Hand2 (heart and neural crest derivatives expressed 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Hand2 (heart and neural crest derivatives expressed 2) Rattus norvegicus

Analyze

Symbol:

Hand2

Name:

heart and neural crest derivatives expressed 2

RGD ID:

621207

Description:

Enables DNA-binding transcription factor activity, RNA polymerase II-specific; RNA polymerase II-specific DNA-binding transcription factor binding activity; and transcription coactivator binding activity. Involved in cellular response to organic cyclic compound; cellular response to retinoic acid; and heart development. Located in nucleus. Orthologous to human HAND2 (heart and neural crest derivatives expressed 2); INTERACTS WITH 3,7-dihydropurine-6-thione; acetamide; all-trans-retinoic acid.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2; dHand protein; heart and neural crest derivatives expressed transcript 2; heart- and neural crest derivatives-expressed protein 2; heart- and neural crest derivatives-expressed protein 2-like; LOC103693947

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

NCBI Annotation Information:

Annotation category: partial on reference assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	16	32,917,826 - 32,919,880 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	32,917,823 - 32,919,891 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	36,510,401 - 36,513,743 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	16	39,921,734 - 39,925,076 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	16	36,141,350 - 36,144,691 (-)	NCBI	Rnor_WKY
Rnor_6.0	16	36,371,489 - 36,373,551 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	36,371,489 - 36,373,546 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	36,173,054 - 36,174,762 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	36,324,327 - 36,348,104 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	36,324,401 - 36,326,112 (-)	NCBI
Celera	16	32,856,614 - 32,879,368 (-)	NCBI		Celera
Cytogenetic Map	16	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Disease Models (ISO)

atrial fibrillation (ISO)

Cardiomegaly (IEP,ISO)

congenital heart disease (ISO)

congestive heart failure (ISO)

dilated cardiomyopathy 1A (ISO)

genetic disease (ISO)

neuroblastoma (ISO)

Neurodevelopmental Disorders (ISO)

Right Ventricular Hypertrophy (IEP)

tetralogy of Fallot (ISO)

Ventricular Remodeling (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,7-dihydropurine-6-thione (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

5-formyltetrahydrofolic acid (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

alcohol (ISO)

all-trans-retinoic acid (EXP,ISO)

ammonium chloride (EXP)

arotinoid acid (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

BQ 123 (EXP)

cadmium sulfate (ISO)

CGP 52608 (ISO)

CHIR 99021 (ISO)

cortisol (ISO)

curcumin (ISO)

cytarabine (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

doxorubicin (EXP,ISO)

glycerol 2-phosphate (ISO)

indometacin (ISO)

L-ascorbic acid (ISO)

L-ascorbic acid 2-phosphate (ISO)

lipopolysaccharide (ISO)

mercaptopurine (EXP)

N-nitrosodiethylamine (ISO)

phenobarbital (ISO)

progesterone (ISO)

purine-6-thiol (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

S-adenosyl-L-methioninate (ISO)

S-adenosyl-L-methionine (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

troglitazone (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

XAV939 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult heart development (IEA,ISO)

angiogenesis (IEA)

apoptotic process (ISO)

apoptotic process involved in heart morphogenesis (IEA,ISO)

cardiac neural crest cell development involved in outflow tract morphogenesis (ISO)

cardiac neural crest cell migration involved in outflow tract morphogenesis (IEA,ISO)

cardiac right ventricle formation (IEA,ISO)

cartilage morphogenesis (IEA,ISO)

cell proliferation involved in outflow tract morphogenesis (IEA,ISO)

cellular response to organic cyclic compound (IEP)

cellular response to retinoic acid (IEP)

coronary artery morphogenesis (IEA,ISO)

determination of heart left/right asymmetry (ISO)

embryonic digit morphogenesis (IEA,ISO)

embryonic skeletal system development (IEA,ISO)

epithelial cell apoptotic process (IEA,ISO)

heart development (IBA,IEP,ISO)

heart looping (IEA,ISO)

heart morphogenesis (ISO)

in utero embryonic development (IEA,ISO)

mesenchymal cell proliferation (IEA,ISO)

mesenchyme development (ISO)

negative regulation of cardiac muscle cell apoptotic process (IEA,ISO)

negative regulation of DNA binding (IEA,ISO)

negative regulation of DNA-binding transcription factor activity (IEA,ISO)

negative regulation of epithelial cell apoptotic process (IEA,ISO)

negative regulation of gene expression (IEA,ISO)

negative regulation of osteoblast differentiation (IEA,ISO)

neural crest cell development (ISO)

odontogenesis of dentin-containing tooth (IEA,ISO)

osteoblast differentiation (IEA,ISO)

peripheral nervous system neuron development (IEA,ISO)

positive regulation of cardiac muscle hypertrophy (IEA,ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of ERK1 and ERK2 cascade (IEA,ISO)

positive regulation of gene expression (IEA,ISO)

positive regulation of p38MAPK cascade (IEA,ISO)

positive regulation of semaphorin-plexin signaling pathway involved in outflow tract morphogenesis (IEA,ISO)

positive regulation of transcription by RNA polymerase II (ISO)

positive regulation of transcription from RNA polymerase II promoter involved in norepinephrine biosynthetic process (IEA,ISO)

positive regulation of transcription regulatory region DNA binding (IEA,ISO)

primary palate development (IEA,ISO)

regulation of DNA-templated transcription (ISO)

regulation of secondary heart field cardioblast proliferation (IEA,ISO)

regulation of tissue remodeling (IEA,ISO)

regulation of transcription by RNA polymerase II (IBA)

roof of mouth development (ISO)

suckling behavior (IEA,ISO)

sympathetic nervous system development (IEA,ISO)

thymus development (IEA,ISO)

tongue development (IEA,ISO)

visceral serous pericardium development (IEA,ISO)

Cellular Component

chromatin (IEA,ISO)

nucleus (IC)

nucleus (IDA)

nucleus (IEA,ISO)

protein-containing complex (ISO)

transcription regulator complex (IEA,ISO)

Molecular Function

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IMP)

E-box binding (IEA,ISO)

minor groove of adenine-thymine-rich DNA binding (IEA,ISO)

protein binding (IPI,ISO)

protein homodimerization activity (IEA,ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IBA,ISO)

RNA polymerase II-specific DNA-binding transcription factor binding (IEA,IPI,ISO)

sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

transcription cis-regulatory region binding (ISO)

transcription coactivator binding (IPI)

transcription factor binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	Upregulation of embryonic transcription factors in right ventricular hypertrophy.	Bar H, etal., Basic Res Cardiol. 2003 Sep;98(5):285-94. Epub 2003 Apr 16.
2.	The transcription factors GATA4 and dHAND physically interact to synergistically activate cardiac gene expression through a p300-dependent mechanism.	Dai YS, etal., J Biol Chem 2002 Jul 5;277(27):24390-8.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Regulation of dHAND protein expression by all-trans retinoic acid through ET-1/ETAR signaling in H9c2 cells.	Li W and Li Y, J Cell Biochem. 2006 Oct 1;99(2):478-84.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Proteasome-mediated degradation of the coactivator p300 impairs cardiac transcription.	Poizat C, etal., Mol Cell Biol. 2000 Dec;20(23):8643-54.
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Comprehensive gene review and curation	RGD comprehensive gene curation
12.	HAND1 and HAND2 are expressed in the adult-rodent heart and are modulated during cardiac hypertrophy.	Thattaliyath BD, etal., Biochem Biophys Res Commun 2002 Oct 4;297(4):870-5.
13.	Cooperative interaction between the basic helix-loop-helix transcription factor dHAND and myocyte enhancer factor 2C regulates myocardial gene expression.	Zang MX, etal., J Biol Chem. 2004 Dec 24;279(52):54258-63. Epub 2004 Oct 14.
14.	Cooperative activation of atrial naturetic peptide promoter by dHAND and MEF2C.	Zang MX, etal., J Cell Biochem. 2004 Dec 15;93(6):1255-66.

Additional References at PubMed

PMID:9171826	PMID:9576835	PMID:9671575	PMID:9878849	PMID:11076755	PMID:11784028	PMID:11812799	PMID:12070084	PMID:12392994	PMID:15351717	PMID:15576406	PMID:16145670
PMID:16280598	PMID:17507395	PMID:17531968	PMID:17764670	PMID:19008477	PMID:19144722	PMID:19341725	PMID:20144608	PMID:21241805	PMID:21350214	PMID:23284944	PMID:24161931

Genomics

Comparative Map Data

Hand2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	16	32,917,826 - 32,919,880 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	32,917,823 - 32,919,891 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	36,510,401 - 36,513,743 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	16	39,921,734 - 39,925,076 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	16	36,141,350 - 36,144,691 (-)	NCBI	Rnor_WKY
Rnor_6.0	16	36,371,489 - 36,373,551 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	36,371,489 - 36,373,546 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	36,173,054 - 36,174,762 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	36,324,327 - 36,348,104 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	36,324,401 - 36,326,112 (-)	NCBI
Celera	16	32,856,614 - 32,879,368 (-)	NCBI		Celera
Cytogenetic Map	16	p11	NCBI

HAND2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	173,526,091 - 173,530,229 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	4	173,524,969 - 173,530,229 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	174,447,242 - 174,451,380 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	174,684,227 - 174,687,953 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	174,820,849 - 174,825,309	NCBI
Celera	4	171,772,735 - 171,776,461 (-)	NCBI		Celera
Cytogenetic Map	4	q34.1	NCBI
HuRef	4	170,194,314 - 170,197,710 (-)	NCBI		HuRef
CHM1_1	4	174,424,466 - 174,428,102 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	176,865,882 - 176,870,021 (-)	NCBI		T2T-CHM13v2.0

Hand2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	57,774,018 - 57,777,552 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	57,774,018 - 57,777,668 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	57,320,983 - 57,324,517 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	57,320,983 - 57,324,633 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	59,799,780 - 59,803,314 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	60,214,046 - 60,216,006 (+)	NCBI		MGSCv36	mm8
Celera	8	59,958,813 - 59,962,384 (+)	NCBI		Celera
Cytogenetic Map	8	B2	NCBI
cM Map	8	29.8	NCBI

Hand2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	33,478,924 - 33,481,608 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	33,478,034 - 33,481,613 (+)	NCBI	ChiLan1.0	ChiLan1.0

HAND2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	4	177,990,362 - 177,992,861 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
Mhudiblu_PPA_v0	4	165,755,000 - 165,758,735 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

HAND2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	24,140,496 - 24,143,143 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	24,141,243 - 24,152,958 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	24,791,105 - 24,793,938 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	24,303,930 - 24,306,779 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	24,304,712 - 24,306,732 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	24,249,725 - 24,252,576 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	24,141,364 - 24,144,207 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	24,290,187 - 24,293,030 (-)	NCBI		UU_Cfam_GSD_1.0

Hand2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	24,277,871 - 24,281,346 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936516	4,692,926 - 4,695,632 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936516	4,692,926 - 4,695,625 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HAND2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	16,459,971 - 16,462,207 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	16,460,089 - 16,462,979 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	17,528,431 - 17,531,096 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HAND2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	119,635,697 - 119,639,415 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	119,634,741 - 119,638,546 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	99,666,888 - 99,670,603 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hand2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624769	5,033,932 - 5,038,343 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624769	5,035,669 - 5,038,333 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hand2
8 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	111
Count of miRNA genes:	94
Interacting mature miRNAs:	97
Transcripts:	ENSRNOT00000030765
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	16	4227609	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
2302057	Pia29	Pristane induced arthritis QTL 29	3.6	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	16	21735975	66735975	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	24325513	69325513	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	25152793	70152793	Rat
1298529	Arunc1	Aerobic running capacity QTL 1	4		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	31951520	60148445	Rat

Markers in Region

UniSTS:478956

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	32,919,324 - 32,919,444 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	36,372,988 - 36,373,107	NCBI	Rnor6.0
Rnor_5.0	16	36,174,553 - 36,174,672	UniSTS	Rnor5.0
RGSC_v3.4	16	36,325,826 - 36,325,945	UniSTS	RGSC3.4
Celera	16	32,858,113 - 32,858,232	UniSTS
Cytogenetic Map	16	p11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	42	8	6		6					21
Low	1	1	44	35	10	35	1	1		4	10	6	1
Below cutoff			4		8		4	6	13	7	2	4	4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y08138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000079552 ⟹ ENSRNOP00000074299

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	32,917,823 - 32,919,891 (-)	Ensembl
Rnor_6.0 Ensembl	16	36,371,489 - 36,373,546 (-)	Ensembl

RefSeq Acc Id:

NM_022696 ⟹ NP_073187

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	16	32,917,826 - 32,919,880 (-)	NCBI
Rnor_6.0	16	36,371,489 - 36,373,551 (-)	NCBI
Rnor_5.0	16	36,173,054 - 36,174,762 (-)	NCBI
RGSC_v3.4	16	36,324,327 - 36,348,104 (-)	RGD
Celera	16	32,856,614 - 32,879,368 (-)	RGD

Sequence:

show sequence

GTTGAGAAGTTTGTCGACAGATTAGGGAGATGAGTCTGGTGGGGGGCTTTCCCCACCACCCCGT
GGTGCACCATGAGGGCTACCCGTTCGCCGCAGCCGCAGCCGCCGCTGCTGCTGCCGCCGCCAGC
CGCTGCAGTCACGAGGAGAACCCCTATTTCCACGGCTGGCTTATTGGCCACCCGGAGATGTCGC
CCCCCGACTACAGCATGGCCCTGTCCTACAGTCCCGAGTACGCCAGCGGTGCCGCGGGCCTGGA
CCACTCCCATTATGGGGGAGTGCCGCCCGGTGCCGGGCCTCCCGGCCTGGGGGGGCCGCGCCCG
GTGAAGCGTCGGGGCACCGCCAACCGCAAGGAGCGGCGCAGGACTCAGAGCATCAACAGCGCCT
TCGCCGAGCTGCGCGAGTGCATCCCCAACGTGCCCGCCGACACCAAACTCTCCAAAATCAAGAC
TCTGCGCCTGGCCACCAGCTACATCGCCTACCTCATGGATCTGCTGGCCAAGGACGACCAGAAC
GGAGAGGCGGAGGCCTTCAAGGCGGAGATCAAGAAGACCGACGTGAAAGAGGAGAAGAGGAAGA
AAGAGCTGAATGAAATCTTGAAAAGTACAGTGAGCAGCAACGACAAGAAAACCAAAGGCCGGAC
AGGCTGGCCACAGCACGTCTGGGCCCTGGAGCTCAAGCAGTGAAGAGTCTGGGCCCTGGAGCTC
AAGCAGTAAAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_073187	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA69332	(Get FASTA)	NCBI Sequence Viewer
	EDL87163	(Get FASTA)	NCBI Sequence Viewer
	P61295	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_073187 ⟸ NM_022696

- UniProtKB:

P97833 (UniProtKB/Swiss-Prot), P61295 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSLVGGFPHHPVVHHEGYPFAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSY
SPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPN
VPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKST
VSSNDKKTKGRTGWPQHVWALELKQ

hide sequence

RefSeq Acc Id:

ENSRNOP00000074299 ⟸ ENSRNOT00000079552

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P61295-F1-model_v2	AlphaFold	P61295	1-217	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621207	AgrOrtholog
BioCyc Gene	G2FUF-11527	BioCyc
Ensembl Genes	ENSRNOG00000060448	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000074299	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOP00000074299.2	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000079552	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOT00000079552.2	UniProtKB/Swiss-Prot
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	bHLH_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64637	UniProtKB/Swiss-Prot
NCBI Gene	64637	ENTREZGENE
PANTHER	BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTOR, TWIST	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HEART- AND NEURAL CREST DERIVATIVES-EXPRESSED PROTEIN 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Hand2	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47459	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K7Q4_RAT	UniProtKB/TrEMBL
	HAND2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	P97833	ENTREZGENE
UniProt Secondary	O95300	UniProtKB/Swiss-Prot
	O95301	UniProtKB/Swiss-Prot
	P97833	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Hand2	heart and neural crest derivatives expressed 2	LOC103693947	heart- and neural crest derivatives-expressed protein 2-like	Data Merged	737654	PROVISIONAL
2014-08-25	LOC103693947	heart- and neural crest derivatives-expressed protein 2-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-10-17	Hand2	heart and neural crest derivatives expressed 2	Hand2	heart and neural crest derivatives expressed transcript 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Hand2	heart and neural crest derivatives expressed transcript 2		dHand protein	Name updated	1299863	APPROVED
2002-08-07	Hand2	dHand protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_physical_interaction	bHLH domain interacts with the GATA4 C-terminal zinc finger domain and with the CH3 domain of p300	727369

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD