Symbol:
Slco3a1
Name:
solute carrier organic anion transporter family member 3A1
RGD ID:
8991684
Description:
ENCODES a protein that exhibits organic anion transmembrane transporter activity (ortholog); prostaglandin transmembrane transporter activity (ortholog); INVOLVED IN positive regulation of canonical NF-kappaB signal transduction (ortholog); positive regulation of MAPK cascade (ortholog); prostaglandin transport (ortholog); FOUND IN basal plasma membrane (ortholog); plasma membrane (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
solute carrier organic anion transporter family, member 3A1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
NCBI Annotation Information:
Annotation category: partial on reference assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 20,186,940 - 20,483,958 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 20,186,940 - 20,483,844 (+) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Slco3a1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 20,186,940 - 20,483,958 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 20,186,940 - 20,483,844 (+) NCBI ChiLan1.0 ChiLan1.0
SLCO3A1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 91,853,708 - 92,172,435 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 91,853,708 - 92,172,435 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 92,396,938 - 92,715,665 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 90,197,950 - 90,507,783 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 90,197,949 - 90,507,783 NCBI Celera 15 68,809,625 - 69,127,530 (+) NCBI Celera Cytogenetic Map 15 q26.1 NCBI HuRef 15 68,535,792 - 68,852,636 (+) NCBI HuRef CHM1_1 15 92,238,177 - 92,556,655 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 89,615,458 - 89,934,870 (+) NCBI T2T-CHM13v2.0
Slco3a1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 73,925,166 - 74,204,528 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 73,925,167 - 74,204,528 (-) Ensembl GRCm39 Ensembl GRCm38 7 74,275,418 - 74,554,780 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 74,275,419 - 74,554,780 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 81,420,304 - 81,699,666 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 74,148,931 - 74,428,293 (-) NCBI MGSCv36 mm8 Celera 7 71,722,299 - 72,002,017 (-) NCBI Celera Cytogenetic Map 7 D1 NCBI cM Map 7 42.95 NCBI
Slco3a1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 137,516,037 - 137,797,836 (-) NCBI GRCr8 mRatBN7.2 1 128,106,232 - 128,388,043 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 128,106,228 - 128,387,925 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 136,062,978 - 136,336,526 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 143,233,107 - 143,506,677 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 136,101,551 - 136,374,041 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 135,790,854 - 136,073,640 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 135,790,810 - 136,073,540 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 136,793,300 - 137,070,909 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 129,580,126 - 130,077,110 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 129,658,468 - 130,155,453 (-) NCBI Celera 1 120,235,201 - 120,503,802 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
SLCO3A1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 81,399,080 - 81,720,058 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 85,099,736 - 85,420,671 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 70,537,924 - 70,858,714 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 89,735,202 - 90,055,251 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 89,739,022 - 90,054,678 (+) Ensembl panpan1.1 panPan2
SLCO3A1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 47,927,280 - 48,233,666 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 47,927,664 - 48,233,703 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 50,628,974 - 50,868,877 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 48,346,093 - 48,649,188 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 48,346,095 - 48,649,226 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 47,847,277 - 48,150,531 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 48,078,812 - 48,381,929 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 48,420,025 - 48,723,118 (-) NCBI UU_Cfam_GSD_1.0
Slco3a1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 135,491,779 - 135,786,720 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936483 10,547,687 - 10,778,752 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936483 10,554,049 - 10,778,662 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLCO3A1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 86,777,920 - 87,103,309 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 86,777,919 - 87,103,316 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 92,719,394 - 93,045,275 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLCO3A1
Slco3a1
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCLAT00000018996 ⟹ ENSCLAP00000018811
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955416 20,186,940 - 20,483,958 (+) Ensembl
RefSeq Acc Id:
XM_005381597 ⟹ XP_005381654
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955416 20,186,940 - 20,483,844 (+) NCBI
Sequence:
CAGGCAGGCAGGCAGGCAGGCAGGACGGGGGCGGCCGCGGCGGGCCCGGGGCGGGGACAGCACGCAGCCTCGCGCCGCGCACCCCCGCCCGGCAGCGGCCGCGACACCCGGGGCGAGCGGGAAAGCCG
hide sequence
RefSeq Acc Id:
XP_005381654 ⟸ XM_005381597
- UniProtKB:
A0A8C2VPZ0 (UniProtKB/TrEMBL)
- Sequence:
MQGKKPGGSSSGGRSGELQGDEAQRNKKKKKKVSCFSNIKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGALLSALPEF
hide sequence
Ensembl Acc Id:
ENSCLAP00000018811 ⟸ ENSCLAT00000018996
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-16
Slco3a1
solute carrier organic anion transporter family member 3A1
solute carrier organic anion transporter family, member 3A1
Symbol and/or name change
5135510 APPROVED
