Ak3 (adenylate kinase 3) - Rat Genome Database

Name: Ak3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Ak3 (adenylate kinase 3) Rattus norvegicus

Analyze

Symbol:

Ak3

Name:

adenylate kinase 3

RGD ID:

619885

Description:

Enables adenylate kinase activity and identical protein binding activity. Involved in several processes, including brain development; liver development; and purine nucleotide metabolic process. Located in mitochondrial matrix. Orthologous to human AK3 (adenylate kinase 3); PARTICIPATES IN beta-ureidopropionase deficiency pathway; dihydropyrimidinase deficiency pathway; mitochondrial neurogastrointestinal encephalopathy syndrome pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

adenylate kinase 3 alpha-like 1; AK 3; GTP:AMP phosphotransferase AK3, mitochondrial; GTP:AMP phosphotransferase mitochondrial; GTP:AMP phosphotransferase, mitochondrial

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AK3 (adenylate kinase 3)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Ak3 (adenylate kinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ak3 (adenylate kinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AK3 (adenylate kinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LOC480491 (GTP:AMP phosphotransferase AK3, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ak3 (adenylate kinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AK3 (adenylate kinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AK3 (adenylate kinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ak3 (adenylate kinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	AK3 (adenylate kinase 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ak3 (adenylate kinase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ak3 (adenylate kinase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ADK2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Adk3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZK673.2	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	ak3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	236,151,012 - 236,178,689 (-)	NCBI		GRCr8
mRatBN7.2	1	226,737,472 - 226,764,647 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	226,739,318 - 226,764,625 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	235,141,055 - 235,168,255 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	242,070,711 - 242,097,905 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	234,895,974 - 234,923,033 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	247,144,486 - 247,169,690 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	247,144,491 - 247,169,693 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	254,383,079 - 254,408,283 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	232,658,879 - 232,684,083 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	232,822,906 - 232,848,106 (-)	NCBI
Celera	1	223,892,190 - 223,917,394 (-)	NCBI		Celera
Cytogenetic Map	1	q52	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 9p deletion syndrome (ISO)

chronic lymphocytic leukemia (ISO)

hepatocellular carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2,4,6-trinitrotoluene (EXP)

2-methylcholine (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

acrolein (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

astemizole (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroacetaldehyde (ISO)

chlorpromazine (EXP)

cidofovir anhydrous (ISO)

cisplatin (ISO)

clobetasol (ISO)

clodronic acid (ISO)

clofibrate (ISO)

cobalt atom (ISO)

cobalt dichloride (ISO)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

diethylstilbestrol (ISO)

dioxygen (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

ethanol (EXP,ISO)

ethyl methanesulfonate (ISO)

fenvalerate (EXP)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

glafenine (EXP)

glyphosate (ISO)

gold atom (ISO)

gold(0) (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

ivermectin (ISO)

lead(0) (ISO)

metformin (EXP)

methapyrilene (EXP)

nefazodone (EXP)

nickel dichloride (ISO)

nicotine (ISO)

ozone (ISO)

p-toluidine (EXP)

paracetamol (ISO)

paraquat (EXP)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

procymidone (EXP)

propiconazole (ISO)

quercetin (EXP)

raloxifene (EXP)

sarin (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sodium fluoride (ISO)

sunitinib (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

tetracycline (ISO)

thapsigargin (ISO)

triphenyl phosphate (EXP,ISO)

troglitazone (ISO)

Tungsten carbide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

vitamin E (ISO)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ADP biosynthetic process (IDA,IEA)

AMP metabolic process (IBA,IEA,ISO)

AMP phosphorylation (IDA)

cerebellum development (IEP)

dATP metabolic process (IDA)

GTP metabolic process (IEA,ISO)

ITP metabolic process (IEA,ISO)

liver development (IEP)

muscle organ development (IEP)

nucleoside monophosphate phosphorylation (IEA)

nucleoside triphosphate biosynthetic process (IBA)

olfactory bulb development (IEP)

phosphorylation (IEA)

response to starvation (IEP)

UTP metabolic process (IEA,ISO)

Cellular Component

cytoplasm (IBA)

mitochondrial matrix (IBA,IDA,IEA,ISO)

mitochondrion (ISO,ISS)

Molecular Function

adenylate kinase activity (IBA,IDA,IEA,ISO)

ATP binding (IEA)

GTP binding (IEA)

identical protein binding (IDA,IPI)

nucleoside diphosphate kinase activity (IEA)

nucleoside triphosphate adenylate kinase activity (IBA,IEA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

beta-ureidopropionase deficiency pathway (ISO)

de novo purine biosynthetic pathway (TAS)

dihydropyrimidinase deficiency pathway (ISO)

mitochondrial neurogastrointestinal encephalopathy syndrome pathway (ISO)

orotic aciduria 1 pathway (ISO)

pyrimidine metabolic pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Novel Biomarker Proteins in Chronic Lymphocytic Leukemia: Impact on Diagnosis, Prognosis and Treatment.	Admoni-Elisha L, etal., PLoS One. 2016 Apr 14;11(4):e0148500. doi: 10.1371/journal.pone.0148500. eCollection 2016.
2.	Rat liver adenosine triphosphate: adenosine monophosphate phosphotransferase activity. I. Purification and physical and kinetic characterization of adenylate kinase 3.	Criss WE, etal., J Biol Chem. 1970 Dec 10;245(23):6346-51.
3.	Combined cDNA array/RT-PCR analysis of gene expression profile in rat gastrocnemius muscle: relation to its adaptive function in energy metabolism during fasting.	de Lange P, etal., FASEB J. 2004 Feb;18(2):350-2. Epub 2003 Dec 4.
4.	Development of adenylate kinase isoenzymes in rat liver.	Filler R and Criss WE, Biochem J. 1971 May;122(4):553-5.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Distribution and developmental changes of adenylate kinase isozymes in the rat brain: localization of adenylate kinase 1 in the olfactory bulb.	Inouye S, etal., Biochem Biophys Res Commun 1999 Jan 27;254(3):618-22.
7.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
8.	Identification of specific protein markers in microdissected hepatocellular carcinoma.	Melle C, etal., J Proteome Res. 2007 Jan;6(1):306-15. doi: 10.1021/pr060439b.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	Mechanism of mitochondrial import of adenylate kinase isozymes.	Nobumoto M, etal., J Biochem. 1998 Jan;123(1):128-35.
12.	Dynamics of nucleotide metabolism as a supporter of life phenomena.	Noma T J Med Invest. 2005 Aug;52(3-4):127-36.
13.	Structure and expression of human mitochondrial adenylate kinase targeted to the mitochondrial matrix.	Noma T, etal., Biochem J 2001 Aug 15;358(Pt 1):225-32.
14.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
15.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
16.	GOA pipeline	RGD automated data pipeline
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	Purification of rat liver adenylate kinase isozyme II and comparison with isozyme 3.	Sapico V, etal., Biochim Biophys Acta. 1972 Feb 28;258(2):436-45.
19.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
20.	Tissue-specific and developmentally regulated expression of the genes encoding adenylate kinase isozymes.	Tanabe T, etal., J Biochem. 1993 Feb;113(2):200-7.

Additional References at PubMed

PMID:218813	PMID:14651853	PMID:18614015

Genomics

Comparative Map Data

Ak3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	236,151,012 - 236,178,689 (-)	NCBI		GRCr8
mRatBN7.2	1	226,737,472 - 226,764,647 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	226,739,318 - 226,764,625 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	235,141,055 - 235,168,255 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	242,070,711 - 242,097,905 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	234,895,974 - 234,923,033 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	247,144,486 - 247,169,690 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	247,144,491 - 247,169,693 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	254,383,079 - 254,408,283 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	232,658,879 - 232,684,083 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	232,822,906 - 232,848,106 (-)	NCBI
Celera	1	223,892,190 - 223,917,394 (-)	NCBI		Celera
Cytogenetic Map	1	q52	NCBI

AK3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	4,709,556 - 4,742,043 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	4,709,556 - 4,742,043 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	4,709,556 - 4,742,043 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	4,701,158 - 4,731,227 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	4,701,157 - 4,731,227	NCBI
Celera	9	4,633,666 - 4,666,796 (-)	NCBI		Celera
Cytogenetic Map	9	p24.1	NCBI
HuRef	9	4,664,901 - 4,697,611 (-)	NCBI		HuRef
CHM1_1	9	4,709,623 - 4,742,326 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	4,713,232 - 4,747,171 (-)	NCBI		T2T-CHM13v2.0

Ak3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	28,968,715 - 29,026,122 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	28,998,233 - 29,025,361 (-)	Ensembl		GRCm39 Ensembl
GRCm38	19	28,995,053 - 29,048,080 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	29,020,833 - 29,047,961 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	29,095,322 - 29,122,392 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	29,086,829 - 29,113,899 (-)	NCBI		MGSCv36	mm8
Celera	19	29,796,177 - 29,823,247 (-)	NCBI		Celera
Cytogenetic Map	19	C1	NCBI
cM Map	19	23.61	NCBI

Ak3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955434	9,000,158 - 9,011,250 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955434	8,998,357 - 9,010,468 (-)	NCBI	ChiLan1.0	ChiLan1.0

AK3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	119,815,241 - 119,882,802 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	119,821,189 - 119,854,215 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	4,541,984 - 4,576,341 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	4,731,024 - 4,744,093 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	4,732,847 - 4,762,900 (-)	Ensembl	panpan1.1		panPan2

LOC480491
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	10,282,452 - 10,283,479 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	10,012,102 - 10,013,357 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	10,553,806 - 10,556,217 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	9	10,883,676 - 10,884,902 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	16,637,073 - 16,638,328 (-)	NCBI		UNSW_CanFamBas_1.0

Ak3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	140,655,993 - 140,675,527 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936503	496,965 - 516,888 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936503	497,391 - 517,011 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AK3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	217,236,482 - 217,261,367 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	217,236,561 - 217,263,144 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	243,072,971 - 243,096,935 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AK3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	74,801,673 - 74,832,838 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	74,801,671 - 74,835,475 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	63,130,542 - 63,161,692 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ak3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624736	9,428,736 - 9,494,645 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ak3
145 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	35
Count of miRNA genes:	33
Interacting mature miRNAs:	34
Transcripts:	ENSRNOT00000020744
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
61455	Niddm7	Non-insulin dependent diabetes mellitus QTL 7	5.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	214537555	238757011	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	206081677	251081677	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	225126575	260522016	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	221264111	259647894	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	213707201	252085212	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
734768	Niddm59	Non-insulin dependent diabetes mellitus QTL 59			body mass (VT:0001259)	body weight (CMO:0000012)	1	213843987	258843987	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	218753816	256448513	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	214647894	259647894	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	214647894	259647894	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
1357399	Bw45	Body weight QTL 45	3.05		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	1	206329708	251329708	Rat
1357404	Bw42	Body weight QTL 42	4.49	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	206329708	251329708	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	210702053	240947965	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	218753689	245907899	Rat
2292216	Bw80	Body weight QTL 80	3.23	0.0019	body mass (VT:0001259)	body weight (CMO:0000012)	1	213533809	243914901	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
1300168	Bp170	Blood pressure QTL 170	2.76		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	207702246	228581766	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	224054293	243747962	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	224054293	243747962	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
6480786	Bw97	Body weight QTL 97	5.03		body mass (VT:0001259)	body weight (CMO:0000012)	1	225126575	227604520	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	203995416	244113296	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	218748008	257976495	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat

Markers in Region

RH130555

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	226,765,532 - 226,765,740 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	247,170,655 - 247,170,862	NCBI	Rnor6.0
Rnor_5.0	1	254,409,248 - 254,409,455	UniSTS	Rnor5.0
RGSC_v3.4	1	232,685,048 - 232,685,255	UniSTS	RGSC3.4
Celera	1	223,918,359 - 223,918,566	UniSTS
RH 3.4 Map	1	1614.5	UniSTS
Cytogenetic Map	1	q52	UniSTS

BF390010

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	226,745,021 - 226,745,162 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	247,150,147 - 247,150,287	NCBI	Rnor6.0
Rnor_5.0	1	254,388,740 - 254,388,880	UniSTS	Rnor5.0
RGSC_v3.4	1	232,664,540 - 232,664,680	UniSTS	RGSC3.4
Celera	1	223,897,851 - 223,897,991	UniSTS
RH 3.4 Map	1	1650.5	UniSTS
Cytogenetic Map	1	q52	UniSTS

RH140143

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	226,739,381 - 226,739,578 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	247,144,507 - 247,144,703	NCBI	Rnor6.0
Rnor_5.0	1	254,383,100 - 254,383,296	UniSTS	Rnor5.0
RGSC_v3.4	1	232,658,900 - 232,659,096	UniSTS	RGSC3.4
Celera	1	223,892,211 - 223,892,407	UniSTS
RH 3.4 Map	19	516.2	UniSTS
Cytogenetic Map	1	q52	UniSTS

AI236739

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	226,747,183 - 226,747,382 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	247,152,309 - 247,152,507	NCBI	Rnor6.0
Rnor_5.0	1	254,390,902 - 254,391,100	UniSTS	Rnor5.0
RGSC_v3.4	1	232,666,702 - 232,666,900	UniSTS	RGSC3.4
Celera	1	223,900,013 - 223,900,211	UniSTS
RH 3.4 Map	1	1614.5	UniSTS
Cytogenetic Map	1	q52	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

appendage

High

Medium

141

227

147

250

115

129

Low

Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013218	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282585	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128425	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC064656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D13062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000079875 ⟹ ENSRNOP00000070076

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	226,739,319 - 226,764,625 (-)	Ensembl
Rnor_6.0 Ensembl	1	247,144,491 - 247,169,693 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114897 ⟹ ENSRNOP00000082113

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	226,739,318 - 226,764,596 (-)	Ensembl

RefSeq Acc Id:

NM_013218 ⟹ NP_037350

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	236,151,012 - 236,178,183 (-)	NCBI
mRatBN7.2	1	226,737,472 - 226,764,647 (-)	NCBI
Rnor_6.0	1	247,144,486 - 247,169,690 (-)	NCBI
Rnor_5.0	1	254,383,079 - 254,408,283 (-)	NCBI
RGSC_v3.4	1	232,658,879 - 232,684,083 (-)	RGD
Celera	1	223,892,190 - 223,917,394 (-)	RGD

Sequence:

show sequence

GGCCAGGCCAGGCCGCAGTTCAGCGTCTGCGCACGTTCGGCCACCGTTGCCACCATGGGGGCAT
CGGGGCGGCTGCTGCGCGCCGTGATCATGGGGGCCCCGGGCTCCGGTAAGGGCACTGGGTCGTC
ACGCATCACCAAACACTTCGAGCTGAAGCACCTCTCCAGCGGGGACCTGCTCCGCCAGAACATG
CTGCAGGGCACAGAAATCGCTGTGTTGGCCAAGAGCTTCATTGACCAAGGAAAGCTCATCCCGG
ATGATGACATGACTCGGCTGGCCCTCCATGAGCTGAAAAACCTTACCCAGTGTAGCTGGCTGTT
GGACGGATTTCCAAGGACACTTCCACAGGCAGAAGCCCTGGATAGAGTTTATCAGATAGACACA
GTGATAAATCTCAACGTGCCCTTTGAGGTCATTAAACTACGCCTTACTGCTCGCTGGATTCATC
CTGCCAGTGGCCGAGTTTACAACATTGAATTCAACCCTCCCAAGACTGTGGGCATCGATGACCT
AACGGGAGAACCTCTGATTCAGCGTGAGGACGACAAACCAGAGACGGTGATCAAGAGATTGAAA
GCGTATGAAGCCCAGACAGAGCCGGTCCTGCAGTATTACCAGAAAAAAGGGGTGTTGGAAACAT
TCTCCGGAACAGAAACCAACAAGATCAGGCCCCACGTATACTCCTTCCTGCAAATGAAAGTTCC
AGAAACCATCCAAAAAGCCTCTGTTACTCCCTGAGGAAGGCACTTGGCGGGATGAAGCAGGGCC
TCCTCCACTCCTCCCCTCGCCTCTGTATTTCGAAGCTGTTTTCCTAAGACTTCTCTGAAAATTA
TGATTTAAGTCCTAATGGCCTTGCCTAATGAGTCAGAAACTAAGGCTGACCGTGTGTTTATGTA
SGTTGTCCTTCCATGGATGTGCAATTGAAAACGTCAGACATGTTGAAACAAACAAACTCAGAGC
ACAATTAAGAGAGCAACTGGTGGGGTTGGGGATTTAGCTCAGTGGTAGAGCGCTTGCCTAGGAA
GTACAAGGCCCTGGGTTCGGTCCCCAGCTCCGAAAAA

hide sequence

RefSeq Acc Id:

XM_063282585 ⟹ XP_063138655

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	236,172,690 - 236,178,689 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_037350	(Get FASTA)	NCBI Sequence Viewer
	XP_063138655	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH64656	(Get FASTA)	NCBI Sequence Viewer
	BAA02379	(Get FASTA)	NCBI Sequence Viewer
	EDM13083	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000070076.2
	ENSRNOP00000082113.1
GenBank Protein	P29411	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037350 ⟸ NM_013218

- UniProtKB:

P29411 (UniProtKB/Swiss-Prot), Q6P2A5 (UniProtKB/TrEMBL), A0A8I6G902 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGASGRLLRAVIMGAPGSGKGTGSSRITKHFELKHLSSGDLLRQNMLQGTEIAVLAKSFIDQGK
LIPDDDMTRLALHELKNLTQCSWLLDGFPRTLPQAEALDRVYQIDTVINLNVPFEVIKLRLTAR
WIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQTEPVLQYYQKKGV
LETFSGTETNKIRPHVYSFLQMKVPETIQKASVTP

hide sequence

Ensembl Acc Id:

ENSRNOP00000070076 ⟸ ENSRNOT00000079875

Ensembl Acc Id:

ENSRNOP00000082113 ⟸ ENSRNOT00000114897

RefSeq Acc Id:	XP_063138655 ⟸ XM_063282585
- Peptide Label:	isoform X1

Protein Domains

Adenylate kinase active site lid

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P29411-F1-model_v2	AlphaFold	P29411	1-227	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690843

Promoter ID:

EPDNEW_R1367

Type:

initiation region

Name:

Ak3_1

Description:

adenylate kinase 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	247,169,705 - 247,169,765	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619885	AgrOrtholog
BioCyc Gene	G2FUF-55982	BioCyc
Ensembl Genes	ENSRNOG00000052506	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000079875.2	UniProtKB/TrEMBL
	ENSRNOT00000114897.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5621289	IMAGE-MGC_LOAD
InterPro	Adenyl_kin_sub	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Adenylat/UMP-CMP_kin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Adenylat_kinase_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Adenylate_kinase_lid-dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ADK_active_lid_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AK3/Ak4_mitochondrial	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:26956	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72552	IMAGE-MGC_LOAD
NCBI Gene	26956	ENTREZGENE
PANTHER	GTP:AMP PHOSPHOTRANSFERASE AK3, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR23359	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ADK	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ADK_lid	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ak3	PhenoGen
PRINTS	ADENYLTKNASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ADENYLATE_KINASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000052506	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF57774	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JWZ7_RAT	UniProtKB/TrEMBL
	A0A8I6G902	ENTREZGENE, UniProtKB/TrEMBL
	KAD3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6P2A5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Ak3	adenylate kinase 3			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Ak3	adenylate kinase 3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)