal., Biochemistry 1988 Jan 26;27(2):553-60.
5.	Mitochondrial ATP synthase. Overexpression in Escherichia coli of a rat liver beta subunit peptide and its interaction with adenine nucleotides.	Garboczi DN, etal., J Biol Chem. 1988 Oct 25;263(30):15694-8.
6.	Rat liver mitochondrial ATP synthase. Effects of mutations in the glycine-rich region of a beta subunit peptide on its interaction with adenine nucleotides.	Garboczi DN, etal., J Biol Chem. 1990 Aug 25;265(24):14632-7.
7.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.	Detection of differential proteomes associated with the development of type 2 diabetes in the Zucker rat model using the iTRAQ technique.	Han D, etal., J Proteome Res. 2011 Feb 4;10(2):564-77. doi: 10.1021/pr100759a. Epub 2010 Dec 20.
9.	Mitochondrial ATP synthase F1-beta-subunit is a calcium-binding protein.	Hubbard MJ and McHugh NJ, FEBS Lett. 1996 Aug 12;391(3):323-9.
10.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
11.	Mitochondrial F(0)F(1) ATP synthase. Subunit regions on the F1 motor shielded by F(0), Functional significance, and evidence for an involvement of the unique F(0) subunit F(6).	Ko YH, etal., J Biol Chem. 2000 Oct 20;275(42):32931-9.
12.	Proteomic characterisation of neuronal sphingolipid-cholesterol microdomains: role in plasminogen activation.	Ledesma MD, etal., Brain Res. 2003 Oct 10;987(1):107-16.
13.	ATP synthase ß-subunit abnormality in pancreas islets of rats with polycystic ovary syndrome and type 2 diabetes mellitus.	Li W, etal., J Huazhong Univ Sci Technolog Med Sci. 2017 Apr;37(2):210-216. doi: 10.1007/s11596-017-1717-9. Epub 2017 Apr 11.
14.	[Screening of differentially expressed genes in rats with cardiomyopathy after bone marrow mesenchymal stem cell transplantation].	Li Y, etal., Zhonghua Er Ke Za Zhi. 2006 Oct;44(10):787-91.
15.	Translational regulation of mitochondrial differentiation in neonatal rat liver. Specific increase in the translational efficiency of the nuclear-encoded mitochondrial beta-F1-ATPase mRNA.	Luis AM, etal., J Biol Chem. 1993 Jan 25;268(3):1868-75.
16.	Ectopic beta-chain of ATP synthase is an apolipoprotein A-I receptor in hepatic HDL endocytosis.	Martinez LO, etal., Nature 2003 Jan 2;421(6918):75-9.
17.	Identification of two proteins associated with mammalian ATP synthase.	Meyer B, etal., Mol Cell Proteomics. 2007 Oct;6(10):1690-9. Epub 2007 Jun 17.
18.	Pharmacological inhibition of galectin-1 by lactulose alleviates weight gain in diet-induced obese rats.	Mukherjee R and Yun JW, Life Sci. 2016 Mar 1;148:112-7. doi: 10.1016/j.lfs.2016.02.018. Epub 2016 Feb 13.
19.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
20.	Coupling factor 6 enhances Src-mediated responsiveness to angiotensin II in resistance arterioles and cells.	Osanai T, etal., Cardiovasc Res. 2009 Mar 1;81(4):780-7. doi: 10.1093/cvr/cvn356. Epub 2008 Dec 22.
21.	Mitochondrial ATP synthase: dramatic Mg2+-induced alterations in the structure and function of the F1-ATPase moiety.	Pedersen PL, etal., Biochemistry. 1987 Dec 29;26(26):8631-7.
22.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
23.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
24.	Overdose Intake of Curcumin Initiates the Unbalanced State of Bodies.	Qiu P, etal., J Agric Food Chem. 2016 Apr 6;64(13):2765-71. doi: 10.1021/acs.jafc.6b00053. Epub 2016 Mar 25.
25.	Application of a discovery to targeted LC-MS proteomics approach to identify deregulated proteins associated with idiosyncratic liver toxicity in a rat model of LPS/diclofenac co-administration.	Ramm S, etal., Toxicology. 2015 May 4;331:100-11. doi: 10.1016/j.tox.2015.03.004. Epub 2015 Mar 13.
26.	GOA pipeline	RGD automated data pipeline
27.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
28.	Proteomic characterization of early changes induced by triiodothyronine in rat liver.	Severino V, etal., J Proteome Res. 2011 Jul 1;10(7):3212-24. Epub 2011 Jun 1.
29.	Proteomic Analysis of One-carbon Metabolism-related Marker in Liver of Rat Offspring.	You YA, etal., Mol Cell Proteomics. 2015 Nov;14(11):2901-9. doi: 10.1074/mcp.M114.046888. Epub 2015 Sep 4.
30.	Proteome analysis of rat pancreatic acinar cells: implication for cerulein-induced acute pancreatitis.	Yu JH, etal., Proteomics. 2003 Dec;3(12):2446-53. doi: 10.1002/pmic.200300545.
31.	Telmisartan improves kidney function through inhibition of the oxidative phosphorylation pathway in diabetic rats.	Zhang Q, etal., J Mol Endocrinol. 2012 Jun 26;49(1):35-46. doi: 10.1530/JME-12-0020. Print 2012 Aug.
32.	Changes in the brain mitochondrial proteome of male Sprague-Dawley rats treated with manganese chloride.	Zhang S, etal., Toxicol Appl Pharmacol. 2005 Jan 1;202(1):13-7.

Additional References at PubMed

PMID:2522775	PMID:2531579	PMID:2870059	PMID:2907347	PMID:8006588	PMID:9736690	PMID:10077593	PMID:12110673	PMID:12477932	PMID:12865426	PMID:14651853	PMID:14673794
PMID:15489334	PMID:15572201	PMID:16210410	PMID:16751257	PMID:16854843	PMID:17303654	PMID:17510399	PMID:17612527	PMID:17634366	PMID:17643490	PMID:17675573	PMID:17709438
PMID:18063578	PMID:18510804	PMID:18614015	PMID:19056867	PMID:19199708	PMID:19808025	PMID:19946888	PMID:20458337	PMID:20833797	PMID:21106936	PMID:21630459	PMID:21926988
PMID:22082260	PMID:23106098	PMID:23376485	PMID:23533145	PMID:23979707	PMID:24042457	PMID:24625528	PMID:25931508	PMID:26316108	PMID:26767982	PMID:26769832	PMID:29476059
PMID:29581031	PMID:29867124	PMID:30552345	PMID:32357304

Genomics

Comparative Map Data

Atp5f1b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	515,454 - 521,858 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	515,460 - 567,273 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	3,274,116 - 3,280,516 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	5,150,130 - 5,156,530 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	5,451,361 - 5,457,743 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	2,504,708 - 2,511,748 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	2,504,695 - 2,511,749 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	2,484,095 - 2,490,338 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	1,376,552 - 1,383,228 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	1,377,178 - 1,383,228 (+)	NCBI
Celera	7	394,648 - 401,125 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

ATP5F1B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	56,638,175 - 56,645,984 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	56,638,175 - 56,645,984 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	57,031,959 - 57,039,768 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	55,318,226 - 55,326,119 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	55,318,227 - 55,326,119	NCBI
Celera	12	56,683,671 - 56,691,564 (-)	NCBI		Celera
Cytogenetic Map	12	q13.3	NCBI
HuRef	12	54,071,237 - 54,079,130 (-)	NCBI		HuRef
CHM1_1	12	56,999,492 - 57,007,379 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	56,606,172 - 56,613,970 (-)	NCBI		T2T-CHM13v2.0

Atp5f1b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	127,919,176 - 127,926,257 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	127,919,142 - 127,926,260 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	128,083,307 - 128,090,388 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	128,083,273 - 128,090,391 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	127,520,363 - 127,527,444 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	127,486,256 - 127,493,337 (+)	NCBI		MGSCv36	mm8
Celera	10	130,478,043 - 130,485,124 (+)	NCBI		Celera
Cytogenetic Map	10	D3	NCBI
cM Map	10	76.39	NCBI

Atp5f1b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955458	4,186,461 - 4,195,494 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955458	4,188,167 - 4,195,575 (-)	NCBI	ChiLan1.0	ChiLan1.0

ATP5F1B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	12	37,677,947 - 37,685,879 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	32,264,570 - 32,272,419 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	32,519,749 - 32,527,753 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	32,519,749 - 32,527,753 (+)	Ensembl	panpan1.1		panPan2

ATP5F1B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	870,405 - 876,937 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	870,392 - 909,161 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	933,592 - 940,127 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	879,724 - 886,261 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	879,724 - 919,087 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	856,580 - 863,114 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	1,099,743 - 1,106,277 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	1,223,513 - 1,230,049 (-)	NCBI		UU_Cfam_GSD_1.0

Atp5f1b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	57,911,328 - 57,918,999 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936646	951,236 - 958,907 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATP5F1B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	21,984,580 - 21,992,407 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	21,984,750 - 21,992,393 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	23,659,081 - 23,666,726 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATP5F1B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	52,587,608 - 52,600,057 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	52,587,143 - 52,600,756 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	193,380,244 - 193,389,154 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atp5f1b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624802	11,399,474 - 11,409,700 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624802	11,400,288 - 11,408,785 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Atp5f1b
20 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	37
Count of miRNA genes:	35
Interacting mature miRNAs:	37
Transcripts:	ENSRNOT00000003965
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat

Markers in Region

ATP5B

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	516,480 - 516,617 (+)	MAPPER	mRatBN7.2
mRatBN7.2	2	29,136,039 - 29,136,176 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	25,599,724 - 25,599,860	NCBI	Rnor6.0
Rnor_6.0	7	2,505,735 - 2,505,871	NCBI	Rnor6.0
Rnor_5.0	7	2,485,122 - 2,485,258	UniSTS	Rnor5.0
Rnor_5.0	2	44,754,009 - 44,754,145	UniSTS	Rnor5.0
RGSC_v3.4	2	28,334,600 - 28,334,736	UniSTS	RGSC3.4
RGSC_v3.4	7	1,377,579 - 1,377,715	UniSTS	RGSC3.4
Celera	7	395,675 - 395,811	UniSTS
Celera	2	25,173,156 - 25,173,292	UniSTS
Cytogenetic Map	2	q12	UniSTS
Cytogenetic Map	7	q11	UniSTS

RH127966

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	520,984 - 521,753 (+)	MAPPER	mRatBN7.2
mRatBN7.2	2	29,137,525 - 29,137,741 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	25,601,210 - 25,601,425	NCBI	Rnor6.0
Rnor_6.0	7	2,510,875 - 2,511,643	NCBI	Rnor6.0
Rnor_5.0	7	2,489,465 - 2,490,233	UniSTS	Rnor5.0
Rnor_5.0	2	44,755,495 - 44,755,710	UniSTS	Rnor5.0
RGSC_v3.4	2	28,336,799 - 28,337,015	UniSTS	RGSC3.4
RGSC_v3.4	7	1,382,355 - 1,383,123	UniSTS	RGSC3.4
Celera	7	400,252 - 401,020	UniSTS
Celera	2	25,174,642 - 25,174,857	UniSTS
Cytogenetic Map	2	q12	UniSTS
Cytogenetic Map	7	q11	UniSTS

AW549786

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	521,016 - 521,655 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	2,510,907 - 2,511,545	NCBI	Rnor6.0
Rnor_5.0	7	2,489,497 - 2,490,135	UniSTS	Rnor5.0
RGSC_v3.4	7	1,382,387 - 1,383,025	UniSTS	RGSC3.4
Celera	7	400,284 - 400,922	UniSTS
Cytogenetic Map	7	q11	UniSTS

MARC_26134-26135:1030377217:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	517,347 - 517,923 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	2,506,602 - 2,507,177	NCBI	Rnor6.0
Rnor_5.0	7	2,485,989 - 2,486,564	UniSTS	Rnor5.0
RGSC_v3.4	7	1,378,446 - 1,379,021	UniSTS	RGSC3.4
Celera	7	396,542 - 397,117	UniSTS
Cytogenetic Map	7	q11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High	3	43	53	41	4	41	8	11	70	35	27		8
Medium			4		15				4		14	11
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_134364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC087041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474104	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ403101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214851	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223600	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231816	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000171	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M19044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M25301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M57634	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000003965 ⟹ ENSRNOP00000003965

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	515,460 - 567,273 (+)	Ensembl
Rnor_6.0 Ensembl	7	2,504,695 - 2,511,749 (+)	Ensembl

RefSeq Acc Id:

NM_134364 ⟹ NP_599191

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	7	515,454 - 521,858 (+)	NCBI
Rnor_6.0	7	2,504,708 - 2,511,748 (+)	NCBI
Rnor_5.0	7	2,484,095 - 2,490,338 (+)	NCBI
RGSC_v3.4	7	1,376,552 - 1,383,228 (+)	RGD
Celera	7	394,648 - 401,125 (+)	RGD

Sequence:

show sequence

CAGTCTCCACCCGGACTCCGCCATGTTGAGTCTTGTGGGGCGTGTGGCCTCGGCCTCGGCCTCC
GGGGCCTTACGGGGACTCAACCCTTTGGCGGCGCTGCCACAGGCGCATCTTCTACTACGAACCG
CTCCCGCCGGGGTCCATCCTGCCAGAGACTATGCGGCGCAGTCGTCTGCGGCCCCGAAGGCAGG
CACCGCCACCGGGCAAATTGTGGCAGTCATCGGCGCCGTTGTGGATGTCCAGTTCGATGAGGGA
TTACCACCTATCCTAAATGCCTTGGAAGTGCAAGGCAGGGAGAGCAGACTGGTTTTGGAGGTAG
CCCAGCATTTAGGGGAGAGCACCGTCAGAACTATTGCTATGGATGGCACTGAAGGCTTGGTTAG
AGGCCAGAAAGTACTGGATTCGGGGGCACCAATCAAAATTCCTGTTGGTCCTGAGACCTTGGGC
AGAATCATGAATGTCATTGGAGAACCTATTGATGAGAGAGGTCCTATCAAAACCAAACAATTCG
CTCCTATTCATGCTGAGGCTCCTGAATTCATAGAGATGAGTGTTGAACAGGAAATTCTGGTGAC
TGGTATAAAGGTTGTGGATCTGCTGGCCCCATACGCCAAGGGTGGGAAAATCGGACTCTTCGGA
GGTGCTGGTGTTGGAAAGACAGTACTGATCATGGAGCTAATCAACAATGTTGCTAAAGCCCATG
GTGGTTATTCTGTATTTGCTGGTGTTGGTGAGAGGACCCGTGAGGGCAATGATTTATACCATGA
AATGATTGAGTCTGGTGTTATCAACCTAAAAGATGCCACTTCCAAGGTAGCGTTGGTATATGGG
CAGATGAATGAACCGCCTGGTGCTCGTGCCCGGGTAGCTCTGACTGGTCTGACTGTTGCTGAAT
ACTTCAGAGACCAGGAAGGCCAAGATGTCCTGCTGTTTATTGACAACATCTTCCGCTTCACCCA
GGCTGGCTCAGAGGTATCTGCCTTATTGGGCAGGATCCCGTCTGCTGTAGGCTACCAGCCTACC
CTAGCCACTGACATGGGTACAATGCAGGAAAGAATCACCACCACCAAGAAGGGCTCGATCACCT
CAGTGCAGGCTATCTATGTGCCAGCTGATGACCTGACTGACCCTGCCCCTGCAACTACCTTTGC
CCATTTGGATGCTACTACTGTGCTGTCCCGTGCTATTGCTGAGTTGGGCATCTATCCAGCTGTG
GATCCACTGGACTCCACCTCTCGAATTATGGATCCCAACATCGTTGGCAGTGAGCATTATGATG
TTGCTCGTGGGGTGCAAAAGATCCTGCAGGACTACAAATCTCTCCAGGACATCATTGCCATCTT
GGGTATGGATGAACTTTCTGAGGAAGATAAATTGACTGTGTCCAGGGCAAGGAAGATACAGCGC
TTCTTGTCACAGCCATTCCAGGTTGCTGAGGTCTTCACAGGTCACATGGGAAAGCTGGTGCCCC
TGAAGGAGACCATTAAAGGATTCCAGCAGATCTTAGCAGGTGACTATGACCATCTCCCGGAACA
AGCCTTCTACATGGTGGGACCCATTGAAGAAGCTGTGGCAAAGGCTGACAAGCTGGCAGAGGAG
CATGGGTCGTGAGGGGCCCTTCAGCCAAACACAACAGCACTCTGCACTGACCTCCATGCTGAGA
GCTCAGTTTGCCATGTAGGCCACACAAGAGCCTTGATTGAAGATGTGATGTTCTCTCTGAAGAG
TATTTAAAGTTTTCAATAAAGTATATACCCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_599191	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40778	(Get FASTA)	NCBI Sequence Viewer
	AAA57154	(Get FASTA)	NCBI Sequence Viewer
	AAB02288	(Get FASTA)	NCBI Sequence Viewer
	AAH99743	(Get FASTA)	NCBI Sequence Viewer
	ABD77234	(Get FASTA)	NCBI Sequence Viewer
	EDL84889	(Get FASTA)	NCBI Sequence Viewer
	EDL84890	(Get FASTA)	NCBI Sequence Viewer
	P10719	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_599191 ⟸ NM_134364
- Peptide Label:	precursor
- UniProtKB:	Q499W0 (UniProtKB/Swiss-Prot), P10719 (UniProtKB/Swiss-Prot), A6KSA3 (UniProtKB/TrEMBL), G3V6D3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLSLVGRVASASASGALRGLNPLAALPQAHLLLRTAPAGVHPARDYAAQSSAAPKAGTATGQIV AVIGAVVDVQFDEGLPPILNALEVQGRESRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDS GAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQEILVTGIKVVDL LAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVI NLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSA LLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTV LSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSE EDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGDYDHLPEQAFYMVGP IEEAVAKADKLAEEHGS hide sequence

RefSeq Acc Id:

ENSRNOP00000003965 ⟸ ENSRNOT00000003965

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P10719-F1-model_v2	AlphaFold	P10719	1-529	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621368	AgrOrtholog
BioCyc Gene	G2FUF-35397	BioCyc
BioCyc Pathway	PWY-7980 [ATP biosynthesis]	BioCyc
Ensembl Genes	ENSRNOG00000002840	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000003965	ENTREZGENE
	ENSRNOP00000003965.3	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000003965	ENTREZGENE
	ENSRNOT00000003965.5	UniProtKB/TrEMBL
Gene3D-CATH	2.40.10.170	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7937989	IMAGE-MGC_LOAD
InterPro	AAA+_ATPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATP_synth_F1_bsu	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATPase_a/bsu_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATPase_F1/V1/A1_a/bsu_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATPase_F1/V1/A1_a/bsu_N_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATPase_F1/V1/A1_a/bsu_nucl-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATPase_F1/V1_b/a_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:171374	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124522	IMAGE-MGC_LOAD
NCBI Gene	171374	ENTREZGENE
PANTHER	ATP SYNTHASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATP SYNTHASE SUBUNIT BETA, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ATP-synt_ab	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATP-synt_ab_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Atp5f1b	PhenoGen
PIRSF	ATPase_subunit_beta	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ATPASE_ALPHA_BETA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	AAA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	C-terminal domain of alpha and beta subunits of F1 ATP synthase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF50615	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6KSA3	ENTREZGENE, UniProtKB/TrEMBL
	ATPB_RAT	UniProtKB/Swiss-Prot
	G3V6D3	ENTREZGENE, UniProtKB/TrEMBL
	P10719	ENTREZGENE
	Q499W0	ENTREZGENE
UniProt Secondary	Q499W0	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-11-30	Atp5f1b	ATP synthase F1 subunit beta	Atp5b	ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Atp5b	ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide	Atp5b	ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-22	Atp5b	ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit	Atp5b	ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Atp5b	ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Atp5b	ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)