Apom (apolipoprotein M) - Rat Genome Database

Name: Apom
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Apom (apolipoprotein M) Rattus norvegicus

Analyze

Symbol:

Apom

Name:

apolipoprotein M

RGD ID:

620773

Description:

Predicted to enable antioxidant activity; lipid transporter activity; and phospholipid binding activity. Involved in response to glucose. Located in extracellular space. Human ortholog(s) of this gene implicated in coronary artery disease; type 1 diabetes mellitus; and type 2 diabetes mellitus. Orthologous to human APOM (apolipoprotein M); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

apo-M; protein Px

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	APOM (apolipoprotein M)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Apom (apolipoprotein M)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Apom (apolipoprotein M)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	APOM (apolipoprotein M)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	APOM (apolipoprotein M)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Apom (apolipoprotein M)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	APOM (apolipoprotein M)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	APOM (apolipoprotein M)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Apom (apolipoprotein M)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	APOM (apolipoprotein M)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Apom (apolipoprotein M)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	apom (apolipoprotein M)	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	apom	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	3,690,950 - 3,693,550 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,688,413 - 3,693,550 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,390,260 - 4,392,730 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,752,317 - 3,754,787 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,290,095 - 4,292,565 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,120,473 - 5,123,073 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,120,474 - 5,123,073 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	7,193,732 - 7,196,332 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	3,754,604 - 3,757,204 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	3,754,853 - 3,757,431 (+)	NCBI
Celera	20	4,332,092 - 4,334,693 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

coronary artery disease (ISO)

Experimental Diabetes Mellitus (ISO)

genetic disease (ISO)

JMP syndrome (ISO)

megacolon (ISO)

Metabolic Syndrome (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aconitine (EXP)

amitrole (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bromobenzene (EXP)

caffeine (EXP)

calcium atom (EXP)

calcium(0) (EXP)

CGP 52608 (ISO)

chenodeoxycholic acid (ISO)

ciglitazone (ISO)

clofibrate (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

dimethyl sulfoxide (ISO)

diquat (ISO)

dorsomorphin (ISO)

flutamide (EXP)

fulvestrant (ISO)

furan (EXP)

gentamycin (EXP)

GW 4064 (ISO)

hydrogen peroxide (ISO)

hydroquinone O-beta-D-glucopyranoside (ISO)

inulin (ISO)

L-ascorbic acid (ISO)

lipopolysaccharide (ISO)

methapyrilene (EXP)

methimazole (EXP)

methylmercury chloride (ISO)

N-nitrosodiethylamine (EXP,ISO)

nefazodone (EXP)

nitrofen (EXP)

O-methyleugenol (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenylmercury acetate (ISO)

pirinixic acid (EXP,ISO)

potassium dichromate (ISO)

progesterone (ISO)

quercetin (ISO)

resveratrol (ISO)

SB 431542 (ISO)

senecionine (ISO)

silicon dioxide (ISO)

simvastatin (ISO)

sodium arsenate (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

Tanshinone I (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

trichloroethene (EXP)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

ursodeoxycholic acid (ISO)

valproic acid (ISO)

vancomycin (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular oxidant detoxification (IEA)

cholesterol efflux (IBA,IEA,ISO)

high-density lipoprotein particle assembly (IBA,ISO)

high-density lipoprotein particle clearance (IBA,ISO)

high-density lipoprotein particle remodeling (IBA,IEA,ISO)

lipoprotein metabolic process (ISO)

negative regulation of plasma lipoprotein oxidation (IEA,ISO)

response to glucose (IEP)

reverse cholesterol transport (ISO)

Cellular Component

discoidal high-density lipoprotein particle (IEA,ISO)

extracellular region (IEA,ISO)

extracellular space (IDA)

high-density lipoprotein particle (IBA,ISO)

low-density lipoprotein particle (IBA,IEA,ISO)

spherical high-density lipoprotein particle (IEA,ISO)

very-low-density lipoprotein particle (IBA,IEA,ISO)

Molecular Function

antioxidant activity (IEA,ISO)

lipid transporter activity (IBA,IEA,ISO)

phospholipid binding (IBA,IEA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Plasma apolipoprotein M is reduced in metabolic syndrome but does not predict intima media thickness.	Dullaart RP, etal., Clin Chim Acta. 2009 Aug;406(1-2):129-33. Epub 2009 Jun 17.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	A prospective evaluation of apolipoprotein M gene T-778C polymorphism in relation to coronary artery disease in Han Chinese.	Jiao GQ, etal., Clin Biochem. 2007 Oct;40(15):1108-12. Epub 2007 Jul 4.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	Single nucleotide polymorphisms in the proximal promoter region of apolipoprotein M gene (apoM) confer the susceptibility to development of type 2 diabetes in Han Chinese.	Niu N, etal., Diabetes Metab Res Rev. 2007 Jan;23(1):21-5.
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation
10.	Apolipoprotein M promoter polymorphisms alter promoter activity and confer the susceptibility to the development of type 1 diabetes.	Wu X, etal., Clin Biochem. 2009 Jan;42(1-2):17-21. Epub 2008 Oct 30.
11.	Suppression of apolipoprotein M expression and secretion in alloxan-diabetic mouse: Partial reversal by insulin.	Xu N, etal., Biochem Biophys Res Commun. 2006 Apr 21;342(4):1174-7. Epub 2006 Feb 14.
12.	Hyperglycemia down-regulates apolipoprotein M expression in vivo and in vitro.	Zhang X, etal., Biochim Biophys Acta. 2007 Jul;1771(7):879-82. Epub 2007 May 18.
13.	Expression pattern of apolipoprotein M during mouse and human embryogenesis.	Zhang XY, etal., Acta Histochem 2004;106(2):123-8.

Additional References at PubMed

PMID:2297521	PMID:12477932	PMID:15060004	PMID:15793583	PMID:16682745	PMID:17154273	PMID:18006500	PMID:22204862	PMID:23376485	PMID:23953565	PMID:26377577

Genomics

Comparative Map Data

Apom
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	3,690,950 - 3,693,550 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,688,413 - 3,693,550 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,390,260 - 4,392,730 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,752,317 - 3,754,787 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,290,095 - 4,292,565 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,120,473 - 5,123,073 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,120,474 - 5,123,073 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	7,193,732 - 7,196,332 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	3,754,604 - 3,757,204 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	3,754,853 - 3,757,431 (+)	NCBI
Celera	20	4,332,092 - 4,334,693 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

APOM
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	31,652,404 - 31,658,210 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	31,652,416 - 31,658,210 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	31,620,181 - 31,625,987 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	31,731,650 - 31,733,966 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	31,731,649 - 31,733,965	NCBI
Celera	6	33,221,892 - 33,224,208 (+)	NCBI		Celera
Cytogenetic Map	6	p21.33	NCBI
HuRef	6	31,406,412 - 31,412,212 (+)	NCBI		HuRef
CHM1_1	6	31,622,323 - 31,628,123 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	31,505,437 - 31,511,243 (+)	NCBI		T2T-CHM13v2.0

Apom
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	35,347,973 - 35,350,777 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	35,347,973 - 35,351,026 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	35,128,997 - 35,131,801 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	35,128,997 - 35,132,050 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	35,265,942 - 35,268,697 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	34,737,053 - 34,739,808 (-)	NCBI		MGSCv36	mm8
Celera	17	38,225,932 - 38,228,688 (-)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	18.59	NCBI

Apom
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	190,609 - 197,342 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	190,609 - 192,781 (+)	NCBI	ChiLan1.0	ChiLan1.0

APOM
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	42,090,938 - 42,096,756 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	31,313,543 - 31,319,374 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	32,203,435 - 32,209,249 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	32,206,514 - 32,209,249 (+)	Ensembl	panpan1.1		panPan2

APOM
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	1,137,474 - 1,142,337 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	1,140,316 - 1,142,331 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	1,273,598 - 1,278,509 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	1,282,390 - 1,287,302 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	1,285,280 - 1,287,296 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	1,142,107 - 1,146,651 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	1,209,008 - 1,213,915 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	1,276,069 - 1,280,982 (+)	NCBI		UU_Cfam_GSD_1.0

Apom
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	35,687,172 - 35,692,577 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936727	1,865,921 - 1,872,214 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936727	1,868,751 - 1,874,347 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

APOM
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	23,768,984 - 23,773,324 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	23,768,974 - 23,773,324 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	27,478,637 - 27,481,118 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

APOM
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023666044	31,563,816 - 31,569,058 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Apom
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	24,554,705 - 24,557,098 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	24,554,705 - 24,558,093 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Apom
32 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	47
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000001126
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
2306850	Pia40	Pristane induced arthritis QTL 40		0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1527959	5304575	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
61448	Ciaa1	CIA Autoantibody QTL 1	30	0.001	blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	20	2646395	4597031	Rat
61472	Aia1	Adjuvant induced arthritis QTL 1	18	0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	2646395	4597031	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
1300152	Bp195	Blood pressure QTL 195	3.46		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	3621649	9243559	Rat
1331772	Cdexp2	CD45RC expression in CD8 T cells QTL 2	5.7		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	20	3621649	10078919	Rat
737973	Pia21	Pristane induced arthritis QTL 21	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	4606812	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat

Markers in Region

RH142043

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	3,693,748 - 3,693,954 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	5,120,069 - 5,120,274	NCBI	Rnor6.0
Rnor_5.0	20	7,193,328 - 7,193,533	UniSTS	Rnor5.0
RGSC_v3.4	20	3,757,403 - 3,757,608	UniSTS	RGSC3.4
Celera	20	4,331,688 - 4,331,893	UniSTS
RH 3.4 Map	20	51.3	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			41	41	1	41				29	5
Low	3	43	16		18		8	11	74	6	36	11	8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019373	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094348	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF207821	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089807	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX883045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210093	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219449	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000323	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000001126 ⟹ ENSRNOP00000001126

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	3,688,413 - 3,693,550 (+)	Ensembl
Rnor_6.0 Ensembl	20	5,120,474 - 5,123,073 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000078273

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	5,122,232 - 5,123,057 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000096939 ⟹ ENSRNOP00000077771

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	3,690,950 - 3,692,938 (+)	Ensembl

RefSeq Acc Id:

NM_019373 ⟹ NP_062246

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	3,690,950 - 3,693,550 (+)	NCBI
Rnor_6.0	20	5,120,473 - 5,123,073 (-)	NCBI
Rnor_5.0	20	7,193,732 - 7,196,332 (-)	NCBI
RGSC_v3.4	20	3,754,604 - 3,757,204 (+)	RGD
Celera	20	4,332,092 - 4,334,693 (-)	RGD

Sequence:

show sequence

AGAGCAGACTGAGCAGCCAGCAGAGAACAGTTAAGGTAGAGGTCCCCAGAACCGCACAGCGCCA
GGTCTCCTCCCAAGATGTTCCACCAAGTCTGGGCAGCGCTGCTCTATCTCTACGGCCTTCTCTT
TAACTCCATGAATCAGTGCCCTGAGCACAGTCAACTAATGACGCTGGGAATGGACGACAAAGAG
ACCCCAGAGCCCCACCTGGGCCTGTGGTACTTTATCGCTGGAGCGGCTCCCACCATGGAAGAGT
TGGCAACTTTTGACCAGGTGGACAATATTGTCTTCAACATGGCCGCCGGCTCTGCCCCAAGGCA
GCTCCAGCTTCGCGCTACCATTCGCACGAAAAACGGGGTCTGCGTGCCCCGGAAATGGACGTAC
CACTTGACTGAAGGGAAAGGAAACACGGAACTCAGAACTGAAGGGCGCCCAGACATGAAAACAG
ACCTCTTCTCCATCTCATGCCCAGGAGGAATCATGCTGAAAGAGACGGGGCAGGGGTACCAGCG
TTTCCTCCTCTACAACCGATCGCCACACCCTCCAGAGGAGTGTGTGGAGGAATTCCAGTCTCTG
ACGTCCTGCTTGGACTTCAAAGCCTTTTTAGTGACTCCCAGGAATCAAGAGGCCTGCCCACTGT
CCAGCAAGTGACCCGTGACTCCACTTGTGTCCTGGACAGGCACGATAGGAGCTGAGCTCTGAGG
GGAGAAGCCGGCGGCTCCCGCTCCTTCTCATGGATAATAAAGATGAATTGTCAATCCAAAAAAA
AAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_062246	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF23408	(Get FASTA)	NCBI Sequence Viewer
	AAH89807	(Get FASTA)	NCBI Sequence Viewer
	CAE83996	(Get FASTA)	NCBI Sequence Viewer
	EDL83529	(Get FASTA)	NCBI Sequence Viewer
	P14630	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_062246 ⟸ NM_019373
- Peptide Label:	precursor
- UniProtKB:	Q5EBB9 (UniProtKB/Swiss-Prot), Q9QXI9 (UniProtKB/Swiss-Prot), P14630 (UniProtKB/Swiss-Prot), A6KTU9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MFHQVWAALLYLYGLLFNSMNQCPEHSQLMTLGMDDKETPEPHLGLWYFIAGAAPTMEELATFD QVDNIVFNMAAGSAPRQLQLRATIRTKNGVCVPRKWTYHLTEGKGNTELRTEGRPDMKTDLFSI SCPGGIMLKETGQGYQRFLLYNRSPHPPEECVEEFQSLTSCLDFKAFLVTPRNQEACPLSSK hide sequence

RefSeq Acc Id:

ENSRNOP00000001126 ⟸ ENSRNOT00000001126

RefSeq Acc Id:

ENSRNOP00000077771 ⟸ ENSRNOT00000096939

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P14630-F1-model_v2	AlphaFold	P14630	1-190	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620773	AgrOrtholog
BioCyc Gene	G2FUF-4649	BioCyc
Ensembl Genes	ENSRNOG00000000850	Ensembl, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000001126.2	UniProtKB/TrEMBL
	ENSRNOP00000077771.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001126.5	UniProtKB/TrEMBL
	ENSRNOT00000096939.1	UniProtKB/TrEMBL
Gene3D-CATH	2.40.128.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7323885	IMAGE-MGC_LOAD
InterPro	ApoM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Calycin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:55939	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108710	IMAGE-MGC_LOAD
NCBI Gene	55939	ENTREZGENE
PANTHER	APOLIPOPROTEIN M	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR32028	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ApoM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Apom	PhenoGen
Superfamily-SCOP	SSF50814	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5YC12_RAT	UniProtKB/TrEMBL
	A0A8L2PZB3_RAT	UniProtKB/TrEMBL
	A6KTU9	ENTREZGENE, UniProtKB/TrEMBL
	APOM_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5EBB9	ENTREZGENE
	Q9QXI9	ENTREZGENE
UniProt Secondary	Q5EBB9	UniProtKB/Swiss-Prot
	Q9QXI9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Apom	apolipoprotein M			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Apom	apolipoprotein M			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_mapping	found within the rat major histocompatibility RT1 complex	1300431

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar