Snai1 (snail family transcriptional repressor 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Snai1 (snail family transcriptional repressor 1) Rattus norvegicus

Analyze

Symbol:

Snai1

Name:

snail family transcriptional repressor 1

RGD ID:

620758

Description:

Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific; E-box binding activity; and kinase binding activity. Predicted to be involved in several processes, including heart development; negative regulation of response to DNA damage stimulus; and regulation of cellular biosynthetic process. Predicted to act upstream of or within several processes, including hair follicle morphogenesis; negative regulation of cell differentiation involved in embryonic placenta development; and trophoblast giant cell differentiation. Predicted to be located in cytosol; nuclear lumen; and pericentric heterochromatin. Orthologous to human SNAI1 (snail family transcriptional repressor 1); INTERACTS WITH (+)-schisandrin B; (R)-carnitine; (S)-nicotine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Sna; snail family zinc finger 1; snail homolog; snail homolog 1; snail homolog 1 (Drosophila); snail homolog, (Drosophila); zinc finger protein SNAI1

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	156,248,479 - 156,252,969 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	156,248,485 - 156,252,969 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	160,043,780 - 160,048,265 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	168,542,842 - 168,547,327 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	166,284,546 - 166,289,031 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	164,274,710 - 164,279,199 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	164,274,710 - 164,279,378 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	170,425,898 - 170,430,387 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	158,676,980 - 158,681,471 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	158,583,924 - 158,586,727 (+)	NCBI
Celera	3	154,827,543 - 154,832,032 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amyotrophic lateral sclerosis type 1 (ISO)

Breast Neoplasms (ISO)

cholestasis (ISO)

colorectal cancer (ISO)

dilated cardiomyopathy (ISS)

Neoplasm Invasiveness (ISO)

Neoplasm Metastasis (ISO)

Neoplastic Cell Transformation (ISO)

oral mucosa leukoplakia (ISO)

skin cancer (ISS)

Stomach Neoplasms (ISO)

thyroid gland papillary carcinoma (ISO)

ureteral obstruction (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(+)-schisandrin B (EXP,ISO)

(+)-Tetrandrine (ISO)

(-)-epigallocatechin 3-gallate (ISO)

(20S)-ginsenoside Rg3 (ISO)

(R)-carnitine (EXP)

(S)-naringenin (ISO)

(S)-nicotine (EXP,ISO)

1,2-dimethylhydrazine (ISO)

1,4-dithiothreitol (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-Dihydroxybenzophenone (ISO)

2-ethylhexan-1-ol (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3,3'-diindolylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-tert-Octylphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

acrolein (ISO)

acteoside (ISO)

aldehydo-D-glucose (ISO)

aldosterone (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

aluminium atom (ISO)

aluminium(0) (ISO)

AM-251 (ISO)

ammonium chloride (EXP)

anthra[1,9-cd]pyrazol-6(2H)-one (ISO)

antirheumatic drug (ISO)

antroquinonol (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

bafilomycin A1 (ISO)

benzo[a]pyrene (ISO)

Benzo[k]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buta-1,3-diene (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

celecoxib (ISO)

chloroquine (EXP)

choline (ISO)

chromium(6+) (ISO)

chrysin (ISO)

ciprofloxacin (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

colforsin daropate hydrochloride (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

CU-O LINKAGE (ISO)

curcumin (ISO)

cyclosporin A (ISO)

cytochalasin D (ISO)

D-glucose (ISO)

decabromodiphenyl ether (ISO)

deguelin (ISO)

delphinidin (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diallyl disulfide (ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

dibutyl phthalate (EXP)

dinophysistoxin 1 (ISO)

dioxygen (ISO)

disulfiram (ISO)

doxorubicin (ISO)

embelin (ISO)

endosulfan (EXP,ISO)

eplerenone (ISO)

ergosta-4,6,8(14),22-tetraen-3-one (ISO)

erlotinib hydrochloride (ISO)

ethanol (ISO)

fludioxonil (ISO)

folic acid (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

furan (EXP)

galaxolide (ISO)

genistein (ISO)

gentamycin (EXP)

gingerol (ISO)

glucose (ISO)

Honokiol (ISO)

hydrogen peroxide (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

Iodine aqueous (ISO)

jaspamide (ISO)

L-1,4-dithiothreitol (ISO)

L-methionine (ISO)

lapatinib (ISO)

leflunomide (ISO)

Licochalcone B (ISO)

lipopolysaccharide (ISO)

lithium chloride (ISO)

losartan (ISO)

luteolin (ISO)

LY294002 (ISO)

mangiferin (ISO)

menadione (ISO)

methylisothiazolinone (ISO)

microcystin-LR (ISO)

mifepristone (ISO)

MK-2206 (ISO)

N-acetyl-L-cysteine (ISO)

N-methyl-N-nitrosourea (EXP)

nickel dichloride (ISO)

nickel sulfate (ISO)

niclosamide (EXP,ISO)

nicotine (EXP,ISO)

Nonylphenol (ISO)

oridonin (ISO)

ouabain (ISO)

oxaliplatin (EXP)

ozone (ISO)

p-tert-Amylphenol (ISO)

Pachymic acid (ISO)

paracetamol (ISO)

paraquat (EXP)

patulin (EXP)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (ISO)

phenol red (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

propiconazole (ISO)

pterostilbene (ISO)

quercetin (EXP,ISO)

rac-lactic acid (ISO)

radon atom (ISO)

radon(0) (ISO)

reparixin (ISO)

resveratrol (ISO)

retinyl acetate (ISO)

ridaforolimus (ISO)

rotenone (ISO)

Salinomycin (ISO)

sanguinarine (ISO)

SB 203580 (ISO)

SB 431542 (EXP,ISO)

sclareol (ISO)

serpentine asbestos (ISO)

silver atom (ISO)

silver(0) (ISO)

sirolimus (EXP,ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sorafenib (ISO)

stattic (ISO)

sulforaphane (EXP)

tacrolimus hydrate (ISO)

tamoxifen (ISO)

tebuconazole (ISO)

testosterone (EXP)

tetrachloromethane (ISO)

tetraethylenepentamine (ISO)

tetraphene (ISO)

thioacetamide (EXP)

thymoquinone (ISO)

titanium dioxide (ISO)

tolfenamic acid (ISO)

topotecan (EXP)

trichostatin A (ISO)

triclosan (ISO)

urethane (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cartilage morphogenesis (ISO)

cell migration (ISO)

epithelial cell migration (ISO)

epithelial to mesenchymal transition (ISO,TAS)

epithelial to mesenchymal transition involved in endocardial cushion formation (ISO)

hair follicle morphogenesis (ISO)

heterochromatin organization (ISO)

left/right pattern formation (ISO)

mesoderm development (ISO)

mesoderm formation (ISO)

negative regulation of cell cycle (TAS)

negative regulation of cell differentiation involved in embryonic placenta development (ISO)

negative regulation of DNA damage response, signal transduction by p53 class mediator (ISO)

negative regulation of DNA-templated transcription (ISO)

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

negative regulation of vitamin D biosynthetic process (ISO)

Notch signaling involved in heart development (ISO)

osteoblast differentiation (ISO)

positive regulation of cell migration (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of epithelial to mesenchymal transition (ISO)

regulation of bicellular tight junction assembly (ISO)

regulation of transcription by RNA polymerase II (IBA,ISO)

roof of mouth development (ISO)

trophoblast giant cell differentiation (ISO)

Cellular Component

cytoplasm (ISO)

cytosol (ISO)

fibrillar center (ISO)

intracellular membrane-bounded organelle (ISO)

nucleoplasm (ISO)

nucleus (ISO)

pericentric heterochromatin (ISO)

Molecular Function

DNA-binding transcription factor activity (IBA)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IBA,ISO)

E-box binding (ISO)

kinase binding (ISO)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO)

sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Snail blocks the cell cycle and confers resistance to cell death.	Vega S, etal., Genes Dev 2004 May 15;18(10):1131-43.
7.	Snail and Axin2 expression predict the malignant transformation of oral leukoplakia.	Zhang X, etal., Oral Oncol. 2017 Oct;73:48-55. doi: 10.1016/j.oraloncology.2017.08.004. Epub 2017 Aug 12.

Additional References at PubMed

PMID:1302246	PMID:9676199	PMID:10655586	PMID:11689706	PMID:11912130	PMID:12477932	PMID:12832491	PMID:12917416	PMID:15314165	PMID:15448698	PMID:15630473	PMID:16096638
PMID:16801545	PMID:17093497	PMID:17376812	PMID:17692821	PMID:18663143	PMID:18832382	PMID:19502595	PMID:19955572	PMID:20018240	PMID:20128911	PMID:20890042	PMID:20930141
PMID:23288509	PMID:23460471	PMID:23707238	PMID:23831330	PMID:24209753	PMID:24239292	PMID:24379627	PMID:25303734	PMID:25893292	PMID:26781174	PMID:26884822	PMID:31115509
PMID:31668740	PMID:32187849

Genomics

Comparative Map Data

Snai1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	156,248,479 - 156,252,969 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	156,248,485 - 156,252,969 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	160,043,780 - 160,048,265 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	168,542,842 - 168,547,327 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	166,284,546 - 166,289,031 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	164,274,710 - 164,279,199 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	164,274,710 - 164,279,378 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	170,425,898 - 170,430,387 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	158,676,980 - 158,681,471 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	158,583,924 - 158,586,727 (+)	NCBI
Celera	3	154,827,543 - 154,832,032 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

SNAI1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	49,982,980 - 49,988,886 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	20	49,982,980 - 49,988,886 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	48,599,517 - 48,605,423 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	48,032,934 - 48,038,830 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	48,032,933 - 48,038,825	NCBI
Celera	20	45,304,074 - 45,309,984 (+)	NCBI		Celera
Cytogenetic Map	20	q13.13	NCBI
HuRef	20	45,348,282 - 45,354,192 (+)	NCBI		HuRef
CHM1_1	20	48,504,120 - 48,510,030 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	51,752,473 - 51,758,373 (+)	NCBI		T2T-CHM13v2.0

Snai1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	167,380,115 - 167,384,734 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	167,380,115 - 167,384,734 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	167,538,195 - 167,542,814 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	167,538,195 - 167,542,814 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	167,363,727 - 167,368,314 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	167,229,432 - 167,234,019 (+)	NCBI		MGSCv36	mm8
Celera	2	173,478,489 - 173,483,072 (+)	NCBI		Celera
Cytogenetic Map	2	H3	NCBI
cM Map	2	87.33	NCBI

Snai1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955445	8,231,924 - 8,237,996 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955445	8,232,084 - 8,237,893 (-)	NCBI	ChiLan1.0	ChiLan1.0

SNAI1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	20	47,384,818 - 47,390,738 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	47,384,818 - 47,390,733 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	20	46,321,075 - 46,328,865 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

SNAI1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	36,498,343 - 36,503,623 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	36,498,062 - 36,503,628 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	35,741,546 - 35,747,503 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	37,204,007 - 37,209,960 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	37,204,036 - 37,209,945 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	36,445,442 - 36,451,401 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	36,578,693 - 36,584,651 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	37,122,272 - 37,128,230 (+)	NCBI		UU_Cfam_GSD_1.0

Snai1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	189,002,837 - 189,012,567 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936514	4,456,484 - 4,462,987 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936514	4,456,498 - 4,462,436 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SNAI1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	51,546,477 - 51,552,499 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	51,546,446 - 51,552,498 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

SNAI1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	13,988,059 - 13,993,780 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	13,988,024 - 13,993,746 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	62,416,997 - 62,422,718 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Snai1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624790	5,509,311 - 5,515,266 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624790	5,509,541 - 5,515,240 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Snai1
15 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	375
Count of miRNA genes:	200
Interacting mature miRNAs:	251
Transcripts:	ENSRNOT00000012939
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141339013	162184794	Rat
2317883	Alcrsp26	Alcohol response QTL 26	1.8	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	3	145526770	169034231	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	145925360	166177555	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	145925360	166177555	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	145925360	166177555	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	145925360	166177555	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	145925360	166177555	Rat
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	145925360	166177555	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145925360	166177555	Rat
1300113	Bp176	Blood pressure QTL 176	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145956084	157309487	Rat
1598854	Memor10	Memory QTL 10	2		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	3	145956084	161299569	Rat
8552791	Vie2	Viral induced encephalitis QTL 2	4.1		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	3	145956084	169034231	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	149040888	168026850	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		26	4	4	2	4			6	20	27	3
Low	3	16	44	29	16	29	4	7	60	15	14	8	4
Below cutoff		1	9	8	1	8	4	4	8				4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053805	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC131854	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF295301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079210	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000012939 ⟹ ENSRNOP00000012939

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	156,248,485 - 156,252,969 (+)	Ensembl
Rnor_6.0 Ensembl	3	164,274,710 - 164,279,194 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000077581 ⟹ ENSRNOP00000071187

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	3	164,275,095 - 164,279,378 (+)	Ensembl

RefSeq Acc Id:

NM_053805 ⟹ NP_446257

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	156,248,479 - 156,252,969 (+)	NCBI
Rnor_6.0	3	164,274,710 - 164,279,199 (+)	NCBI
Rnor_5.0	3	170,425,898 - 170,430,387 (+)	NCBI
RGSC_v3.4	3	158,676,980 - 158,681,471 (+)	RGD
Celera	3	154,827,543 - 154,832,032 (+)	RGD

Sequence:

show sequence

CGGCCGGGCCTCGCGAGCAGAGTTGTCTACCGACCTTGCGCGACCCGGTGACCCCGACTACCTA
GGTCGCTCCGGCCACCATGCCGCGCTCCTTCCTGGTCAGGAAGCCGTCCGACCCCCGCCGGAAG
CCCAACTATAGCGAGCTGCAGGACGCGTGTGTGGAGTTCACCTTCCAGCAGCCCTACGACCAGG
CCCACCTGCTGGCGGCCATCCCTCCGCCCGAGGTCCTCAACCCCGCCGCTTCGCTGCCCACCCT
CATCTGGGACTCTCTCCTGGTGCCCCAAGTACAGCCGGTGGCCTGGGCCACCCTCCCGCTGCGG
GAGAGCCCCAGGGCCGCAGAGCTGACTTCTCTGTCCGATGAGGACAGTGGCAAAAGCTCCCAGC
CGCCCAGCCCGCCCTCGCCGGCGCCGTCGTCCTTCTCTTCCACCTCGGCCTCATCCCTGGAAGC
CGAGGCCTTCATTGCCTTCCCGGGCTTGGGCCAACTTCCCAAGCAGCTGGCCAGGCTCTCGGTG
GCCAAGGACCCCCAGTCCCGGAAGGCCTTCAACTGCAAATATTGTAATAAGGAGTACCTCAGCC
TGGGCGCTCTGAAGATGCACATCCGAAGCCACACGCTGCCTTGCGTCTGCACGACCTGCGGAAA
GGCCTTCTCCAGGCCCTGGCTGCTCCAGGGCCACGTCCGCACCCACACTGGTGAGAAGCCTTTC
TCCTGCTCCCACTGCAACCGTGCCTTTGCCGACCGCTCCAACCTACGTGCCCACCTCCAGACCC
ACTCGGATGTGAAGAGATACCAGTGTCAGGCCTGCGCCCGAACCTTCTCCCGAATGTCCTTGCT
CCACAAACACCAAGAGTCTGGCTGCTCCGGAGGCCCTCGCTGACCCTGCTACCTCCCCATCCTC
ACTGGCATCTCCCTGGTGCCCTGGAGCTCCTCACTGCCAGGATTCCTTCCAGCTTAAGTCCAGG
GACCTGTGGAGTCCATGTCTGGCCCTGGTTCCTGCTTGGCTCTCTTGGTGGCCTTTGCTGCAGA
TGGCTGATGGAAGGCAGAGTGCCTTTGTACCCTCCCAGAGCCTCCTGCCCCTCAGTATTCATGA
GGTGTAGCCTCTGGACACAGCTGCTTCGAGCCATAGAACTAAAGCCAACCCACTGGCTGGGAAG
CTTGAACCCCACTCAGGGGACCCCACTTCCCTACCTCCCCCAAGGACCCTTTCAGGCCACCTTC
CTCGAGGTACAACAGACTATGCAATAGTCCCATCCCTCCTGCGTCCATGCCTCGGCAGGGTGGT
TACTGGACACATGTCCAGGTGCCCCTGGGCCTGAGCAGCTGTTTCAGCCCCCGCCCCATTTGTC
CTGGGGACACCTGTCTCACAGCAGTTTAACTGTCTCAGAAGGGACCATGAATAATGGCCGTCAC
TTGTTAGGGGCCAAGTGGGGTGCTTCAGCCTGGCCAACGTGTCTCCCAGAACTATTTTGGGGCC
CAACAGGTGTCCCCGGGGAGAAAGATGTTTACATTTTAAAGGTATTTATATTGTAAGCAGCATT
TTGTATAGTTGATATGTACAGTTTATTGATATTCAATAAAGTGGTTAATTTATATACTAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446257	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG31598	(Get FASTA)	NCBI Sequence Viewer
	AAH79210	(Get FASTA)	NCBI Sequence Viewer
	EDL96401	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_446257 ⟸ NM_053805

- UniProtKB:

Q6AY35 (UniProtKB/TrEMBL), E9PU82 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPRSFLVRKPSDPRRKPNYSELQDACVEFTFQQPYDQAHLLAAIPPPEVLNPAASLPTLIWDSL
LVPQVQPVAWATLPLRESPRAAELTSLSDEDSGKSSQPPSPPSPAPSSFSSTSASSLEAEAFIA
FPGLGQLPKQLARLSVAKDPQSRKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCTTCGKAFSRP
WLLQGHVRTHTGEKPFSCSHCNRAFADRSNLRAHLQTHSDVKRYQCQACARTFSRMSLLHKHQE
SGCSGGPR

hide sequence

RefSeq Acc Id:

ENSRNOP00000071187 ⟸ ENSRNOT00000077581

RefSeq Acc Id:

ENSRNOP00000012939 ⟸ ENSRNOT00000012939

Protein Domains

C2H2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AY35-F1-model_v2	AlphaFold	Q6AY35	1-264	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692692

Promoter ID:

EPDNEW_R3217

Type:

single initiation site

Name:

Snai1_1

Description:

snail family transcriptional repressor 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	164,274,701 - 164,274,761	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620758	AgrOrtholog
BioCyc Gene	G2FUF-46731	BioCyc
Ensembl Genes	ENSRNOG00000009594	Ensembl, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000012939.5	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000012939.6	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7131806	IMAGE-MGC_LOAD
InterPro	Znf_C2H2/integrase_DNA-bd	UniProtKB/TrEMBL
	Znf_C2H2_sf	UniProtKB/TrEMBL
KEGG Report	rno:116490	UniProtKB/TrEMBL
MGC_CLONE	MGC:94272	IMAGE-MGC_LOAD
NCBI Gene	116490	ENTREZGENE
Pfam	zf-C2H2	UniProtKB/TrEMBL
PhenoGen	Snai1	PhenoGen
PROSITE	ZINC_FINGER_C2H2_1	UniProtKB/TrEMBL
	ZINC_FINGER_C2H2_2	UniProtKB/TrEMBL
SMART	ZnF_C2H2	UniProtKB/TrEMBL
Superfamily-SCOP	SSF57667	UniProtKB/TrEMBL
UniProt	A0A8J8YBT6_RAT	UniProtKB/TrEMBL
	E9PU82	ENTREZGENE
	Q6AY35	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	E9PU82	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-11	Snai1	snail family transcriptional repressor 1	Snai1	snail family zinc finger 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-06-05	Snai1	snail family zinc finger 1	Snai1	snail homolog 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Snai1	snail homolog 1 (Drosophila)		snail homolog, (Drosophila)	Name updated	1299863	APPROVED
2004-09-10	Snai1	snail homolog, (Drosophila)	Sna		Symbol and Name updated	1299863	APPROVED
2002-08-07	Sna	snail homolog, (Drosophila)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI