Symbol:
Psmb6
Name:
proteasome 20S subunit beta 6
RGD ID:
61881
Description:
Predicted to enable endopeptidase activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process. Predicted to be located in mitochondrion and nucleoplasm. Predicted to be part of proteasome core complex, beta-subunit complex. Predicted to be active in cytosol and nucleus. Orthologous to human PSMB6 (proteasome 20S subunit beta 6); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
beta-1; macropain delta chain; multicatalytic endopeptidase complex delta chain; proteasome (prosome, macropain) subunit, beta type 6; proteasome beta 6 subunit; proteasome chain 5; proteasome delta chain; proteasome subunit beta 6; proteasome subunit beta type 6-like; proteasome subunit beta type-6; proteasome subunit beta-1; proteasome subunit Y; Psmb6l
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 55,737,852 - 55,740,218 (+) NCBI GRCr8 mRatBN7.2 10 55,239,256 - 55,241,586 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 55,239,241 - 55,241,586 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 59,919,232 - 59,921,558 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 59,407,737 - 59,410,063 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 54,906,829 - 54,909,155 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 57,131,339 - 57,133,685 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 57,131,386 - 57,133,637 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 56,888,972 - 56,891,279 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 57,370,397 - 57,372,704 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 57,384,019 - 57,386,327 (+) NCBI Celera 10 54,385,536 - 54,387,843 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Psmb6 Rat (1->4)-beta-D-glucan multiple interactions ISO Psmb6 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMB6 mRNA CTD PMID:36331819 Psmb6 Rat (S)-nicotine decreases expression ISO PSMB6 (Homo sapiens) 6480464 Nicotine results in decreased expression of PSMB6 mRNA CTD PMID:18247414 Psmb6 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of PSMB6 protein CTD PMID:17337753 Psmb6 Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of PSMB6 mRNA CTD PMID:24140754 Psmb6 Rat 17beta-estradiol affects expression ISO Psmb6 (Mus musculus) 6480464 Estradiol affects the expression of PSMB6 mRNA CTD PMID:15598610 Psmb6 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO Psmb6 (Mus musculus) 6480464 2 more ... CTD PMID:25639565 Psmb6 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Psmb6 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Psmb6 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Psmb6 (Mus musculus) 6480464 troxerutin inhibits the reaction [2 more ... CTD PMID:25639565 Psmb6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Psmb6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PSMB6 mRNA CTD PMID:21570461 Psmb6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PSMB6 mRNA CTD PMID:33387578 Psmb6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PSMB6 mRNA CTD PMID:32109520 Psmb6 Rat 2-hydroxypropanoic acid decreases expression ISO PSMB6 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PSMB6 mRNA CTD PMID:30851411 Psmb6 Rat 2-naphthylamine decreases expression ISO PSMB6 (Homo sapiens) 6480464 2-Naphthylamine results in decreased expression of PSMB6 mRNA CTD PMID:18247414 Psmb6 Rat 3-methylcholanthrene increases expression ISO Psmb6 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of PSMB6 protein CTD PMID:16723119 Psmb6 Rat 3H-1,2-dithiole-3-thione increases expression ISO Psmb6 (Mus musculus) 6480464 1 and 2-dithiol-3-thione results in increased expression of PSMB6 mRNA CTD PMID:15375163 and PMID:22959925 Psmb6 Rat 4,4'-sulfonyldiphenol increases expression ISO Psmb6 (Mus musculus) 6480464 bisphenol S results in increased expression of PSMB6 mRNA CTD PMID:39298647 Psmb6 Rat 4,4'-sulfonyldiphenol increases expression ISO PSMB6 (Homo sapiens) 6480464 bisphenol S results in increased expression of PSMB6 protein CTD PMID:34186270 Psmb6 Rat aflatoxin B1 increases expression ISO PSMB6 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PSMB6 mRNA CTD PMID:27153756 Psmb6 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PSMB6 mRNA CTD PMID:16483693 Psmb6 Rat aristolochic acid A increases expression ISO PSMB6 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PSMB6 protein CTD PMID:33212167 Psmb6 Rat arsane affects methylation ISO PSMB6 (Homo sapiens) 6480464 Arsenic affects the methylation of PSMB6 gene CTD PMID:25304211 Psmb6 Rat arsane multiple interactions ISO PSMB6 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PSMB6 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PSMB6 mRNA CTD PMID:35809665 and PMID:39836092 Psmb6 Rat arsenic atom affects methylation ISO PSMB6 (Homo sapiens) 6480464 Arsenic affects the methylation of PSMB6 gene CTD PMID:25304211 Psmb6 Rat arsenic atom multiple interactions ISO PSMB6 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PSMB6 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PSMB6 mRNA CTD PMID:35809665 and PMID:39836092 Psmb6 Rat arsenic trichloride multiple interactions ISO PSMB6 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PSMB6 mRNA CTD PMID:35809665 Psmb6 Rat arsenite(3-) multiple interactions ISO PSMB6 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to PSMB6 mRNA] CTD PMID:32406909 Psmb6 Rat arsenous acid multiple interactions ISO PSMB6 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PSMB6 protein] CTD PMID:26598702 Psmb6 Rat arsenous acid increases expression ISO PSMB6 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PSMB6 mRNA CTD PMID:12852829 and PMID:29633893 Psmb6 Rat benzo[a]pyrene decreases expression ISO PSMB6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PSMB6 mRNA CTD PMID:18247414 Psmb6 Rat benzo[a]pyrene increases expression ISO Psmb6 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PSMB6 mRNA CTD PMID:22228805 Psmb6 Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of PSMB6 mRNA CTD PMID:15651846 Psmb6 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of PSMB6 mRNA CTD PMID:21318169 Psmb6 Rat bis(2-ethylhexyl) phthalate increases expression ISO Psmb6 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PSMB6 mRNA CTD PMID:33754040 Psmb6 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PSMB6 mRNA CTD PMID:25181051 Psmb6 Rat bisphenol A increases expression ISO PSMB6 (Homo sapiens) 6480464 bisphenol A results in increased expression of PSMB6 protein CTD PMID:37567409 Psmb6 Rat bisphenol A decreases expression ISO Psmb6 (Mus musculus) 6480464 bisphenol A results in decreased expression of PSMB6 mRNA CTD PMID:33221593 Psmb6 Rat bisphenol AF increases expression ISO PSMB6 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PSMB6 protein CTD PMID:34186270 Psmb6 Rat Bisphenol B increases expression ISO PSMB6 (Homo sapiens) 6480464 bisphenol B results in increased expression of PSMB6 protein CTD PMID:34186270 Psmb6 Rat bisphenol F decreases expression ISO Psmb6 (Mus musculus) 6480464 bisphenol F results in decreased expression of PSMB6 mRNA CTD PMID:38685157 Psmb6 Rat bisphenol F increases expression ISO PSMB6 (Homo sapiens) 6480464 bisphenol F results in increased expression of PSMB6 protein CTD PMID:34186270 Psmb6 Rat cadmium atom multiple interactions ISO PSMB6 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PSMB6 mRNA CTD PMID:35301059 Psmb6 Rat cadmium dichloride multiple interactions ISO PSMB6 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PSMB6 mRNA CTD PMID:35301059 Psmb6 Rat chloropicrin affects expression ISO PSMB6 (Homo sapiens) 6480464 chloropicrin affects the expression of PSMB6 mRNA CTD PMID:26352163 Psmb6 Rat cisplatin multiple interactions ISO PSMB6 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PSMB6 mRNA CTD PMID:27392435 Psmb6 Rat cisplatin increases expression ISO PSMB6 (Homo sapiens) 6480464 Cisplatin results in increased expression of PSMB6 mRNA CTD PMID:27392435 Psmb6 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of PSMB6 mRNA CTD PMID:21318169 Psmb6 Rat cobalt dichloride increases expression ISO PSMB6 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of PSMB6 mRNA CTD PMID:19376846 Psmb6 Rat cyclosporin A increases expression ISO PSMB6 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PSMB6 mRNA CTD PMID:20106945 Psmb6 Rat cyclosporin A decreases expression ISO PSMB6 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PSMB6 mRNA CTD PMID:27989131 Psmb6 Rat diarsenic trioxide increases expression ISO PSMB6 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PSMB6 mRNA CTD PMID:12852829 and PMID:29633893 Psmb6 Rat diarsenic trioxide multiple interactions ISO PSMB6 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PSMB6 protein] CTD PMID:26598702 Psmb6 Rat dibenzo[a,l]pyrene decreases expression ISO Psmb6 (Mus musculus) 6480464 dibenzo(a and l)pyrene results in decreased expression of PSMB6 mRNA CTD PMID:25908611 Psmb6 Rat Dibutyl phosphate affects expression ISO PSMB6 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PSMB6 mRNA CTD PMID:37042841 Psmb6 Rat dibutyl phthalate decreases expression ISO Psmb6 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PSMB6 mRNA CTD PMID:17361019 Psmb6 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of PSMB6 mRNA CTD PMID:18636392 Psmb6 Rat doxorubicin increases expression ISO PSMB6 (Homo sapiens) 6480464 Doxorubicin results in increased expression of PSMB6 mRNA CTD PMID:29803840 Psmb6 Rat epoxomicin increases expression ISO PSMB6 (Homo sapiens) 6480464 epoxomicin results in increased expression of PSMB6 mRNA CTD PMID:27345029 Psmb6 Rat epoxomicin multiple interactions ISO PSMB6 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [epoxomicin results in increased expression of PSMB6 mRNA] more ... CTD PMID:27345029 Psmb6 Rat fenthion decreases expression ISO Psmb6 (Mus musculus) 6480464 Fenthion results in decreased expression of PSMB6 mRNA CTD PMID:34813904 Psmb6 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PSMB6 mRNA CTD PMID:24136188 Psmb6 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of PSMB6 mRNA CTD PMID:18035473 Psmb6 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PSMB6 mRNA CTD PMID:24136188 Psmb6 Rat furfural multiple interactions ISO PSMB6 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PSMB6 protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of PSMB6 protein CTD PMID:38598786 Psmb6 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PSMB6 mRNA CTD PMID:33387578 Psmb6 Rat heparin decreases expression ISO PSMB6 (Homo sapiens) 6480464 Heparin analog results in decreased expression of PSMB6 mRNA CTD PMID:26476401 Psmb6 Rat hydralazine multiple interactions ISO PSMB6 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PSMB6 mRNA CTD PMID:17183730 Psmb6 Rat isobutanol multiple interactions ISO PSMB6 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of PSMB6 mRNA CTD PMID:29432896 Psmb6 Rat ivermectin decreases expression ISO PSMB6 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PSMB6 protein CTD PMID:32959892 Psmb6 Rat L-ascorbic acid multiple interactions ISO PSMB6 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [epoxomicin results in increased expression of PSMB6 mRNA] and Ascorbic Acid inhibits the reaction [Rotenone results in increased expression of PSMB6 mRNA] CTD PMID:27345029 Psmb6 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of PSMB6 mRNA CTD PMID:24136188 Psmb6 Rat methidathion decreases expression ISO Psmb6 (Mus musculus) 6480464 methidathion results in decreased expression of PSMB6 mRNA CTD PMID:34813904 Psmb6 Rat microcystin RR decreases expression ISO PSMB6 (Homo sapiens) 6480464 microcystin RR results in decreased expression of PSMB6 protein CTD PMID:19111056 Psmb6 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO PSMB6 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of PSMB6 mRNA CTD PMID:31806706 Psmb6 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PSMB6 mRNA CTD PMID:24136188 Psmb6 Rat nicotine decreases expression ISO PSMB6 (Homo sapiens) 6480464 Nicotine results in decreased expression of PSMB6 mRNA CTD PMID:18247414 Psmb6 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PSMB6 mRNA CTD PMID:24136188 Psmb6 Rat nitrates multiple interactions ISO Psmb6 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PSMB6 mRNA CTD PMID:35964746 Psmb6 Rat O-acetyl-L-carnitine increases expression EXP 6480464 Acetylcarnitine results in increased expression of PSMB6 mRNA CTD PMID:14654561 Psmb6 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of PSMB6 mRNA CTD PMID:23358140 Psmb6 Rat ouabain affects expression ISO PSMB6 (Homo sapiens) 6480464 Ouabain affects the expression of PSMB6 protein CTD PMID:17268060 Psmb6 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of PSMB6 mRNA CTD PMID:18636392 Psmb6 Rat ozone multiple interactions ISO Psmb6 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PSMB6 mRNA CTD PMID:34911549 Psmb6 Rat paclitaxel affects response to substance ISO PSMB6 (Homo sapiens) 6480464 PSMB6 protein affects the susceptibility to Paclitaxel CTD PMID:16217747 Psmb6 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PSMB6 mRNA CTD PMID:33387578 Psmb6 Rat perfluorooctane-1-sulfonic acid affects expression ISO Psmb6 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of PSMB6 mRNA CTD PMID:19429403 Psmb6 Rat perfluorooctane-1-sulfonic acid increases expression ISO PSMB6 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of PSMB6 mRNA CTD PMID:27153767 Psmb6 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Psmb6 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMB6 mRNA more ... CTD PMID:20936131 and PMID:36331819 Psmb6 Rat perfluorooctane-1-sulfonic acid increases expression ISO Psmb6 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of PSMB6 mRNA CTD PMID:20936131 Psmb6 Rat perfluorooctanoic acid increases expression ISO Psmb6 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of PSMB6 mRNA CTD PMID:18467677 Psmb6 Rat perfluorooctanoic acid multiple interactions ISO Psmb6 (Mus musculus) 6480464 PPARA protein promotes the reaction [perfluorooctanoic acid results in increased expression of PSMB6 mRNA] CTD PMID:18467677 Psmb6 Rat perfluorooctanoic acid affects expression ISO Psmb6 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of PSMB6 mRNA CTD PMID:19429403 Psmb6 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of PSMB6 mRNA CTD PMID:19162173 Psmb6 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of PSMB6 mRNA CTD PMID:15215175 Psmb6 Rat picoxystrobin increases expression ISO PSMB6 (Homo sapiens) 6480464 picoxystrobin results in increased expression of PSMB6 mRNA CTD PMID:33512557 Psmb6 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of PSMB6 mRNA CTD PMID:22484513 Psmb6 Rat pirinixic acid multiple interactions ISO Psmb6 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of PSMB6 mRNA] CTD PMID:18467677 Psmb6 Rat pirinixic acid increases expression ISO Psmb6 (Mus musculus) 6480464 pirinixic acid results in increased expression of PSMB6 mRNA CTD PMID:15375163 more ... Psmb6 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of PSMB6 mRNA CTD PMID:19162173 and PMID:21318169 Psmb6 Rat quercitrin decreases expression ISO PSMB6 (Homo sapiens) 6480464 quercitrin results in decreased expression of PSMB6 mRNA CTD PMID:25193878 Psmb6 Rat rac-lactic acid decreases expression ISO PSMB6 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PSMB6 mRNA CTD PMID:30851411 Psmb6 Rat resveratrol multiple interactions ISO PSMB6 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of PSMB6 mRNA and [Plant Extracts co-treated with Resveratrol] results in increased expression of PSMB6 mRNA CTD PMID:23557933 Psmb6 Rat rotenone decreases expression ISO Psmb6 (Mus musculus) 6480464 Rotenone results in decreased expression of PSMB6 mRNA CTD PMID:23186747 Psmb6 Rat rotenone multiple interactions ISO PSMB6 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [Rotenone results in increased expression of PSMB6 mRNA] more ... CTD PMID:27345029 Psmb6 Rat rotenone increases expression ISO PSMB6 (Homo sapiens) 6480464 Rotenone results in increased expression of PSMB6 mRNA CTD PMID:27345029 and PMID:33512557 Psmb6 Rat sodium arsenite increases expression ISO PSMB6 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PSMB6 mRNA CTD PMID:34032870 and PMID:38568856 Psmb6 Rat sodium arsenite multiple interactions ISO PSMB6 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PSMB6 mRNA CTD PMID:39836092 Psmb6 Rat sodium chloride multiple interactions ISO PSMB6 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PSMB6 protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of PSMB6 protein CTD PMID:38598786 Psmb6 Rat stattic decreases expression ISO PSMB6 (Homo sapiens) 6480464 stattic results in decreased expression of PSMB6 mRNA and stattic results in decreased expression of PSMB6 protein CTD PMID:24627483 Psmb6 Rat sulforaphane multiple interactions ISO PSMB6 (Homo sapiens) 6480464 sulforaphane inhibits the reaction [epoxomicin results in increased expression of PSMB6 mRNA] CTD PMID:27345029 Psmb6 Rat tetrachloromethane affects expression ISO Psmb6 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of PSMB6 mRNA CTD PMID:17484886 Psmb6 Rat triphenyl phosphate affects expression ISO PSMB6 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PSMB6 mRNA CTD PMID:37042841 Psmb6 Rat tungsten increases expression ISO Psmb6 (Mus musculus) 6480464 Tungsten results in increased expression of PSMB6 mRNA CTD PMID:30912803 Psmb6 Rat tunicamycin multiple interactions ISO Psmb6 (Mus musculus) 6480464 NFE2L2 mRNA affects the reaction [Tunicamycin results in increased expression of PSMB6 mRNA] CTD PMID:22959925 Psmb6 Rat tunicamycin increases expression ISO Psmb6 (Mus musculus) 6480464 Tunicamycin results in increased expression of PSMB6 mRNA CTD PMID:22959925 Psmb6 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of PSMB6 mRNA CTD PMID:24136188 Psmb6 Rat valproic acid multiple interactions ISO PSMB6 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PSMB6 mRNA CTD PMID:17183730 Psmb6 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of PSMB6 mRNA CTD PMID:21318169 Psmb6 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PSMB6 mRNA CTD PMID:23555832 Psmb6 Rat vitamin E increases expression ISO PSMB6 (Homo sapiens) 6480464 Vitamin E results in increased expression of PSMB6 mRNA CTD PMID:19244175
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2,4-trimethylbenzene (EXP) 1,3-dinitrobenzene (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 2-naphthylamine (ISO) 3-methylcholanthrene (ISO) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenic trichloride (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) chloropicrin (ISO) cisplatin (ISO) clofibrate (EXP) cobalt dichloride (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dichlorine (EXP) doxorubicin (ISO) epoxomicin (ISO) fenthion (ISO) finasteride (EXP) flavonoids (EXP) flutamide (EXP) furfural (ISO) gentamycin (EXP) heparin (ISO) hydralazine (ISO) isobutanol (ISO) ivermectin (ISO) L-ascorbic acid (ISO) leflunomide (EXP) methidathion (ISO) microcystin RR (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nefazodone (EXP) nicotine (ISO) nimesulide (EXP) nitrates (ISO) O-acetyl-L-carnitine (EXP) ochratoxin A (EXP) ouabain (ISO) ozone (EXP,ISO) paclitaxel (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP) PhIP (EXP) picoxystrobin (ISO) piperonyl butoxide (EXP) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) quercitrin (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (ISO) sodium arsenite (ISO) sodium chloride (ISO) stattic (ISO) sulforaphane (ISO) tetrachloromethane (ISO) triphenyl phosphate (ISO) tungsten (ISO) tunicamycin (ISO) valdecoxib (EXP) valproic acid (EXP,ISO) vinclozolin (EXP) vitamin E (ISO)
Psmb6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 55,737,852 - 55,740,218 (+) NCBI GRCr8 mRatBN7.2 10 55,239,256 - 55,241,586 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 55,239,241 - 55,241,586 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 59,919,232 - 59,921,558 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 59,407,737 - 59,410,063 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 54,906,829 - 54,909,155 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 57,131,339 - 57,133,685 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 57,131,386 - 57,133,637 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 56,888,972 - 56,891,279 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 57,370,397 - 57,372,704 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 57,384,019 - 57,386,327 (+) NCBI Celera 10 54,385,536 - 54,387,843 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
PSMB6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 4,796,164 - 4,798,495 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 4,796,144 - 4,798,502 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 4,699,459 - 4,701,790 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 4,646,415 - 4,648,748 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 4,646,414 - 4,648,746 NCBI Celera 17 4,714,866 - 4,717,199 (+) NCBI Celera Cytogenetic Map 17 p13.2 NCBI HuRef 17 4,587,894 - 4,590,253 (+) NCBI HuRef CHM1_1 17 4,708,411 - 4,710,770 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 4,686,019 - 4,688,350 (+) NCBI T2T-CHM13v2.0
Psmb6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 70,416,116 - 70,418,684 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 70,416,193 - 70,418,684 (+) Ensembl GRCm39 Ensembl GRCm38 11 70,525,324 - 70,527,858 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 70,525,367 - 70,527,858 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 70,338,859 - 70,341,360 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 70,341,595 - 70,343,844 (+) NCBI MGSCv36 mm8 Celera 11 78,073,676 - 78,076,176 (+) NCBI Celera Cytogenetic Map 11 B3 NCBI cM Map 11 42.99 NCBI
Psmb6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 10,220,285 - 10,222,659 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 10,220,435 - 10,222,470 (+) NCBI ChiLan1.0 ChiLan1.0
PSMB6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 12,404,642 - 12,407,141 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 14,373,150 - 14,375,487 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 4,842,978 - 4,845,321 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 4,832,225 - 4,834,549 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 4,831,981 - 4,834,549 (+) Ensembl panpan1.1 panPan2
PSMB6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 31,776,286 - 31,778,789 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 31,776,293 - 31,778,682 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 31,915,750 - 31,918,255 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 31,881,502 - 31,884,007 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 31,881,509 - 31,883,900 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 31,847,683 - 31,850,185 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 31,807,355 - 31,809,858 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 31,983,746 - 31,986,251 (-) NCBI UU_Cfam_GSD_1.0
Psmb6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 53,005,091 - 53,007,195 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936677 2,893,737 - 2,896,380 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936677 2,893,780 - 2,895,870 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PSMB6
PSMB6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 4,272,009 - 4,274,451 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 4,272,081 - 4,274,555 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 17,363,157 - 17,365,516 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Psmb6
.
Predicted Target Of
Count of predictions: 80 Count of miRNA genes: 67 Interacting mature miRNAs: 71 Transcripts: ENSRNOT00000026507 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1578762 Toxo1 Toxoplasma gondii resistance QTL 1 brain integrity trait (VT:0010579) percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028) 10 52200030 59378278 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 1354585 Eae18a Experimental allergic encephalomyelitis QTL 18a 7.5 0.0004 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 10 53797385 58445852 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
105
82
81
50
25
50
6
202
97
85
38
54
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026507 ⟹ ENSRNOP00000026507
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 55,239,241 - 55,241,586 (+) Ensembl Rnor_6.0 Ensembl 10 57,131,386 - 57,133,637 (+) Ensembl
RefSeq Acc Id:
NM_057099 ⟹ NP_476440
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 55,737,888 - 55,740,218 (+) NCBI mRatBN7.2 10 55,239,256 - 55,241,586 (+) NCBI Rnor_6.0 10 57,131,378 - 57,133,685 (+) NCBI Rnor_5.0 10 56,888,972 - 56,891,279 (+) NCBI RGSC_v3.4 10 57,370,397 - 57,372,704 (+) RGD Celera 10 54,385,536 - 54,387,843 (+) RGD
Sequence:
AGAGGAAGATGGCGGCCGCCTTAGCTGTTCGTGGAGCCGTCTCTGCACCGGCCTTTGGGCCGGAGGCGCTCACTCCAGACTGGGAAAACCGAGAAGTCTCCACAGGGACCACGATCATGGCTGTGCAA
hide sequence
RefSeq Acc Id:
XM_063268842 ⟹ XP_063124912
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 55,737,852 - 55,740,218 (+) NCBI
RefSeq Acc Id:
NP_476440 ⟸ NM_057099
- UniProtKB:
Q6IE68 (UniProtKB/Swiss-Prot), Q6PDW5 (UniProtKB/Swiss-Prot), P28073 (UniProtKB/Swiss-Prot), A6HG61 (UniProtKB/TrEMBL), A6HG62 (UniProtKB/TrEMBL)
- Sequence:
MAAALAVRGAVSAPAFGPEALTPDWENREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLM
hide sequence
Ensembl Acc Id:
ENSRNOP00000026507 ⟸ ENSRNOT00000026507
RefSeq Acc Id:
XP_063124912 ⟸ XM_063268842
- Peptide Label:
isoform X1
RGD ID: 13697362 Promoter ID: EPDNEW_R7886 Type: multiple initiation site Name: Psmb6_1 Description: proteasome subunit beta 6 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 57,131,373 - 57,131,433 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-09-13
Psmb6
proteasome 20S subunit beta 6
Psmb6
proteasome subunit beta 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-08-19
Psmb6
proteasome subunit beta 6
Psmb6
proteasome (prosome, macropain) subunit, beta type 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Psmb6
proteasome (prosome, macropain) subunit, beta type 6
Name updated
70584 APPROVED
