Symbol:
Rnpep
Name:
arginyl aminopeptidase
RGD ID:
621137
Description:
Enables metalloaminopeptidase activity; peptide binding activity; and transition metal ion binding activity. Involved in negative regulation of blood pressure; protein processing; and retina development in camera-type eye. Located in external side of plasma membrane; extracellular space; and secretory granule. Used to study hypertension. Biomarker of hypertension. Orthologous to human RNPEP (arginyl aminopeptidase); PARTICIPATES IN angiotensin IV signaling pathway; renin-angiotensin cascade pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
aminopeptidase B; AP-B; arginine aminopeptidase; arginyl aminopeptidase (aminopeptidase B); cytosol aminopeptidase IV
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Candidate Gene For:
Bp328 Bp396
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 49,251,259 - 49,271,440 (-) NCBI GRCr8 mRatBN7.2 13 46,699,458 - 46,717,829 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 46,699,463 - 46,717,998 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 49,306,528 - 49,324,611 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 50,594,605 - 50,612,686 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 47,860,650 - 47,879,132 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 52,092,863 - 52,124,006 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 52,092,859 - 52,111,363 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 57,144,697 - 57,163,164 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 48,267,923 - 48,286,295 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 48,281,967 - 48,300,338 (-) NCBI Celera 13 47,022,135 - 47,040,506 (-) NCBI Celera Cytogenetic Map 13 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rnpep Rat 1,2-dimethylhydrazine multiple interactions ISO Rnpep (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RNPEP mRNA CTD PMID:22206623 Rnpep Rat 17alpha-ethynylestradiol affects expression ISO Rnpep (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of RNPEP mRNA CTD PMID:17555576 Rnpep Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of RNPEP mRNA CTD PMID:17557909 Rnpep Rat 17alpha-ethynylestradiol multiple interactions ISO Rnpep (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RNPEP mRNA CTD PMID:17942748 Rnpep Rat 17alpha-ethynylestradiol increases expression ISO Rnpep (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of RNPEP mRNA CTD PMID:17942748 Rnpep Rat 17beta-estradiol increases expression ISO Rnpep (Mus musculus) 6480464 Estradiol results in increased expression of RNPEP mRNA CTD PMID:39298647 Rnpep Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RNPEP (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Rnpep Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rnpep (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RNPEP mRNA CTD PMID:17942748 Rnpep Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RNPEP mRNA CTD PMID:34747641 Rnpep Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rnpep (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RNPEP mRNA CTD PMID:18343893 and PMID:21570461 Rnpep Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Rnpep (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of RNPEP mRNA CTD PMID:15328365 Rnpep Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Rnpep (Mus musculus) 6480464 2 more ... CTD PMID:18343893 Rnpep Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of RNPEP mRNA CTD PMID:21346803 Rnpep Rat 2,6-dimethoxyphenol multiple interactions ISO RNPEP (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of RNPEP protein CTD PMID:38598786 Rnpep Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of RNPEP mRNA CTD PMID:21346803 Rnpep Rat 2-naphthylamine increases metabolic processing EXP 6480464 RNPEP protein results in increased metabolism of 2-Naphthylamine analog CTD PMID:11732752 Rnpep Rat 2-naphthylamine increases metabolic processing ISO RNPEP (Homo sapiens) 6480464 RNPEP protein results in increased metabolism of 2-Naphthylamine analog CTD PMID:11732752 Rnpep Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Rnpep Rat 4,4'-diaminodiphenylmethane increases expression ISO Rnpep (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of RNPEP mRNA CTD PMID:18648102 Rnpep Rat 4,4'-sulfonyldiphenol increases expression ISO Rnpep (Mus musculus) 6480464 bisphenol S results in increased expression of RNPEP mRNA CTD PMID:39298647 Rnpep Rat 4,4'-sulfonyldiphenol decreases methylation ISO RNPEP (Homo sapiens) 6480464 bisphenol S results in decreased methylation of RNPEP gene CTD PMID:31601247 Rnpep Rat 4,4'-sulfonyldiphenol multiple interactions ISO RNPEP (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of RNPEP gene CTD PMID:31601247 Rnpep Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of RNPEP mRNA CTD PMID:30047161 Rnpep Rat acrolein multiple interactions ISO RNPEP (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of RNPEP mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of RNPEP mRNA CTD PMID:32699268 Rnpep Rat actinomycin D multiple interactions ISO RNPEP (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of RNPEP protein CTD PMID:38460933 Rnpep Rat all-trans-retinoic acid increases expression ISO RNPEP (Homo sapiens) 6480464 Tretinoin results in increased expression of RNPEP mRNA CTD PMID:33167477 Rnpep Rat alpha-hexachlorocyclohexane decreases expression EXP 6480464 alpha-hexachlorocyclohexane results in decreased expression of RNPEP mRNA CTD PMID:16940010 Rnpep Rat alpha-hexachlorocyclohexane increases expression EXP 6480464 alpha-hexachlorocyclohexane results in increased expression of RNPEP mRNA CTD PMID:16940010 Rnpep Rat alpha-hexachlorocyclohexane affects expression EXP 6480464 alpha-hexachlorocyclohexane affects the expression of RNPEP mRNA CTD PMID:16940010 Rnpep Rat alpha-pinene multiple interactions ISO RNPEP (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of RNPEP mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of RNPEP mRNA CTD PMID:32699268 Rnpep Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of RNPEP mRNA CTD PMID:30047161 Rnpep Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RNPEP mRNA CTD PMID:16483693 Rnpep Rat antirheumatic drug decreases expression ISO RNPEP (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of RNPEP mRNA CTD PMID:24449571 Rnpep Rat arsenous acid multiple interactions ISO RNPEP (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to RNPEP protein] CTD PMID:26598702 Rnpep Rat arsenous acid increases expression ISO RNPEP (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of RNPEP protein CTD PMID:25419056 Rnpep Rat benzo[a]pyrene increases methylation ISO RNPEP (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of RNPEP 3' UTR CTD PMID:27901495 Rnpep Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RNPEP mRNA CTD PMID:25181051 Rnpep Rat bisphenol A increases expression ISO RNPEP (Homo sapiens) 6480464 bisphenol A results in increased expression of RNPEP protein CTD PMID:37567409 Rnpep Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of RNPEP gene CTD PMID:28505145 Rnpep Rat Bisphenol B increases expression ISO RNPEP (Homo sapiens) 6480464 bisphenol B results in increased expression of RNPEP protein CTD PMID:34186270 Rnpep Rat bisphenol F increases expression ISO RNPEP (Homo sapiens) 6480464 bisphenol F results in increased expression of RNPEP protein CTD PMID:34186270 Rnpep Rat cadmium dichloride increases expression ISO RNPEP (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of RNPEP protein CTD PMID:24527689 Rnpep Rat chlorpyrifos decreases expression ISO Rnpep (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of RNPEP mRNA CTD PMID:37019170 Rnpep Rat choline multiple interactions ISO Rnpep (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of RNPEP gene CTD PMID:20938992 Rnpep Rat cisplatin multiple interactions ISO RNPEP (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of RNPEP mRNA CTD PMID:27392435 Rnpep Rat cisplatin increases expression ISO RNPEP (Homo sapiens) 6480464 Cisplatin results in increased expression of RNPEP mRNA CTD PMID:27392435 Rnpep Rat clofibrate multiple interactions ISO Rnpep (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of RNPEP mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of RNPEP mRNA] CTD PMID:17585979 Rnpep Rat copper(II) sulfate decreases expression ISO RNPEP (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of RNPEP mRNA CTD PMID:19549813 Rnpep Rat cyclosporin A decreases expression ISO RNPEP (Homo sapiens) 6480464 Cyclosporine results in decreased expression of RNPEP mRNA CTD PMID:20106945 and PMID:25562108 Rnpep Rat dehydroepiandrosterone decreases expression EXP 6480464 Dehydroepiandrosterone results in decreased expression of RNPEP mRNA CTD PMID:16940010 Rnpep Rat diarsenic trioxide multiple interactions ISO RNPEP (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to RNPEP protein] CTD PMID:26598702 Rnpep Rat diarsenic trioxide increases expression ISO RNPEP (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of RNPEP protein CTD PMID:25419056 Rnpep Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of RNPEP mRNA CTD PMID:21266533 Rnpep Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of RNPEP mRNA CTD PMID:18636392 Rnpep Rat diethylstilbestrol decreases expression ISO RNPEP (Homo sapiens) 6480464 Diethylstilbestrol results in decreased expression of RNPEP mRNA CTD PMID:36621641 Rnpep Rat elemental selenium increases expression ISO RNPEP (Homo sapiens) 6480464 Selenium results in increased expression of RNPEP mRNA CTD PMID:19244175 Rnpep Rat ethanol multiple interactions EXP 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of RNPEP mRNA CTD PMID:17347304 Rnpep Rat ethanol affects expression ISO Rnpep (Mus musculus) 6480464 Ethanol affects the expression of RNPEP mRNA CTD PMID:30319688 Rnpep Rat ethyl methanesulfonate increases expression ISO RNPEP (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of RNPEP mRNA CTD PMID:23649840 Rnpep Rat fenthion decreases expression ISO Rnpep (Mus musculus) 6480464 Fenthion results in decreased expression of RNPEP mRNA CTD PMID:34813904 Rnpep Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of RNPEP mRNA CTD PMID:18035473 Rnpep Rat folic acid multiple interactions ISO Rnpep (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Rnpep Rat FR900359 increases phosphorylation ISO RNPEP (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of RNPEP protein CTD PMID:37730182 Rnpep Rat fulvestrant multiple interactions ISO RNPEP (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of RNPEP gene CTD PMID:31601247 Rnpep Rat furfural multiple interactions ISO RNPEP (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of RNPEP protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of RNPEP protein CTD PMID:38598786 Rnpep Rat gamma-hexachlorocyclohexane decreases expression EXP 6480464 Hexachlorocyclohexane results in decreased expression of RNPEP mRNA CTD PMID:17785943 Rnpep Rat genistein multiple interactions ISO RNPEP (Homo sapiens) 6480464 ESR2 promotes the reaction [Genistein results in increased expression of RNPEP protein] CTD PMID:20884965 Rnpep Rat genistein increases expression ISO RNPEP (Homo sapiens) 6480464 Genistein results in increased expression of RNPEP protein CTD PMID:20884965 Rnpep Rat ivermectin decreases expression ISO RNPEP (Homo sapiens) 6480464 Ivermectin results in decreased expression of RNPEP protein CTD PMID:32959892 Rnpep Rat L-methionine multiple interactions ISO Rnpep (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of RNPEP gene CTD PMID:20938992 Rnpep Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of RNPEP protein CTD PMID:37182599 Rnpep Rat methidathion decreases expression ISO Rnpep (Mus musculus) 6480464 methidathion results in decreased expression of RNPEP mRNA CTD PMID:34813904 Rnpep Rat methyl methanesulfonate increases expression ISO RNPEP (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of RNPEP mRNA CTD PMID:23649840 Rnpep Rat Nutlin-3 multiple interactions ISO RNPEP (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of RNPEP protein CTD PMID:38460933 Rnpep Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of RNPEP mRNA CTD PMID:18636392 Rnpep Rat ozone multiple interactions ISO RNPEP (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of RNPEP mRNA more ... CTD PMID:32699268 Rnpep Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of RNPEP mRNA CTD PMID:27638505 Rnpep Rat paracetamol multiple interactions ISO Rnpep (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of RNPEP mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of RNPEP mRNA] CTD PMID:17585979 Rnpep Rat paracetamol affects expression ISO Rnpep (Mus musculus) 6480464 Acetaminophen affects the expression of RNPEP mRNA CTD PMID:17562736 Rnpep Rat pentachlorophenol increases expression ISO Rnpep (Mus musculus) 6480464 Pentachlorophenol results in increased expression of RNPEP mRNA CTD PMID:23892564 Rnpep Rat phenobarbital multiple interactions ISO Rnpep (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of RNPEP mRNA] CTD PMID:19482888 Rnpep Rat phenobarbital affects expression ISO RNPEP (Homo sapiens) 6480464 Phenobarbital affects the expression of RNPEP mRNA CTD PMID:19159669 Rnpep Rat phenobarbital increases expression ISO Rnpep (Mus musculus) 6480464 Phenobarbital results in increased expression of RNPEP mRNA CTD PMID:19482888 Rnpep Rat pirimiphos-methyl decreases activity EXP 6480464 pirimiphos methyl results in decreased activity of RNPEP protein CTD PMID:9204212 Rnpep Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of RNPEP protein CTD PMID:35544339 Rnpep Rat selenium atom increases expression ISO RNPEP (Homo sapiens) 6480464 Selenium results in increased expression of RNPEP mRNA CTD PMID:19244175 Rnpep Rat sodium arsenite decreases expression ISO RNPEP (Homo sapiens) 6480464 sodium arsenite results in decreased expression of RNPEP mRNA CTD PMID:38568856 Rnpep Rat sodium chloride multiple interactions ISO RNPEP (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of RNPEP protein more ... CTD PMID:38598786 Rnpep Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of RNPEP mRNA CTD PMID:19281266 Rnpep Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of RNPEP mRNA CTD PMID:30047161 Rnpep Rat tamoxifen affects expression ISO Rnpep (Mus musculus) 6480464 Tamoxifen affects the expression of RNPEP mRNA CTD PMID:17555576 Rnpep Rat temozolomide increases expression ISO RNPEP (Homo sapiens) 6480464 Temozolomide results in increased expression of RNPEP mRNA CTD PMID:31758290 Rnpep Rat tetrachloromethane decreases expression ISO Rnpep (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of RNPEP mRNA CTD PMID:31919559 Rnpep Rat tetracycline increases expression ISO Rnpep (Mus musculus) 6480464 Tetracycline results in increased expression of RNPEP mRNA CTD PMID:16917069 Rnpep Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of RNPEP mRNA CTD PMID:34492290 Rnpep Rat titanium dioxide decreases methylation ISO Rnpep (Mus musculus) 6480464 titanium dioxide results in decreased methylation of RNPEP gene CTD PMID:35295148 Rnpep Rat trimellitic anhydride increases expression ISO Rnpep (Mus musculus) 6480464 trimellitic anhydride results in increased expression of RNPEP mRNA CTD PMID:19042947 Rnpep Rat triphenyl phosphate affects expression ISO RNPEP (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RNPEP mRNA CTD PMID:37042841 Rnpep Rat valproic acid decreases expression ISO RNPEP (Homo sapiens) 6480464 Valproic Acid results in decreased expression of RNPEP mRNA CTD PMID:29154799 Rnpep Rat valproic acid affects expression ISO Rnpep (Mus musculus) 6480464 Valproic Acid affects the expression of RNPEP mRNA CTD PMID:17292431
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-naphthylamine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) actinomycin D (ISO) all-trans-retinoic acid (ISO) alpha-hexachlorocyclohexane (EXP) alpha-pinene (ISO) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium dichloride (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) clofibrate (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dehydroepiandrosterone (EXP) diarsenic trioxide (ISO) dibutyl phthalate (EXP) dichlorine (EXP) diethylstilbestrol (ISO) elemental selenium (ISO) ethanol (EXP,ISO) ethyl methanesulfonate (ISO) fenthion (ISO) flavonoids (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) gamma-hexachlorocyclohexane (EXP) genistein (ISO) ivermectin (ISO) L-methionine (ISO) Mesaconitine (EXP) methidathion (ISO) methyl methanesulfonate (ISO) Nutlin-3 (ISO) ozone (EXP,ISO) p-toluidine (EXP) paracetamol (ISO) pentachlorophenol (ISO) phenobarbital (ISO) pirimiphos-methyl (EXP) rotenone (EXP) selenium atom (ISO) sodium arsenite (ISO) sodium chloride (ISO) Soman (EXP) sulfadimethoxine (EXP) tamoxifen (ISO) temozolomide (ISO) tetrachloromethane (ISO) tetracycline (ISO) thioacetamide (EXP) titanium dioxide (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) valproic acid (ISO)
1.
Aminopeptidase B: a processing enzyme secreted and associated with the plasma membrane of rat pheochromocytoma (PC12) cells.
Balogh A, etal., J Cell Sci. 1998 Jan;111 ( Pt 2):161-9.
2.
Aminopeptidase B from the rat testis is a bifunctional enzyme structurally related to leukotriene-A4 hydrolase.
Cadel S, etal., Proc Natl Acad Sci U S A 1997 Apr 1;94(7):2963-8.
3.
Renin-angiotensin system-regulating aminopeptidase activities are modified in the pineal gland of rats with breast cancer induced by N-methyl-nitrosourea.
Carrera MP, etal., Cancer Invest. 2006 Mar;24(2):149-53.
4.
Congenic mapping and sequence analysis of the Renin locus.
Flister MJ, etal., Hypertension. 2013 Apr;61(4):850-6. doi: 10.1161/HYPERTENSIONAHA.111.01008. Epub 2013 Mar 4.
5.
Miniglucagon (MG)-generating endopeptidase, which processes glucagon into MG, is composed of N-arginine dibasic convertase and aminopeptidase B.
Fontes G, etal., Endocrinology. 2005 Feb;146(2):702-12. Epub 2004 Nov 11.
6.
Aminopeptidase B is structurally related to leukotriene-A4 hydrolase but is not a bifunctional enzyme with epoxide hydrolase activity.
Fukasawa KM, etal., Biochem J 1999 May 1;339 ( Pt 3):497-502.
7.
Molecular cloning and expression of rat liver aminopeptidase B.
Fukasawa KM, etal., J Biol Chem 1996 Nov 29;271(48):30731-5.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
Characterization of the metal-binding site in aminopeptidase B.
Hirose J, etal., Biol Pharm Bull. 2006 Dec;29(12):2378-82.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
Expression of aminopeptidase B in the developing and adult rat retina.
Piesse C, etal., Exp Eye Res. 2004 Nov;79(5):639-48.
14.
Insulin-regulated aminopeptidase/placental leucil Aminopeptidase (IRAP/P-lAP) and angiotensin IV-forming activities are modified in serum of rats with breast cancer induced by N-methyl-nitrosourea.
Pilar Carrera M, etal., Anticancer Res. 2006 Mar-Apr;26(2A):1011-4.
15.
Activities of aminopeptidases in a rat saline model of volume hypertension.
Prieto I, etal., Horm Metab Res. 1998 May;30(5):246-8.
16.
Developmental and ageing changes in aminopeptidase activities in selected tissues of the rat.
Ramirez M, etal., Experientia. 1993 Apr 15;49(4):300-3.
17.
Soluble and membrane-bound leucyl- and arginyl-aminopeptidase activities in subcellular fractions of young and adult rat brains.
Ramirez M, etal., Rev Esp Fisiol. 1990 Dec;46(4):393-7.
18.
GOA pipeline
RGD automated data pipeline
19.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
20.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
21.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
22.
Dysfunction of central angiotensinergic aminopeptidase activity in spontaneously hypertensive rats.
Wright JW, etal., Neurosci Lett. 1985 Nov 11;61(3):351-6.
Rnpep Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 49,251,259 - 49,271,440 (-) NCBI GRCr8 mRatBN7.2 13 46,699,458 - 46,717,829 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 46,699,463 - 46,717,998 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 49,306,528 - 49,324,611 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 50,594,605 - 50,612,686 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 47,860,650 - 47,879,132 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 52,092,863 - 52,124,006 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 52,092,859 - 52,111,363 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 57,144,697 - 57,163,164 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 48,267,923 - 48,286,295 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 48,281,967 - 48,300,338 (-) NCBI Celera 13 47,022,135 - 47,040,506 (-) NCBI Celera Cytogenetic Map 13 q13 NCBI
RNPEP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 201,982,648 - 202,006,143 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 201,982,372 - 202,006,147 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 201,951,776 - 201,975,271 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 200,218,389 - 200,241,898 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 198,683,422 - 198,706,931 NCBI Celera 1 175,075,517 - 175,099,029 (+) NCBI Celera Cytogenetic Map 1 q32.1 NCBI HuRef 1 173,117,652 - 173,141,163 (+) NCBI HuRef CHM1_1 1 203,373,998 - 203,397,522 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 201,240,334 - 201,263,798 (+) NCBI T2T-CHM13v2.0
Rnpep Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 135,190,447 - 135,211,765 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 135,190,450 - 135,211,822 (-) Ensembl GRCm39 Ensembl GRCm38 1 135,262,699 - 135,284,423 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 135,262,712 - 135,284,084 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 137,159,276 - 137,180,661 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 137,079,123 - 137,100,445 (-) NCBI MGSCv36 mm8 Celera 1 137,887,970 - 137,909,160 (-) NCBI Celera Cytogenetic Map 1 E4 NCBI cM Map 1 58.43 NCBI
Rnpep Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 38,103,426 - 38,122,358 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 38,103,701 - 38,122,162 (+) NCBI ChiLan1.0 ChiLan1.0
RNPEP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 47,376,889 - 47,400,418 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 47,341,586 - 47,366,097 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 177,579,349 - 177,602,865 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 181,881,128 - 181,904,334 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 181,880,404 - 181,903,906 (+) Ensembl panpan1.1 panPan2
RNPEP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 966,563 - 985,169 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 966,607 - 984,714 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 1,018,226 - 1,036,397 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 974,388 - 992,561 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 974,388 - 992,593 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 962,438 - 980,611 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 1,070,635 - 1,088,791 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 1,094,644 - 1,112,818 (-) NCBI UU_Cfam_GSD_1.0
Rnpep Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 73,269,882 - 73,290,311 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936567 2,504,537 - 2,525,018 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936567 2,504,544 - 2,524,977 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RNPEP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 24,218,139 - 24,235,518 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 24,218,144 - 24,235,520 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 28,635,318 - 28,639,788 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RNPEP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 27,401,749 - 27,426,371 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 27,401,757 - 27,426,410 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 28,184,309 - 28,208,990 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rnpep
.
Predicted Target Of
Count of predictions: 158 Count of miRNA genes: 119 Interacting mature miRNAs: 129 Transcripts: ENSRNOT00000009198 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 9589141 Insul28 Insulin level QTL 28 10.82 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 13 9313465 54313465 Rat 6893344 Cm79 Cardiac mass QTL 79 1.5 0.04 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 43720770 62022792 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 2317040 Aia21 Adjuvant induced arthritis QTL 21 2.75 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 631645 Bp121 Blood pressure QTL 121 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 14915655 59915655 Rat 2317046 Aia8 Adjuvant induced arthritis QTL 8 3.9700000286102295 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 1331784 Bp222 Blood pressure QTL 222 2.944 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 17694436 53050594 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 4145117 Mcs27 Mammary carcinoma susceptibility QTL 27 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 13 43437904 47841255 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 2301962 Cm72 Cardiac mass QTL 72 4.12 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 13 31241331 58363171 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 12879472 Bp399 Blood pressure QTL 399 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45228358 47841255 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 9589164 Gluco66 Glucose level QTL 66 6.67 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 13 15158722 60158722 Rat 7411662 Foco29 Food consumption QTL 29 20.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 13 9313465 54313465 Rat
D13Hmgc24
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 46,706,087 - 46,706,205 (+) MAPPER mRatBN7.2 Rnor_6.0 13 52,099,496 - 52,099,613 NCBI Rnor6.0 Rnor_5.0 13 57,151,330 - 57,151,447 UniSTS Rnor5.0 RGSC_v3.4 13 48,274,553 - 48,274,670 UniSTS RGSC3.4 Celera 13 47,028,765 - 47,028,882 UniSTS Cytogenetic Map 13 q13 UniSTS
BF400237
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 46,710,130 - 46,710,311 (+) MAPPER mRatBN7.2 Rnor_6.0 13 52,103,539 - 52,103,719 NCBI Rnor6.0 Rnor_5.0 13 57,155,373 - 57,155,553 UniSTS Rnor5.0 RGSC_v3.4 13 48,278,596 - 48,278,776 UniSTS RGSC3.4 Celera 13 47,032,808 - 47,032,988 UniSTS RH 3.4 Map 13 163.8 UniSTS Cytogenetic Map 13 q13 UniSTS
BF386633
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 46,703,639 - 46,703,836 (+) MAPPER mRatBN7.2 Rnor_6.0 13 52,097,048 - 52,097,244 NCBI Rnor6.0 Rnor_5.0 13 57,148,882 - 57,149,078 UniSTS Rnor5.0 RGSC_v3.4 13 48,272,105 - 48,272,301 UniSTS RGSC3.4 Celera 13 47,026,317 - 47,026,513 UniSTS RH 3.4 Map 13 168.1 UniSTS Cytogenetic Map 13 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009198 ⟹ ENSRNOP00000009198
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 46,699,463 - 46,717,998 (-) Ensembl Rnor_6.0 Ensembl 13 52,092,859 - 52,111,363 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115357 ⟹ ENSRNOP00000091649
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 46,699,463 - 46,717,998 (-) Ensembl
RefSeq Acc Id:
NM_031097 ⟹ NP_112359
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 49,251,259 - 49,269,630 (-) NCBI mRatBN7.2 13 46,699,458 - 46,717,829 (-) NCBI Rnor_6.0 13 52,092,866 - 52,111,237 (-) NCBI Rnor_5.0 13 57,144,697 - 57,163,164 (-) NCBI RGSC_v3.4 13 48,267,923 - 48,286,295 (-) RGD Celera 13 47,022,135 - 47,040,506 (-) RGD
Sequence:
CTCTAAGAGCCATGGAGAGCAGCGGACCCAGCAGCTGCCACAGCGCGGCCCGGCGGCCACTTCACTCGGCACAAGCCGTGGACGTGGCCTCGGCCTCCAGTTTCCGCGCCTTCGAGATCCTGCACCTG
hide sequence
RefSeq Acc Id:
XM_063272636 ⟹ XP_063128706
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 49,251,259 - 49,271,440 (-) NCBI
RefSeq Acc Id:
NP_112359 ⟸ NM_031097
- UniProtKB:
G3V6V1 (UniProtKB/TrEMBL), A6ICE6 (UniProtKB/TrEMBL), Q6P7D2 (UniProtKB/TrEMBL)
- Sequence:
MESSGPSSCHSAARRPLHSAQAVDVASASSFRAFEILHLHLDLRAELPPGPGPGSRGLNGKATLELRCLLPEGASELRLDSHSCLEVMAATLLRGQPGDQQQLTEPVPFHTQPFSHYGQALCVVFPKP
hide sequence
Ensembl Acc Id:
ENSRNOP00000009198 ⟸ ENSRNOT00000009198
Ensembl Acc Id:
ENSRNOP00000091649 ⟸ ENSRNOT00000115357
RefSeq Acc Id:
XP_063128706 ⟸ XM_063272636
- Peptide Label:
isoform X1
- UniProtKB:
A6ICE6 (UniProtKB/TrEMBL), G3V6V1 (UniProtKB/TrEMBL), Q6P7D2 (UniProtKB/TrEMBL)
RGD ID: 13698841 Promoter ID: EPDNEW_R9365 Type: initiation region Name: Rnpep_1 Description: arginyl aminopeptidase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 52,111,259 - 52,111,319 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-03
Rnpep
arginyl aminopeptidase
Rnpep
arginyl aminopeptidase (aminopeptidase B)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Rnpep
arginyl aminopeptidase (aminopeptidase B)
aminopeptidase B
Name updated
1299863 APPROVED
2002-08-07
Rnpep
aminopeptidase B
Symbol and Name status set to provisional
70820 PROVISIONAL
