Symbol:
Slco3a1
Name:
solute carrier organic anion transporter family, member 3a1
RGD ID:
620227
Description:
Predicted to enable prostaglandin transmembrane transporter activity and sodium-independent organic anion transmembrane transporter activity. Involved in prostaglandin transport. Predicted to be located in basal plasma membrane. Predicted to be active in basolateral plasma membrane. Orthologous to human SLCO3A1 (solute carrier organic anion transporter family member 3A1); INTERACTS WITH 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
OATP-D; organic anion-transporting polypeptide D; prostaglandin transporter subtype 2; Slc21a11; sodium-independent organic anion transporter D; solute carrier family 21 (organic anion transporter), member 11; solute carrier family 21 member 11; solute carrier organic anion transporter family member 3A1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLCO3A1 (solute carrier organic anion transporter family member 3A1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Slco3a1 (solute carrier organic anion transporter family, member 3a1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slco3a1 (solute carrier organic anion transporter family member 3A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLCO3A1 (solute carrier organic anion transporter family member 3A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLCO3A1 (solute carrier organic anion transporter family member 3A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slco3a1 (solute carrier organic anion transporter family member 3A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLCO3A1 (solute carrier organic anion transporter family member 3A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLCO3A1 (solute carrier organic anion transporter family member 3A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slco3a1 (solute carrier organic anion transporter family member 3A1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SLCO3A1 (solute carrier organic anion transporter family member 3A1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Slco3a1 (solute carrier organic anion transporter family, member 3a1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slco3a1 (solute carrier organic anion transporter family, member 3A1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:dkey-88i8.2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
F47E1.2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
F47E1.4
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
Y32F6B.1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
slco3a1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Is Marker For:
Strains:
SHRSP.WKY-(Slco3a1-D1Rat106 )/IzmTkyo
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 137,516,037 - 137,797,836 (-) NCBI GRCr8 mRatBN7.2 1 128,106,232 - 128,388,043 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 128,106,228 - 128,387,925 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 136,062,978 - 136,336,526 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 143,233,107 - 143,506,677 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 136,101,551 - 136,374,041 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 135,790,854 - 136,073,640 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 135,790,810 - 136,073,540 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 136,793,300 - 137,070,909 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 129,580,126 - 130,077,110 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 129,658,468 - 130,155,453 (-) NCBI Celera 1 120,235,201 - 120,503,802 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slco3a1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:733471 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SLCO3A1 mRNA CTD PMID:22079256 Slco3a1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:733472 6480464 1,2-Dimethylhydrazine results in increased expression of SLCO3A1 mRNA CTD PMID:22206623 Slco3a1 Rat 17beta-estradiol multiple interactions ISO RGD:733471 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of SLCO3A1 mRNA; [Progesterone co-treated with more ... CTD PMID:17404688|PMID:30165855 Slco3a1 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO RGD:733472 6480464 [Flame Retardants results in increased abundance of 2,2',4,4'-tetrabromodiphenyl ether] which results in decreased expression of more ... CTD PMID:38995820 Slco3a1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:733472 6480464 Tetrachlorodibenzodioxin affects the expression of SLCO3A1 mRNA CTD PMID:21570461 Slco3a1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO RGD:733472 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of SLCO3A1 mRNA CTD PMID:15919853 Slco3a1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:733472 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of SLCO3A1 mRNA CTD PMID:20188158 Slco3a1 Rat 3-iodothyronamine affects uptake ISO RGD:733471 6480464 SLCO3A1 mRNA affects the uptake of 3-iodothyronamine CTD PMID:19074582 Slco3a1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:733472 6480464 4,4'-diaminodiphenylmethane results in decreased expression of SLCO3A1 mRNA CTD PMID:18648102 Slco3a1 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:733472 6480464 bisphenol S results in decreased expression of SLCO3A1 mRNA CTD PMID:39298647 Slco3a1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Slco3a1 Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:733472 6480464 Fenretinide results in decreased expression of SLCO3A1 mRNA CTD PMID:28973697 Slco3a1 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:733472 6480464 Fenretinide results in increased expression of SLCO3A1 mRNA CTD PMID:28973697 Slco3a1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SLCO3A1 mRNA CTD PMID:24780913 Slco3a1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of SLCO3A1 mRNA CTD PMID:31881176 Slco3a1 Rat all-trans-retinoic acid decreases expression ISO RGD:733472 6480464 Tretinoin results in decreased expression of SLCO3A1 mRNA CTD PMID:16604517 Slco3a1 Rat all-trans-retinoic acid increases expression ISO RGD:733471 6480464 Tretinoin results in increased expression of SLCO3A1 mRNA CTD PMID:33167477 Slco3a1 Rat amosite asbestos decreases expression ISO RGD:733472 6480464 Asbestos, Amosite results in decreased expression of SLCO3A1 mRNA CTD PMID:23917077 Slco3a1 Rat antirheumatic drug decreases expression ISO RGD:733471 6480464 Antirheumatic Agents results in decreased expression of SLCO3A1 mRNA CTD PMID:24449571 Slco3a1 Rat arsane affects methylation ISO RGD:733471 6480464 Arsenic affects the methylation of SLCO3A1 gene CTD PMID:25304211 Slco3a1 Rat arsenic atom affects methylation ISO RGD:733471 6480464 Arsenic affects the methylation of SLCO3A1 gene CTD PMID:25304211 Slco3a1 Rat arsenite(3-) increases methylation ISO RGD:733471 6480464 arsenite results in increased methylation of SLCO3A1 promoter CTD PMID:23974009 Slco3a1 Rat arsenous acid increases expression ISO RGD:733471 6480464 Arsenic Trioxide results in increased expression of SLCO3A1 mRNA CTD PMID:15761015 Slco3a1 Rat Azoxymethane multiple interactions ISO RGD:733472 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLCO3A1 more ... CTD PMID:29950665 Slco3a1 Rat benzo[a]pyrene decreases expression ISO RGD:733471 6480464 Benzo(a)pyrene results in decreased expression of SLCO3A1 mRNA CTD PMID:20064835 Slco3a1 Rat benzo[a]pyrene increases expression ISO RGD:733472 6480464 Benzo(a)pyrene results in increased expression of SLCO3A1 mRNA CTD PMID:32417428 Slco3a1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:733471 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of SLCO3A1 mRNA CTD PMID:19150397 Slco3a1 Rat benzylpenicillin multiple interactions ISO RGD:733471 6480464 Penicillin G promotes the reaction [SLCO3A1 protein results in increased uptake of simvastatin acid] CTD PMID:28887287 Slco3a1 Rat beta-lapachone decreases expression ISO RGD:733471 6480464 beta-lapachone results in decreased expression of SLCO3A1 mRNA CTD PMID:38218311 Slco3a1 Rat beta-naphthoflavone increases expression ISO RGD:733472 6480464 beta-Naphthoflavone results in increased expression of SLCO3A1 mRNA CTD PMID:15919853 Slco3a1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SLCO3A1 mRNA CTD PMID:25181051 Slco3a1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Slco3a1 Rat bisphenol A decreases methylation ISO RGD:733471 6480464 bisphenol A results in decreased methylation of SLCO3A1 gene CTD PMID:31601247 Slco3a1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLCO3A1 mRNA CTD PMID:30816183|PMID:32528016|PMID:34947998 Slco3a1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Slco3a1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of SLCO3A1 mRNA CTD PMID:33453195 Slco3a1 Rat carbon nanotube decreases expression ISO RGD:733472 6480464 Nanotubes, Carbon analog results in decreased expression of SLCO3A1 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681|PMID:25620056 Slco3a1 Rat CGP 52608 multiple interactions ISO RGD:733471 6480464 CGP 52608 promotes the reaction [RORA protein binds to SLCO3A1 gene] CTD PMID:28238834 Slco3a1 Rat chlordecone increases expression ISO RGD:733472 6480464 Chlordecone results in increased expression of SLCO3A1 mRNA CTD PMID:33711761 Slco3a1 Rat choline multiple interactions ISO RGD:733472 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Slco3a1 Rat ciguatoxin CTX1B affects expression ISO RGD:733472 6480464 Ciguatoxins affects the expression of SLCO3A1 mRNA CTD PMID:18353800 Slco3a1 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of SLCO3A1 mRNA CTD PMID:22023808 Slco3a1 Rat cisplatin multiple interactions ISO RGD:733471 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of SLCO3A1 mRNA CTD PMID:27392435 Slco3a1 Rat cisplatin decreases expression ISO RGD:733471 6480464 Cisplatin results in decreased expression of SLCO3A1 mRNA CTD PMID:27392435 Slco3a1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of SLCO3A1 mRNA CTD PMID:30556269 Slco3a1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of SLCO3A1 mRNA CTD PMID:30556269 Slco3a1 Rat crocidolite asbestos decreases expression ISO RGD:733472 6480464 Asbestos, Crocidolite results in decreased expression of SLCO3A1 mRNA CTD PMID:23917077 Slco3a1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of SLCO3A1 mRNA CTD PMID:27523638 Slco3a1 Rat cyclosporin A multiple interactions ISO RGD:733471 6480464 Cyclosporine promotes the reaction [SLCO3A1 protein results in increased uptake of Fluorescein]; Cyclosporine promotes the more ... CTD PMID:28887287 Slco3a1 Rat dexamethasone increases expression ISO RGD:733472 6480464 Dexamethasone results in increased expression of SLCO3A1 mRNA CTD PMID:22733784 Slco3a1 Rat dextran sulfate multiple interactions ISO RGD:733472 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLCO3A1 more ... CTD PMID:29950665 Slco3a1 Rat diarsenic trioxide increases expression ISO RGD:733471 6480464 Arsenic Trioxide results in increased expression of SLCO3A1 mRNA CTD PMID:15761015 Slco3a1 Rat Dibutyl phosphate affects expression ISO RGD:733471 6480464 di-n-butylphosphoric acid affects the expression of SLCO3A1 mRNA CTD PMID:37042841 Slco3a1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SLCO3A1 mRNA CTD PMID:21266533 Slco3a1 Rat dibutyl phthalate affects expression EXP 6480464 Dibutyl Phthalate affects the expression of SLCO3A1 mRNA CTD PMID:30934153 Slco3a1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of SLCO3A1 mRNA CTD PMID:21551480 Slco3a1 Rat doxorubicin decreases expression ISO RGD:733471 6480464 Doxorubicin results in decreased expression of SLCO3A1 mRNA CTD PMID:29803840 Slco3a1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of SLCO3A1 mRNA CTD PMID:29391264 Slco3a1 Rat epoxiconazole increases expression ISO RGD:733472 6480464 epoxiconazole results in increased expression of SLCO3A1 mRNA CTD PMID:35436446 Slco3a1 Rat estrone 3-sulfate multiple interactions ISO RGD:733471 6480464 estrone sulfate promotes the reaction [SLCO3A1 protein results in increased uptake of simvastatin acid] CTD PMID:28887287 Slco3a1 Rat ethanol affects expression ISO RGD:733472 6480464 Ethanol affects the expression of SLCO3A1 mRNA CTD PMID:30319688 Slco3a1 Rat ethanol affects splicing ISO RGD:733472 6480464 Ethanol affects the splicing of SLCO3A1 mRNA CTD PMID:30319688 Slco3a1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of SLCO3A1 mRNA CTD PMID:30307764 Slco3a1 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of SLCO3A1 mRNA CTD PMID:18035473 Slco3a1 Rat fluorescein (lactone form) increases uptake ISO RGD:733471 6480464 SLCO3A1 protein results in increased uptake of Fluorescein CTD PMID:28887287 Slco3a1 Rat fluorescein (lactone form) multiple interactions ISO RGD:733471 6480464 Cyclosporine promotes the reaction [SLCO3A1 protein results in increased uptake of Fluorescein]; simvastatin acid affects more ... CTD PMID:28887287 Slco3a1 Rat folic acid multiple interactions ISO RGD:733472 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Slco3a1 Rat fonofos decreases methylation ISO RGD:733471 6480464 Fonofos results in decreased methylation of SLCO3A1 promoter CTD PMID:22847954 Slco3a1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SLCO3A1 mRNA CTD PMID:33387578 Slco3a1 Rat glyphosate increases expression ISO RGD:733472 6480464 Glyphosate results in increased expression of SLCO3A1 mRNA CTD PMID:35897073 Slco3a1 Rat indoxyl sulfate multiple interactions ISO RGD:733471 6480464 Indican promotes the reaction [SLCO3A1 protein results in increased uptake of simvastatin acid] CTD PMID:28887287 Slco3a1 Rat isoprenaline increases expression ISO RGD:733472 6480464 Isoproterenol results in increased expression of SLCO3A1 mRNA CTD PMID:20003209 Slco3a1 Rat L-methionine multiple interactions ISO RGD:733472 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Slco3a1 Rat lead(0) increases expression ISO RGD:733471 6480464 Lead results in increased expression of SLCO3A1 mRNA CTD PMID:37386098 Slco3a1 Rat lipopolysaccharide multiple interactions ISO RGD:733471 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of SLCO3A1 mRNA CTD PMID:35811015 Slco3a1 Rat lipopolysaccharide increases expression ISO RGD:733471 6480464 Lipopolysaccharides results in increased expression of SLCO3A1 mRNA CTD PMID:35811015 Slco3a1 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of SLCO3A1 mRNA CTD PMID:28801915 Slco3a1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of SLCO3A1 gene CTD PMID:35440735 Slco3a1 Rat microcystin-LR increases expression EXP 6480464 cyanoginosin LR results in increased expression of SLCO3A1 mRNA; cyanoginosin LR results in increased expression more ... CTD PMID:22579952 Slco3a1 Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of SLCO3A1 mRNA CTD PMID:21515302 Slco3a1 Rat okadaic acid increases expression ISO RGD:733471 6480464 Okadaic Acid results in increased expression of SLCO3A1 mRNA CTD PMID:38832940 Slco3a1 Rat ozone multiple interactions ISO RGD:733471 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of SLCO3A1 mRNA CTD PMID:35430440 Slco3a1 Rat paracetamol affects expression ISO RGD:733472 6480464 Acetaminophen affects the expression of SLCO3A1 mRNA CTD PMID:17562736 Slco3a1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SLCO3A1 mRNA CTD PMID:33387578 Slco3a1 Rat paracetamol increases expression ISO RGD:733471 6480464 Acetaminophen results in increased expression of SLCO3A1 mRNA CTD PMID:29067470 Slco3a1 Rat parathion decreases methylation ISO RGD:733471 6480464 Parathion results in decreased methylation of SLCO3A1 promoter CTD PMID:22847954 Slco3a1 Rat potassium chromate decreases expression ISO RGD:733471 6480464 potassium chromate(VI) results in decreased expression of SLCO3A1 mRNA CTD PMID:22079256 Slco3a1 Rat potassium chromate multiple interactions ISO RGD:733471 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SLCO3A1 mRNA CTD PMID:22079256 Slco3a1 Rat progesterone multiple interactions ISO RGD:733471 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of SLCO3A1 mRNA CTD PMID:17404688 Slco3a1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of SLCO3A1 mRNA; Rotenone results in decreased expression of SLCO3A1 more ... CTD PMID:28374803|PMID:35544339 Slco3a1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:733471 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of SLCO3A1 mRNA CTD PMID:35811015 Slco3a1 Rat S-nitrosoglutathione decreases expression ISO RGD:733471 6480464 S-Nitrosoglutathione results in decreased expression of SLCO3A1 mRNA CTD PMID:38825487 Slco3a1 Rat silicon dioxide increases expression ISO RGD:733472 6480464 Silicon Dioxide results in increased expression of SLCO3A1 mRNA CTD PMID:23221170 Slco3a1 Rat simvastatin hydroxy acid multiple interactions ISO RGD:733471 6480464 Cyclosporine promotes the reaction [SLCO3A1 protein results in increased uptake of simvastatin acid]; estrone sulfate more ... CTD PMID:28887287 Slco3a1 Rat simvastatin hydroxy acid increases uptake ISO RGD:733471 6480464 SLCO3A1 protein results in increased uptake of simvastatin acid CTD PMID:28887287 Slco3a1 Rat simvastatin hydroxy acid decreases expression ISO RGD:733471 6480464 simvastatin acid results in decreased expression of SLCO3A1 protein CTD PMID:28887287 Slco3a1 Rat sodium arsenite decreases expression ISO RGD:733471 6480464 sodium arsenite results in decreased expression of SLCO3A1 mRNA CTD PMID:22714537 Slco3a1 Rat sulforaphane decreases expression ISO RGD:733471 6480464 sulforaphane results in decreased expression of SLCO3A1 mRNA CTD PMID:31838189 Slco3a1 Rat terbufos decreases methylation ISO RGD:733471 6480464 terbufos results in decreased methylation of SLCO3A1 promoter CTD PMID:22847954 Slco3a1 Rat Tesaglitazar decreases expression EXP 6480464 tesaglitazar results in decreased expression of SLCO3A1 mRNA CTD PMID:21515302 Slco3a1 Rat testosterone decreases expression ISO RGD:733472 6480464 Testosterone deficiency results in decreased expression of SLCO3A1 mRNA CTD PMID:33848595 Slco3a1 Rat tetrachloroethene decreases expression ISO RGD:733472 6480464 Tetrachloroethylene results in decreased expression of SLCO3A1 mRNA CTD PMID:28973375 Slco3a1 Rat tetrachloromethane affects expression ISO RGD:733472 6480464 Carbon Tetrachloride affects the expression of SLCO3A1 mRNA CTD PMID:17484886 Slco3a1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of SLCO3A1 mRNA CTD PMID:31150632 Slco3a1 Rat titanium dioxide multiple interactions ISO RGD:733472 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLCO3A1 more ... CTD PMID:29950665 Slco3a1 Rat titanium dioxide decreases methylation ISO RGD:733472 6480464 titanium dioxide results in decreased methylation of SLCO3A1 gene CTD PMID:35295148 Slco3a1 Rat toluene affects expression EXP 6480464 Toluene affects the expression of SLCO3A1 mRNA CTD PMID:18653662 Slco3a1 Rat triphenyl phosphate affects expression ISO RGD:733471 6480464 triphenyl phosphate affects the expression of SLCO3A1 mRNA CTD PMID:37042841 Slco3a1 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of SLCO3A1 mRNA CTD PMID:21515302 Slco3a1 Rat undecane decreases expression EXP 6480464 undecane results in decreased expression of SLCO3A1 protein CTD PMID:17337753 Slco3a1 Rat valproic acid decreases expression ISO RGD:733471 6480464 Valproic Acid results in decreased expression of SLCO3A1 mRNA CTD PMID:29154799 Slco3a1 Rat valproic acid increases expression ISO RGD:733471 6480464 Valproic Acid results in increased expression of SLCO3A1 mRNA CTD PMID:19101580|PMID:23179753|PMID:27188386 Slco3a1 Rat valproic acid affects expression ISO RGD:733471 6480464 Valproic Acid affects the expression of SLCO3A1 mRNA CTD PMID:25979313 Slco3a1 Rat vancomycin decreases expression ISO RGD:733472 6480464 Vancomycin results in decreased expression of SLCO3A1 mRNA CTD PMID:18930951 Slco3a1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of SLCO3A1 mRNA CTD PMID:23034163 Slco3a1 Rat zoledronic acid decreases expression ISO RGD:733471 6480464 zoledronic acid results in decreased expression of SLCO3A1 mRNA CTD PMID:20977926 Slco3a1 Rat zoledronic acid increases expression ISO RGD:733471 6480464 zoledronic acid results in increased expression of SLCO3A1 mRNA CTD PMID:24714768
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-iodothyronamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) all-trans-retinoic acid (ISO) amosite asbestos (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzylpenicillin (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium dichloride (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) choline (ISO) ciguatoxin CTX1B (ISO) cisplatin (EXP,ISO) copper atom (EXP) copper(0) (EXP) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) diuron (EXP) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) estrone 3-sulfate (ISO) ethanol (ISO) fenvalerate (EXP) flavonoids (EXP) fluorescein (lactone form) (ISO) folic acid (ISO) fonofos (ISO) gentamycin (EXP) glyphosate (ISO) indoxyl sulfate (ISO) isoprenaline (ISO) L-methionine (ISO) lead(0) (ISO) lipopolysaccharide (ISO) manganese(II) chloride (EXP) methoxychlor (EXP) microcystin-LR (EXP) Muraglitazar (EXP) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) parathion (ISO) potassium chromate (ISO) progesterone (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) S-nitrosoglutathione (ISO) silicon dioxide (ISO) simvastatin hydroxy acid (ISO) sodium arsenite (ISO) sulforaphane (ISO) terbufos (ISO) Tesaglitazar (EXP) testosterone (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP,ISO) titanium dioxide (ISO) toluene (EXP) triphenyl phosphate (ISO) troglitazone (EXP) undecane (EXP) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) zoledronic acid (ISO)
Slco3a1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 137,516,037 - 137,797,836 (-) NCBI GRCr8 mRatBN7.2 1 128,106,232 - 128,388,043 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 128,106,228 - 128,387,925 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 136,062,978 - 136,336,526 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 143,233,107 - 143,506,677 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 136,101,551 - 136,374,041 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 135,790,854 - 136,073,640 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 135,790,810 - 136,073,540 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 136,793,300 - 137,070,909 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 129,580,126 - 130,077,110 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 129,658,468 - 130,155,453 (-) NCBI Celera 1 120,235,201 - 120,503,802 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
SLCO3A1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 91,853,708 - 92,172,435 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 91,853,708 - 92,172,435 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 92,396,938 - 92,715,665 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 90,197,950 - 90,507,783 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 90,197,949 - 90,507,783 NCBI Celera 15 68,809,625 - 69,127,530 (+) NCBI Celera Cytogenetic Map 15 q26.1 NCBI HuRef 15 68,535,792 - 68,852,636 (+) NCBI HuRef CHM1_1 15 92,238,177 - 92,556,655 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 89,615,458 - 89,934,870 (+) NCBI T2T-CHM13v2.0
Slco3a1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 73,925,166 - 74,204,528 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 73,925,167 - 74,204,528 (-) Ensembl GRCm39 Ensembl GRCm38 7 74,275,418 - 74,554,780 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 74,275,419 - 74,554,780 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 81,420,304 - 81,699,666 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 74,148,931 - 74,428,293 (-) NCBI MGSCv36 mm8 Celera 7 71,722,299 - 72,002,017 (-) NCBI Celera Cytogenetic Map 7 D1 NCBI cM Map 7 42.95 NCBI
Slco3a1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 20,186,940 - 20,483,958 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 20,186,940 - 20,483,844 (+) NCBI ChiLan1.0 ChiLan1.0
SLCO3A1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 81,399,080 - 81,720,058 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 85,099,736 - 85,420,671 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 70,537,924 - 70,858,714 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 89,735,202 - 90,055,251 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 89,739,022 - 90,054,678 (+) Ensembl panpan1.1 panPan2
SLCO3A1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 47,927,280 - 48,233,666 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 47,927,664 - 48,233,703 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 50,628,974 - 50,868,877 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 48,346,093 - 48,649,188 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 48,346,095 - 48,649,226 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 47,847,277 - 48,150,531 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 48,078,812 - 48,381,929 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 48,420,025 - 48,723,118 (-) NCBI UU_Cfam_GSD_1.0
Slco3a1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 135,491,779 - 135,786,720 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936483 10,547,687 - 10,778,752 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936483 10,554,049 - 10,778,662 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLCO3A1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 86,777,920 - 87,103,309 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 86,777,919 - 87,103,316 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 92,719,394 - 93,045,275 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLCO3A1
Slco3a1
.
Predicted Target Of
Count of predictions: 51 Count of miRNA genes: 48 Interacting mature miRNAs: 48 Transcripts: ENSRNOT00000043854 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 631570 Bp94 Blood pressure QTL 94 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123479780 142990467 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514) 1 83547917 128547917 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 2325726 Eae30 Experimental allergic encephalomyelitis QTL 30 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 1 123053310 128593844 Rat
D1Got113
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 128,354,401 - 128,354,489 (+) MAPPER mRatBN7.2 Rnor_6.0 1 136,040,289 - 136,040,376 NCBI Rnor6.0 Rnor_5.0 1 137,037,664 - 137,037,751 UniSTS Rnor5.0 RGSC_v3.4 1 130,043,124 - 130,043,212 RGD RGSC3.4 RGSC_v3.4 1 130,043,125 - 130,043,212 UniSTS RGSC3.4 RGSC_v3.1 1 130,121,468 - 130,121,555 RGD Celera 1 120,470,627 - 120,470,714 UniSTS RH 3.4 Map 1 1004.6 UniSTS RH 3.4 Map 1 1004.6 RGD RH 2.0 Map 1 657.4 RGD Cytogenetic Map 1 q31 UniSTS
D1Mco53
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 128,319,846 - 128,320,087 (+) MAPPER mRatBN7.2 Rnor_6.0 1 136,004,907 - 136,005,145 NCBI Rnor6.0 Rnor_5.0 1 137,004,640 - 137,004,878 UniSTS Rnor5.0 RGSC_v3.4 1 130,009,733 - 130,009,971 UniSTS RGSC3.4 Celera 1 120,436,880 - 120,437,118 UniSTS Cytogenetic Map 1 q31 UniSTS
BF387901
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 128,116,921 - 128,117,134 (+) MAPPER mRatBN7.2 Rnor_6.0 1 135,801,539 - 135,801,751 NCBI Rnor6.0 Rnor_5.0 1 136,803,985 - 136,804,197 UniSTS Rnor5.0 RGSC_v3.4 1 129,581,864 - 129,582,076 UniSTS RGSC3.4 Celera 1 120,236,939 - 120,237,151 UniSTS RH 3.4 Map 1 996.5 UniSTS Cytogenetic Map 1 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000043854 ⟹ ENSRNOP00000049659
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 135,799,801 - 136,073,483 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000075893
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 135,812,970 - 136,073,540 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000076340 ⟹ ENSRNOP00000068179
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 135,799,750 - 136,073,540 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000082564 ⟹ ENSRNOP00000074908
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 128,106,228 - 128,387,925 (-) Ensembl Rnor_6.0 Ensembl 1 135,790,810 - 136,073,496 (-) Ensembl
RefSeq Acc Id:
NM_177481 ⟹ NP_803434
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 137,516,037 - 137,797,836 (-) NCBI mRatBN7.2 1 128,106,232 - 128,388,043 (-) NCBI Rnor_6.0 1 135,799,801 - 136,073,483 (-) NCBI Rnor_5.0 1 136,793,300 - 137,070,909 (-) NCBI RGSC_v3.4 1 129,580,126 - 130,077,110 (-) RGD Celera 1 120,235,201 - 120,503,802 (-) RGD
Sequence:
ATGCAGGGAAAGAAGCCGGGCGGCTCGTCGGGCGGCGGCCGGAGCGGCGAGCTGCAGGGGGACGAGGCGCAGAGGAACAAGAAGAAGAAAAAGAAGGTGTCCTGCTTCTCCAACATCAAGATCTTCCT
hide sequence
RefSeq Acc Id:
NP_803434 ⟸ NM_177481
- UniProtKB:
A6JBZ2 (UniProtKB/TrEMBL)
- Sequence:
MQGKKPGGSSGGGRSGELQGDEAQRNKKKKKKVSCFSNIKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGALLSALPEF
hide sequence
Ensembl Acc Id:
ENSRNOP00000049659 ⟸ ENSRNOT00000043854
Ensembl Acc Id:
ENSRNOP00000074908 ⟸ ENSRNOT00000082564
Ensembl Acc Id:
ENSRNOP00000068179 ⟸ ENSRNOT00000076340
RGD ID: 13690124 Promoter ID: EPDNEW_R642 Type: multiple initiation site Name: Slco3a1_1 Description: solute carrier organic anion transporter family, member 3a1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 136,073,638 - 136,073,698 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Slco3a1
solute carrier organic anion transporter family, member 3a1
Slc21a11
solute carrier family 21 (organic anion transporter), member 11
Symbol and Name updated
1299863 APPROVED
2002-08-07
Slc21a11
solute carrier family 21 (organic anion transporter), member 11
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
protein is expressed in the vascular, renal, and reproductive system
737652
