Symbol:
Paics
Name:
phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase
RGD ID:
620066
Description:
Predicted to enable identical protein binding activity; phosphoribosylaminoimidazole carboxylase activity; and phosphoribosylaminoimidazolesuccinocarboxamide synthase activity. Involved in G1/S transition of mitotic cell cycle. Predicted to be located in cytoplasm. Human ortholog(s) of this gene implicated in schizophrenia. Orthologous to human PAICS (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase); PARTICIPATES IN adenine phoshoribosyltransferase deficiency pathway; adenosine monophosphate deaminase deficiency pathway; adenylosuccinate lyase deficiency pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Ade2h1; AIR carboxylase-SAICAR synthetase; Airc; bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase; LOC100910308; MGC93240; multifunctional protein ADE2; multifunctional protein ADE2-like; phosphoribosylaminoimidazole carboxylase; phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase; phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoribosylaminoimidazole succinocarboxamide synthetase; phosphoribosylaminoimidazole carboxylase; phosphoribosylaminoimidazolesuccinocarboxamide synthase; phosphoribosylaminoimidazolesuccinocarboxamide synthase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PAICS (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoribosylaminoimidazole, succinocarboxamide synthetase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Paics (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100993147 (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PAICS (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101961407 (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PAICS (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Paics (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PPP2R5A (protein phosphatase 2 regulatory subunit B'alpha) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoribosylaminoimidazole, succinocarboxamide synthetase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PAICS (phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
paics (phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ADE1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder)
Drosophila melanogaster (fruit fly):
Paics
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pacs-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
paics.1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 31,553,355 - 31,586,843 (-) NCBI GRCr8 mRatBN7.2 14 31,199,086 - 31,232,731 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 31,173,541 - 31,232,635 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 31,576,746 - 31,593,097 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 32,885,078 - 32,901,428 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 31,369,751 - 31,386,102 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 33,563,884 - 33,580,944 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 33,563,886 - 33,580,566 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 33,354,797 - 33,371,784 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 33,492,707 - 33,509,389 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 33,492,708 - 33,509,389 (-) NCBI Celera 14 30,512,320 - 30,529,517 (-) NCBI Celera Cytogenetic Map 14 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Paics Rat (1->4)-beta-D-glucan multiple interactions ISO Paics (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PAICS mRNA CTD PMID:36331819 Paics Rat 1,2-dimethylhydrazine increases expression ISO Paics (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PAICS mRNA CTD PMID:22206623 Paics Rat 1,2-dimethylhydrazine multiple interactions ISO Paics (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of PAICS mRNA] CTD PMID:22206623 Paics Rat 1-chloro-2,4-dinitrobenzene decreases expression ISO PAICS (Homo sapiens) 6480464 Dinitrochlorobenzene results in decreased expression of PAICS mRNA CTD PMID:17374397 Paics Rat 17beta-estradiol increases expression ISO PAICS (Homo sapiens) 6480464 Estradiol results in increased expression of PAICS mRNA CTD PMID:19167446 and PMID:31614463 Paics Rat 17beta-estradiol decreases expression ISO Paics (Mus musculus) 6480464 Estradiol results in decreased expression of PAICS mRNA CTD PMID:39298647 Paics Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PAICS (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PAICS mRNA CTD PMID:19684285 Paics Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Paics (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PAICS mRNA CTD PMID:15328365 and PMID:16960034 Paics Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PAICS mRNA CTD PMID:16960034 Paics Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PAICS mRNA CTD PMID:21346803 Paics Rat 2-butoxyethanol increases expression ISO Paics (Mus musculus) 6480464 n-butoxyethanol results in increased expression of PAICS mRNA CTD PMID:19812364 Paics Rat 2-methylcholine affects expression ISO PAICS (Homo sapiens) 6480464 beta-methylcholine affects the expression of PAICS mRNA CTD PMID:21179406 Paics Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PAICS (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PAICS mRNA CTD PMID:28628672 Paics Rat 4,4'-diaminodiphenylmethane increases expression ISO Paics (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PAICS mRNA CTD PMID:18648102 Paics Rat 4,4'-sulfonyldiphenol increases expression ISO Paics (Mus musculus) 6480464 bisphenol S results in increased expression of PAICS mRNA CTD PMID:39298647 Paics Rat 4,4'-sulfonyldiphenol increases expression ISO PAICS (Homo sapiens) 6480464 bisphenol S results in increased expression of PAICS protein CTD PMID:31945527 and PMID:34186270 Paics Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression ISO PAICS (Homo sapiens) 6480464 Oxazolone results in decreased expression of PAICS mRNA CTD PMID:17374397 Paics Rat 5-fluorouracil increases expression ISO PAICS (Homo sapiens) 6480464 Fluorouracil results in increased expression of PAICS mRNA CTD PMID:19219653 Paics Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of PAICS mRNA CTD PMID:19483382 Paics Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PAICS mRNA CTD PMID:19483382 Paics Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PAICS mRNA CTD PMID:31881176 Paics Rat acrolein multiple interactions ISO PAICS (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PAICS mRNA more ... CTD PMID:32699268 and PMID:32845096 Paics Rat actinomycin D multiple interactions ISO PAICS (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PAICS protein CTD PMID:38460933 Paics Rat all-trans-retinoic acid decreases expression ISO PAICS (Homo sapiens) 6480464 Tretinoin results in decreased expression of PAICS mRNA CTD PMID:16054129 more ... Paics Rat alpha-pinene multiple interactions ISO PAICS (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PAICS mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PAICS mRNA CTD PMID:32699268 Paics Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of PAICS mRNA CTD PMID:19483382 Paics Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PAICS mRNA CTD PMID:16483693 Paics Rat aristolochic acid A decreases expression ISO PAICS (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PAICS mRNA CTD PMID:33212167 Paics Rat Aroclor 1254 decreases expression ISO Paics (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PAICS mRNA CTD PMID:23650126 Paics Rat arsane decreases expression ISO PAICS (Homo sapiens) 6480464 Arsenic results in decreased expression of PAICS protein CTD PMID:19818359 Paics Rat arsenic atom decreases expression ISO PAICS (Homo sapiens) 6480464 Arsenic results in decreased expression of PAICS protein CTD PMID:19818359 Paics Rat arsenite(3-) multiple interactions ISO PAICS (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to PAICS mRNA] CTD PMID:32406909 Paics Rat arsenous acid increases expression ISO PAICS (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PAICS mRNA CTD PMID:20458559 Paics Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of PAICS mRNA CTD PMID:19483382 Paics Rat benzo[a]pyrene decreases expression ISO Paics (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PAICS mRNA CTD PMID:19770486 Paics Rat bis(2-chloroethyl) sulfide decreases expression ISO PAICS (Homo sapiens) 6480464 Mustard Gas results in decreased expression of PAICS mRNA CTD PMID:25102026 Paics Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PAICS mRNA CTD PMID:25181051 Paics Rat bisphenol A decreases expression ISO PAICS (Homo sapiens) 6480464 bisphenol A results in decreased expression of PAICS protein CTD PMID:31675489 and PMID:37567409 Paics Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PAICS mRNA and bisphenol A results in decreased expression of PAICS protein CTD PMID:30816183 more ... Paics Rat bisphenol A affects expression ISO PAICS (Homo sapiens) 6480464 bisphenol A affects the expression of PAICS mRNA CTD PMID:30903817 Paics Rat bisphenol A multiple interactions ISO PAICS (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PAICS mRNA CTD PMID:28628672 Paics Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PAICS gene CTD PMID:28505145 Paics Rat Bisphenol B increases expression ISO PAICS (Homo sapiens) 6480464 bisphenol B results in increased expression of PAICS protein CTD PMID:34186270 Paics Rat bisphenol F increases expression ISO Paics (Mus musculus) 6480464 bisphenol F results in increased expression of PAICS mRNA CTD PMID:38685157 Paics Rat bisphenol F increases expression ISO PAICS (Homo sapiens) 6480464 bisphenol F results in increased expression of PAICS protein CTD PMID:34186270 Paics Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of PAICS promoter CTD PMID:22457795 Paics Rat carbon nanotube decreases expression ISO Paics (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of PAICS mRNA CTD PMID:25620056 Paics Rat chlorpyrifos decreases expression ISO Paics (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PAICS mRNA CTD PMID:37019170 Paics Rat choline multiple interactions ISO Paics (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PAICS mRNA CTD PMID:20938992 Paics Rat chromium(6+) affects expression ISO Paics (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PAICS mRNA CTD PMID:28472532 Paics Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of PAICS mRNA CTD PMID:19483382 Paics Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PAICS mRNA CTD PMID:17602206 Paics Rat cobalt dichloride decreases expression ISO PAICS (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PAICS mRNA CTD PMID:19320972 Paics Rat coumarin increases phosphorylation ISO PAICS (Homo sapiens) 6480464 coumarin results in increased phosphorylation of PAICS protein CTD PMID:35688186 Paics Rat coumestrol multiple interactions ISO PAICS (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Paics Rat coumestrol increases expression ISO PAICS (Homo sapiens) 6480464 Coumestrol results in increased expression of PAICS mRNA CTD PMID:19167446 Paics Rat DDE increases expression ISO PAICS (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of PAICS mRNA CTD PMID:38568856 Paics Rat dexamethasone multiple interactions ISO PAICS (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PAICS mRNA CTD PMID:28628672 Paics Rat diarsenic trioxide increases expression ISO PAICS (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PAICS mRNA CTD PMID:20458559 Paics Rat diazinon increases methylation ISO PAICS (Homo sapiens) 6480464 Diazinon results in increased methylation of PAICS gene CTD PMID:22964155 Paics Rat Dibutyl phosphate affects expression ISO PAICS (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PAICS mRNA CTD PMID:37042841 Paics Rat doxorubicin decreases expression ISO PAICS (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PAICS mRNA CTD PMID:29803840 Paics Rat Enterolactone multiple interactions ISO PAICS (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PAICS mRNA CTD PMID:19167446 Paics Rat enzyme inhibitor multiple interactions ISO PAICS (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PAICS protein CTD PMID:23301498 Paics Rat ethyl methanesulfonate decreases expression ISO PAICS (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of PAICS mRNA CTD PMID:23649840 Paics Rat eugenol decreases expression ISO PAICS (Homo sapiens) 6480464 Eugenol results in decreased expression of PAICS mRNA CTD PMID:17374397 Paics Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PAICS mRNA CTD PMID:24136188 Paics Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PAICS mRNA CTD PMID:24136188 Paics Rat folic acid multiple interactions ISO Paics (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PAICS mRNA more ... CTD PMID:20938992 and PMID:22206623 Paics Rat formaldehyde decreases expression ISO PAICS (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PAICS mRNA CTD PMID:23649840 Paics Rat FR900359 affects phosphorylation ISO PAICS (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PAICS protein CTD PMID:37730182 Paics Rat furan affects binding EXP 6480464 furan binds to PAICS protein CTD PMID:22240984 Paics Rat genistein decreases expression ISO PAICS (Homo sapiens) 6480464 Genistein results in decreased expression of PAICS mRNA CTD PMID:22228119 Paics Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PAICS mRNA CTD PMID:22061828 Paics Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of PAICS mRNA CTD PMID:24136188 Paics Rat hexadecanoic acid increases phosphorylation ISO PAICS (Homo sapiens) 6480464 Palmitic Acid results in increased phosphorylation of PAICS protein CTD PMID:28073184 Paics Rat hydroquinone decreases expression ISO PAICS (Homo sapiens) 6480464 hydroquinone results in decreased expression of PAICS mRNA CTD PMID:31256213 Paics Rat indometacin multiple interactions ISO PAICS (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PAICS mRNA CTD PMID:28628672 Paics Rat ivermectin decreases expression ISO PAICS (Homo sapiens) 6480464 Ivermectin results in decreased expression of PAICS protein CTD PMID:32959892 Paics Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of PAICS mRNA CTD PMID:19483382 Paics Rat L-methionine multiple interactions ISO Paics (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PAICS mRNA CTD PMID:20938992 Paics Rat lead(0) affects expression ISO PAICS (Homo sapiens) 6480464 Lead affects the expression of PAICS mRNA CTD PMID:28903495 Paics Rat manganese atom multiple interactions ISO PAICS (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of PAICS mRNA CTD PMID:39836092 Paics Rat manganese(0) multiple interactions ISO PAICS (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of PAICS mRNA CTD PMID:39836092 Paics Rat manganese(II) chloride multiple interactions ISO PAICS (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of PAICS mRNA CTD PMID:39836092 Paics Rat menadione affects expression ISO PAICS (Homo sapiens) 6480464 Vitamin K 3 affects the expression of PAICS mRNA CTD PMID:20044591 Paics Rat methyl methanesulfonate decreases expression ISO PAICS (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of PAICS mRNA CTD PMID:23649840 Paics Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PAICS mRNA CTD PMID:17602206 Paics Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of PAICS protein CTD PMID:19716841 Paics Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PAICS mRNA CTD PMID:24136188 Paics Rat nickel atom decreases expression ISO PAICS (Homo sapiens) 6480464 Nickel results in decreased expression of PAICS mRNA CTD PMID:23195993 Paics Rat nickel atom increases expression ISO PAICS (Homo sapiens) 6480464 Nickel results in increased expression of PAICS mRNA CTD PMID:25583101 Paics Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PAICS mRNA CTD PMID:24136188 Paics Rat nitrates multiple interactions ISO Paics (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PAICS mRNA CTD PMID:35964746 Paics Rat nitroglycerin increases expression EXP 6480464 Nitroglycerin results in increased expression of PAICS mRNA CTD PMID:12102619 Paics Rat Nutlin-3 multiple interactions ISO PAICS (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PAICS protein CTD PMID:38460933 Paics Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of PAICS mRNA CTD PMID:19483382 Paics Rat oxaliplatin increases expression ISO PAICS (Homo sapiens) 6480464 oxaliplatin results in increased expression of PAICS mRNA CTD PMID:17762391 Paics Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PAICS mRNA CTD PMID:25729387 Paics Rat ozone multiple interactions ISO PAICS (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PAICS mRNA more ... CTD PMID:32699268 and PMID:32845096 Paics Rat paracetamol affects expression ISO Paics (Mus musculus) 6480464 Acetaminophen affects the expression of PAICS mRNA CTD PMID:17562736 Paics Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PAICS mRNA CTD PMID:33387578 Paics Rat pentachlorophenol increases expression ISO Paics (Mus musculus) 6480464 Pentachlorophenol results in increased expression of PAICS mRNA CTD PMID:23892564 Paics Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Paics (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PAICS mRNA CTD PMID:36331819 Paics Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of PAICS mRNA CTD PMID:19483382 Paics Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PAICS mRNA CTD PMID:19162173 Paics Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of PAICS mRNA CTD PMID:19162173 Paics Rat propiconazole decreases expression ISO Paics (Mus musculus) 6480464 propiconazole results in decreased expression of PAICS mRNA CTD PMID:21278054 Paics Rat quinoline increases expression ISO PAICS (Homo sapiens) 6480464 quinoline analog results in increased expression of PAICS protein CTD PMID:18645022 Paics Rat resveratrol multiple interactions ISO PAICS (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of PAICS mRNA CTD PMID:19167446 Paics Rat rotenone decreases expression ISO PAICS (Homo sapiens) 6480464 Rotenone results in decreased expression of PAICS mRNA CTD PMID:33512557 Paics Rat sodium arsenite decreases expression ISO PAICS (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PAICS mRNA CTD PMID:38568856 Paics Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of PAICS protein CTD PMID:35544339 Paics Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of PAICS mRNA CTD PMID:19483382 Paics Rat thiram decreases expression ISO PAICS (Homo sapiens) 6480464 Thiram results in decreased expression of PAICS mRNA CTD PMID:38568856 Paics Rat titanium dioxide increases methylation ISO Paics (Mus musculus) 6480464 titanium dioxide results in increased methylation of PAICS promoter CTD PMID:35295148 Paics Rat titanium dioxide decreases methylation ISO Paics (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PAICS promoter CTD PMID:35295148 Paics Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PAICS mRNA CTD PMID:25729387 Paics Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PAICS mRNA CTD PMID:33387578 Paics Rat trimellitic anhydride increases expression ISO Paics (Mus musculus) 6480464 trimellitic anhydride results in increased expression of PAICS mRNA CTD PMID:19042947 Paics Rat triphenyl phosphate affects expression ISO PAICS (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PAICS mRNA CTD PMID:37042841 Paics Rat triptonide decreases expression ISO Paics (Mus musculus) 6480464 triptonide results in decreased expression of PAICS mRNA CTD PMID:33045310 Paics Rat troglitazone decreases expression ISO PAICS (Homo sapiens) 6480464 troglitazone results in decreased expression of PAICS mRNA CTD PMID:19140230 Paics Rat urethane decreases expression ISO PAICS (Homo sapiens) 6480464 Urethane results in decreased expression of PAICS mRNA CTD PMID:28818685 Paics Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of PAICS mRNA CTD PMID:24136188 Paics Rat valproic acid decreases expression ISO Paics (Mus musculus) 6480464 Valproic Acid results in decreased expression of PAICS mRNA CTD PMID:21427059 Paics Rat zearalenone decreases expression ISO Paics (Mus musculus) 6480464 Zearalenone results in decreased expression of PAICS protein CTD PMID:25058043
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2-butoxyethanol (ISO) 2-methylcholine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 5-fluorouracil (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrolein (ISO) actinomycin D (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amiodarone (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium dichloride (EXP) carbon nanotube (ISO) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) clofibrate (EXP) clofibric acid (EXP) cobalt dichloride (ISO) coumarin (ISO) coumestrol (ISO) DDE (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) doxorubicin (ISO) Enterolactone (ISO) enzyme inhibitor (ISO) ethyl methanesulfonate (ISO) eugenol (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) glafenine (EXP) hexadecanoic acid (ISO) hydroquinone (ISO) indometacin (ISO) ivermectin (ISO) L-ethionine (EXP) L-methionine (ISO) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) methyl methanesulfonate (ISO) N-nitrosodiethylamine (EXP) N-nitrosomorpholine (EXP) nefazodone (EXP) nickel atom (ISO) nimesulide (EXP) nitrates (ISO) nitroglycerin (EXP) Nutlin-3 (ISO) omeprazole (EXP) oxaliplatin (EXP,ISO) ozone (ISO) paracetamol (EXP,ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (ISO) quinoline (ISO) resveratrol (ISO) rotenone (ISO) sodium arsenite (ISO) thapsigargin (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) urethane (ISO) valdecoxib (EXP) valproic acid (ISO) zearalenone (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Nucleotide sequence of a nearly full-length cDNA coding for pepsinogen of rat gastric mucosa.
Ichihara Y, etal., Eur J Biochem 1986 Nov 17;161(1):7-12.
3.
Identification of novel candidate genes for treatment response to risperidone and susceptibility for schizophrenia: integrated analysis among pharmacogenomics, mouse expression, and genetic case-control association approaches.
Ikeda M, etal., Biol Psychiatry. 2010 Feb 1;67(3):263-9. Epub 2009 Oct 22.
4.
Rat genomic structure of amidophosphoribosyltransferase, cDNA sequence of aminoimidazole ribonucleotide carboxylase, and cell cycle-dependent expression of these two physically linked genes.
Iwahana H, etal., Biochim Biophys Acta 1995 Apr 26;1261(3):369-80.
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Comprehensive gene review and curation
RGD comprehensive gene curation
11.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Paics Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 31,553,355 - 31,586,843 (-) NCBI GRCr8 mRatBN7.2 14 31,199,086 - 31,232,731 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 31,173,541 - 31,232,635 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 31,576,746 - 31,593,097 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 32,885,078 - 32,901,428 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 31,369,751 - 31,386,102 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 33,563,884 - 33,580,944 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 33,563,886 - 33,580,566 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 33,354,797 - 33,371,784 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 33,492,707 - 33,509,389 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 33,492,708 - 33,509,389 (-) NCBI Celera 14 30,512,320 - 30,529,517 (-) NCBI Celera Cytogenetic Map 14 p11 NCBI
PAICS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 56,410,507 - 56,464,578 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 56,435,741 - 56,464,578 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 57,276,673 - 57,330,744 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 56,996,672 - 57,022,291 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 57,142,868 - 57,168,453 NCBI Celera 4 54,808,286 - 54,833,908 (+) NCBI Celera Cytogenetic Map 4 q12 NCBI HuRef 4 53,256,050 - 53,281,675 (+) NCBI HuRef CHM1_1 4 57,337,028 - 57,362,670 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 59,898,501 - 59,952,584 (+) NCBI T2T-CHM13v2.0
Paics Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 77,099,149 - 77,115,356 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 77,099,154 - 77,115,356 (+) Ensembl GRCm39 Ensembl GRCm38 5 76,951,302 - 76,967,509 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 76,951,307 - 76,967,509 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 77,380,436 - 77,396,530 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 78,026,186 - 78,042,280 (+) NCBI MGSCv36 mm8 Celera 5 74,219,278 - 74,235,370 (+) NCBI Celera Cytogenetic Map 5 C3.3 NCBI cM Map 5 41.45 NCBI
Paics Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955447 14,558,468 - 14,574,052 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955447 14,558,468 - 14,571,081 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100993147 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 73,318,512 - 73,374,750 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 73,524,030 - 73,578,412 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 67,461,799 - 67,491,300 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 74,031,397 - 74,059,868 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 74,031,397 - 74,059,857 (-) Ensembl panpan1.1 panPan2
PAICS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 48,296,232 - 48,682,650 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 48,502,631 - 48,572,598 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 49,226,506 - 49,296,327 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 49,226,501 - 49,298,373 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 48,898,441 - 48,968,392 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 48,427,408 - 48,497,095 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 49,373,530 - 49,443,304 (+) NCBI UU_Cfam_GSD_1.0
LOC101961407 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 27,633,677 - 27,672,235 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936482 18,626,015 - 18,667,164 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936482 18,649,093 - 18,664,629 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PAICS Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 55,700,956 - 55,722,979 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 55,700,700 - 55,722,982 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 57,827,127 - 57,849,464 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
Paics
.
Predicted Target Of
Count of predictions: 57 Count of miRNA genes: 53 Interacting mature miRNAs: 55 Transcripts: ENSRNOT00000063942 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 731183 Pia20 Pristane induced arthritis QTL 20 3.55 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 9088978 39057237 Rat 10755459 Coatc15 Coat color QTL 15 0.01681 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 14 19836944 64836944 Rat 1300154 Bp189 Blood pressure QTL 189 3.04 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 14 30883777 68757901 Rat 619619 Rf4 Renal disease susceptibility QTL 4 4.1 0.002 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 14 1 32754612 Rat 70187 Pancm5 Pancreatic morphology QTL 5 16.7 pancreas mass (VT:0010144) pancreas weight to body weight ratio (CMO:0000630) 14 30320092 80829842 Rat 2324617 Coatc2 Coat color QTL 2 0.001 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 14 30767025 39153750 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 71117 Niddm17 Non-insulin dependent diabetes mellitus QTL 17 2.35 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 14 17593761 42336881 Rat 61420 Pia6 Pristane induced arthritis QTL 6 4.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 14 18631345 42337007 Rat 7387267 Uae42 Urinary albumin excretion QTL 42 0.61 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 14 22167967 67167967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 2313397 Coatc1 Coat color QTL1 coat/hair pigmentation trait (VT:0010463) coat/hair color measurement (CMO:0001808) 14 18541332 63541332 Rat 631262 Tcas4 Tongue tumor susceptibility QTL 4 7.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 14 17622561 42337007 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat
RH127888
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 31,199,203 - 31,199,390 (+) MAPPER mRatBN7.2 Rnor_6.0 14 33,564,002 - 33,564,188 NCBI Rnor6.0 Rnor_6.0 14 33,968,284 - 33,968,470 NCBI Rnor6.0 Rnor_5.0 14 33,354,915 - 33,355,101 UniSTS Rnor5.0 Rnor_5.0 14 33,752,801 - 33,752,987 UniSTS Rnor5.0 RGSC_v3.4 14 33,492,825 - 33,493,011 UniSTS RGSC3.4 Celera 14 30,512,438 - 30,512,624 UniSTS Cytogenetic Map 14 p11 UniSTS
RH129425
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 31,199,203 - 31,199,360 (+) MAPPER mRatBN7.2 Rnor_6.0 14 33,564,002 - 33,564,158 NCBI Rnor6.0 Rnor_6.0 14 33,968,284 - 33,968,440 NCBI Rnor6.0 Rnor_5.0 14 33,752,801 - 33,752,957 UniSTS Rnor5.0 Rnor_5.0 14 33,354,915 - 33,355,071 UniSTS Rnor5.0 RGSC_v3.4 14 33,492,825 - 33,492,981 UniSTS RGSC3.4 Celera 14 30,512,438 - 30,512,594 UniSTS RH 3.4 Map 14 427.39 UniSTS Cytogenetic Map 14 p11 UniSTS
RH143742
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 14 33,360,622 - 33,360,963 NCBI Rnor5.0 Rnor_5.0 14 33,758,508 - 33,758,849 NCBI Rnor5.0 Rnor_5.0 X 5,076,828 - 5,076,944 NCBI Rnor5.0 RGSC_v3.4 X 15,625,492 - 15,625,607 UniSTS RGSC3.4 RGSC_v3.4 14 33,498,533 - 33,498,873 UniSTS RGSC3.4 Celera X 4,574,774 - 4,574,889 UniSTS Celera 14 30,517,945 - 30,518,285 UniSTS RH 3.4 Map 14 423.4 UniSTS Cytogenetic Map 14 p11 UniSTS
RH140904
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 31,199,115 - 31,199,335 (+) MAPPER mRatBN7.2 Rnor_6.0 14 33,968,196 - 33,968,415 NCBI Rnor6.0 Rnor_6.0 14 33,563,914 - 33,564,133 NCBI Rnor6.0 Rnor_5.0 14 33,752,713 - 33,752,932 UniSTS Rnor5.0 Rnor_5.0 14 33,354,827 - 33,355,046 UniSTS Rnor5.0 RGSC_v3.4 14 33,492,737 - 33,492,956 UniSTS RGSC3.4 Celera 14 30,512,350 - 30,512,569 UniSTS RH 3.4 Map 14 428.59 UniSTS Cytogenetic Map 14 p11 UniSTS
PMC312758P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 31,216,183 - 31,216,360 (+) MAPPER mRatBN7.2 Rnor_6.0 14 33,580,984 - 33,581,160 NCBI Rnor6.0 Rnor_5.0 14 33,371,897 - 33,372,073 UniSTS Rnor5.0 RGSC_v3.4 14 33,509,807 - 33,509,983 UniSTS RGSC3.4 Celera 14 30,529,935 - 30,530,111 UniSTS Cytogenetic Map 14 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002890 ⟹ ENSRNOP00000002890
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 31,173,541 - 31,232,635 (-) Ensembl Rnor_6.0 Ensembl 14 33,968,759 - 33,977,277 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000063942 ⟹ ENSRNOP00000061495
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 31,199,086 - 31,216,112 (-) Ensembl Rnor_6.0 Ensembl 14 33,563,886 - 33,580,566 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096789 ⟹ ENSRNOP00000089961
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 31,173,541 - 31,232,635 (-) Ensembl
RefSeq Acc Id:
NM_080910 ⟹ NP_543186
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 31,553,355 - 31,570,035 (-) NCBI mRatBN7.2 14 31,199,086 - 31,215,766 (-) NCBI Rnor_6.0 14 33,563,884 - 33,580,566 (-) NCBI Rnor_5.0 14 33,354,797 - 33,371,784 (-) NCBI RGSC_v3.4 14 33,492,707 - 33,509,389 (-) RGD Celera 14 30,512,320 - 30,529,517 (-) RGD
Sequence:
CGGTTCCTGCCCTGAGCAGCCAGCCGAGTGCTTTGGGTTCGCTGATCGCTGCTTCTTTTTCCCGCGCGGTCTGCTCCTCTAGTTCACCTAGGATAATGGCGACAGCTGAAGTACTGAACATCGGGAGA
hide sequence
RefSeq Acc Id:
XM_006250852 ⟹ XP_006250914
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 31,553,447 - 31,570,386 (-) NCBI mRatBN7.2 14 31,199,178 - 31,216,117 (-) NCBI Rnor_6.0 14 33,564,416 - 33,580,893 (-) NCBI Rnor_5.0 14 33,354,797 - 33,371,784 (-) NCBI
Sequence:
CAAGGGACTGGGGTTAATTCTCCGCGGCAGAGGTCAGGATCGCTGCTTTTCCCTGCACGTGGGAGACTCCGTTATTTTCCCGCTCCCAAGGCATCGCTGCTTCTTTTTCCCGCGCGGTCTGCTCCTCT
hide sequence
RefSeq Acc Id:
XM_006250853 ⟹ XP_006250915
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 31,553,447 - 31,570,469 (-) NCBI mRatBN7.2 14 31,199,178 - 31,216,196 (-) NCBI Rnor_6.0 14 33,563,976 - 33,580,944 (-) NCBI Rnor_5.0 14 33,354,797 - 33,371,784 (-) NCBI
Sequence:
CAGCTCCGGGCCAATCAGCTAGGACACGGGACGGGGGCGGAGCTATGGAGTCAAGGGACTGGGGTTAATTCTCCGCGGCAGAGATCGCTGCTTCTTTTTCCCGCGCGGTCTGCTCCTCTAGTTCACCT
hide sequence
RefSeq Acc Id:
XM_006250854 ⟹ XP_006250916
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 31,553,447 - 31,570,387 (-) NCBI mRatBN7.2 14 31,199,178 - 31,216,118 (-) NCBI Rnor_6.0 14 33,563,976 - 33,580,890 (-) NCBI Rnor_5.0 14 33,354,797 - 33,371,784 (-) NCBI
Sequence:
GGGACTGGGGTTAATTCTCCGCGGCAGAGGTCAGGATCGCTGCTTTTCCCTGCACGTGGGAGACTCCGTTATTTTCCCGCTCCCAAGGCGTAGATCGCTGCTTCTTTTTCCCGCGCGGTCTGCTCCTC
hide sequence
RefSeq Acc Id:
XM_063272816 ⟹ XP_063128886
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 31,553,447 - 31,586,843 (-) NCBI
RefSeq Acc Id:
NP_543186 ⟸ NM_080910
- UniProtKB:
P51583 (UniProtKB/Swiss-Prot), A6JCW8 (UniProtKB/TrEMBL), A6JCW6 (UniProtKB/TrEMBL)
- Sequence:
MATAEVLNIGRKLYEGKTKEVYELLDSPGRVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYRFYPPKVEM
hide sequence
RefSeq Acc Id:
XP_006250915 ⟸ XM_006250853
- Peptide Label:
isoform X2
- Sequence:
MATAEVLNIGRKLYEGKTKEVYELLDSPGRVLLQSKDQITAGNAARKNHLEGKAAISNKITSCI
hide sequence
RefSeq Acc Id:
XP_006250914 ⟸ XM_006250852
- Peptide Label:
isoform X2
- Sequence:
MATAEVLNIGRKLYEGKTKEVYELLDSPGRVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYRFYPPKVEM
hide sequence
RefSeq Acc Id:
XP_006250916 ⟸ XM_006250854
- Peptide Label:
isoform X2
- UniProtKB:
P51583 (UniProtKB/Swiss-Prot), A6JCW8 (UniProtKB/TrEMBL), A6JCW6 (UniProtKB/TrEMBL)
- Sequence:
MATAEVLNIGRKLYEGKTKEVYELLDSPGRVLLQSKDQITAGNAARKNHLEGKAAISNKITSCI
hide sequence
Ensembl Acc Id:
ENSRNOP00000061495 ⟸ ENSRNOT00000063942
Ensembl Acc Id:
ENSRNOP00000002890 ⟸ ENSRNOT00000002890
Ensembl Acc Id:
ENSRNOP00000089961 ⟸ ENSRNOT00000096789
RefSeq Acc Id:
XP_063128886 ⟸ XM_063272816
- Peptide Label:
isoform X1
RGD ID: 13699270 Promoter ID: EPDNEW_R9795 Type: initiation region Name: Paics_1 Description: phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamidesynthase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R9797 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 33,580,399 - 33,580,459 EPDNEW
RGD ID: 13699272 Promoter ID: EPDNEW_R9797 Type: initiation region Name: Paics_2 Description: phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamidesynthase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R9795 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 33,580,598 - 33,580,658 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Paics
phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase
LOC100910308
multifunctional protein ADE2-like
Data merged from RGD:6499293
737654 PROVISIONAL
2017-01-03
Paics
phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase
Paics
phosphoribosylaminoimidazole carboxylase; phosphoribosylaminoimidazolesuccinocarboxamide synthase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-11-30
Paics
phosphoribosylaminoimidazole carboxylase; phosphoribosylaminoimidazolesuccinocarboxamide synthase
Paics
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-05
LOC100910308
multifunctional protein ADE2-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-11-30
Paics
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Paics
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoribosylaminoimidazole succinocarboxamide synthetase
Name updated
1299863 APPROVED
Note Type
Note
Reference
gene_expression
induced in G1/S phase of the cell cycle
633691
